Q99PN1_MOUSE Loading...

Tripartite motif protein TRIM23

AlphaFold DB , UniProt , Accession Q99PN1, Species MOUSE (Mus musculus, Mouse), Gene Trim23, Length 46 aa.

						>Q99PN1_MOUSE|Q99PN1|Trim23
SNVSHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	47.3	Very low	52.1	Low	164 Å²	164	135.7 Å²	135.7	100%	1.147	77%	0.773	S	S	*	*				0	105.6	0	-29.2	0	0	0	0	108.8
2	N	49.5	Very low	54.4	Low	138 Å²	138	130.3 Å²	130.3	74%	0.738	75%	0.75	S	S	*	*			trans	162.3	6.5	156	-101.8	-61	0	0	0	116.6	S4	N2-S4 VanDerWaalsContact C-N 3.29Å; N2-S4 PolarHBondContact O-N 3.32Å
3	V	55	Low	56.8	Low	136 Å²	136	137.8 Å²	137.8	82%	0.824	76%	0.758	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.5	-16.8	-179.2	131.3	0	0	0	0	113.9
4	S	49.4	Very low	59.1	Low	94 Å²	94	135.2 Å²	135.2	66%	0.657	73%	0.733	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.9	-6.7	-173	-48.2	0	0	0	0	115.2	N2	N2-S4 VanDerWaalsContact C-N 3.29Å; N2-S4 PolarHBondContact O-N 3.32Å
5	H	42.8	Very low	61.3	Low	146 Å²	146	136.9 Å²	136.9	68%	0.676	74%	0.739	S	S	*	*	S	Bend	trans	-91.5	-2	-170.4	-131.2	-118.9	0	0	0	114.7	C9	H5-C9 PolarHBondContact O-SG 3.37Å
6	K	46.5	Very low	63.4	Low	192 Å²	192	132.7 Å²	132.7	84%	0.835	71%	0.713	S	S	*	*	S	Bend	trans	-102.9	-13.4	-177.8	-86.8	-163	168.6	87.8	0	115.2
7	L	49.9	Very low	65.3	Low	147 Å²	147	128.5 Å²	128.5	77%	0.77	71%	0.708	S	S	*	*	S	Bend	trans	-78.6	-21.5	-172.3	-74.5	158.2	0	0	0	113.6
8	C	48.7	Very low	66.8	Low	110 Å²	110	126 Å²	126	74%	0.743	70%	0.7	S	S	*	*	S	Bend	trans	-112.7	-7.5	-172.6	7.7	0	0	0	0	114.5
9	C	54.3	Low	68.2	Low	97 Å²	97	122.9 Å²	122.9	66%	0.655	68%	0.682	S	S	*	*	S	Bend	trans	-96.9	-0.5	-171.6	-53.1	0	0	0	0	114.8	H5	H5-C9 PolarHBondContact O-SG 3.37Å
10	G	59.8	Low	69.3	Low	68 Å²	68	121.8 Å²	121.8	70%	0.701	69%	0.689	S	S	*	*			trans	-103.7	2.1	-167.8	0	0	0	0	0	117
11	R	69.8	Low	70.5	Confident	201 Å²	201	127.4 Å²	127.4	76%	0.758	70%	0.7	S	S	*	*			trans	-101.7	105.5	-179.9	-89.9	179.3	-103.6	-139.1	-4.3	110.6
12	S	80.4	Confident	72.7	Confident	70 Å²	70	123.2 Å²	123.2	49%	0.49	67%	0.671	S	S	.	*			trans	-72.3	139.4	169.5	-44.9	0	0	0	0	109.6	W32 Q36	S12-W32 VanDerWaalsContact O-CH2 3.31Å; S12-W32 WeakPolarHBondContact O-CH2 3.16Å; S12-Q36 PolarHBondContact OG-NE2 3.17Å
13	W	85.3	Confident	74.6	Confident	228 Å²	228	118.4 Å²	118.4	86%	0.864	65%	0.654	S	S	*	*			trans	-119.1	143.9	174.5	-65.1	84.1	0	0	0	108.9
14	Y	89	Confident	76.5	Confident	102 Å²	102	118.7 Å²	118.7	40%	0.4	65%	0.648	S	S	.	*			trans	-142.2	131.8	177.1	176.1	-115.8	0	0	0	108.5	Q16 W32	Y14-Q16 HydrophobicContact CD1-CB 4.22Å; Y14-Q16 HydrophobicContact CE1-CB 3.71Å; Y14-Q16 HydrophobicContact CE1-CG 4.28Å; Y14-Q16 PolarHBondContact OH-OE1 3.49Å; Y14-W32 VanDerWaalsContact CB-CZ2 3.41Å; Y14-W32 HydrophobicContact CD1-CB 3.68Å; Y14-W32 AromaticContact CD1-CD1 3.99Å; Y14-W32 AromaticContact CD1-CD2 3.69Å; Y14-W32 HydrophobicContact CD1-CD2 3.69Å; Y14-W32 HydrophobicContact CD1-CE3 4.05Å; Y14-W32 AromaticContact CD1-CG 3.48Å; Y14-W32 HydrophobicContact CD1-CG 3.48Å; Y14-W32 VanDerWaalsContact CD1-CG 3.48Å; Y14-W32 HydrophobicContact CE1-CB 3.91Å; Y14-W32 HydrophobicContact CE1-CG 4.14Å; Y14-W32 HydrophobicContact CG-CB 4.4Å; Y14-W32 AromaticContact CG-CD1 3.84Å; Y14-W32 AromaticContact CG-CD2 3.79Å; Y14-W32 HydrophobicContact CG-CD2 3.79Å; Y14-W32 AromaticContact CG-CE2 3.95Å; Y14-W32 HydrophobicContact CG-CE3 4.36Å; Y14-W32 AromaticContact CG-CG 3.75Å; Y14-W32 HydrophobicContact CG-CG 3.75Å; Y14-W32 AromaticContact CG-NE1 3.96Å
15	I	92.6	Very high	78.6	Confident	161 Å²	161	114.4 Å²	114.4	83%	0.826	62%	0.618	S	S	*	*			trans	-107.7	117.4	179.3	-60.1	174.3	0	0	0	106.5
16	Q	94.8	Very high	81	Confident	69 Å²	69	112.1 Å²	112.1	32%	0.322	61%	0.61	S	S	.	*			trans	-115.8	120.8	176.5	-177.3	57.3	1.1	0	0	109.6	Y14 C18 G25 E28	Y14-Q16 HydrophobicContact CD1-CB 4.22Å; Y14-Q16 HydrophobicContact CE1-CB 3.71Å; Y14-Q16 HydrophobicContact CE1-CG 4.28Å; Y14-Q16 PolarHBondContact OH-OE1 3.49Å; Q16-C18 PolarHBondContact O-N 3.04Å; Q16-G25 WeakPolarHBondContact CG-O 3.37Å; Q16-G25 VanDerWaalsContact NE2-CA 3.27Å; Q16-E28 HydrophobicContact CG-CB 4.44Å
17	G	95	Very high	83.2	Confident	61 Å²	61	111.3 Å²	111.3	63%	0.629	60%	0.603	S	S	*	*			trans	-65.9	131.5	168.4	0	0	0	0	0	108.9
18	C	92.1	Very high	85.4	Confident	84 Å²	84	108.6 Å²	108.6	57%	0.568	59%	0.587	S	S	*	*			trans	-133.5	149.6	174.7	100.7	0	0	0	0	111.7	Q16 M24	Q16-C18 PolarHBondContact O-N 3.04Å; C18-M24 CarbonylContact C-O 3.55Å; C18-M24 WeakPolarHBondContact CA-O 3.44Å; C18-M24 VanDerWaalsContact CB-O 3.27Å; C18-M24 WeakPolarHBondContact CB-O 3.44Å
19	D	94.1	Very high	87.5	Confident	68 Å²	68	104.3 Å²	104.3	36%	0.364	56%	0.561	S	S	.	*			trans	-112.9	118.4	168.1	169.2	24.9	0	0	0	109.4	R21 S22 G23 M24	D19-R21 PolarHBondContact O-N 3.01Å; D19-R21 PolarHBondContact OD1-N 3.27Å; D19-S22 WeakPolarHBondContact CB-OG 3.23Å; D19-S22 VanDerWaalsContact CG-OG 3.29Å; D19-S22 VanDerWaalsContact OD2-CB 3.27Å; D19-S22 WeakPolarHBondContact OD2-CB 3.41Å; D19-S22 PolarHBondContact OD2-N 3.17Å; D19-S22 VanDerWaalsContact OD2-N 3.15Å; D19-S22 PolarHBondContact OD2-OG 3.34Å; D19-G23 VanDerWaalsContact O-CA 3.24Å; D19-G23 WeakPolarHBondContact O-CA 3.46Å; D19-G23 PolarHBondContact O-N 3.33Å; D19-M24 HydrophobicContact CB-CB 4.48Å; D19-M24 PolarHBondContact N-O 2.71Å; D19-M24 PolarHBondContact O-N 2.93Å
20	A	89.6	Confident	89.4	Confident	99 Å²	99	104.4 Å²	104.4	82%	0.818	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.8	-22.5	-179.3	0	0	0	0	0	113.6
21	R	93.6	Very high	91.1	Very high	240 Å²	240	103.6 Å²	103.6	91%	0.906	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82	-44.9	-179.5	-66.7	-176.1	-179.2	133.9	-1.3	112.5	D19	D19-R21 PolarHBondContact O-N 3.01Å; D19-R21 PolarHBondContact OD1-N 3.27Å
22	S	93.9	Very high	92.2	Very high	77 Å²	77	97.1 Å²	97.1	54%	0.538	51%	0.509	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.9	-16.5	178.5	60.7	0	0	0	0	113.5	D19 M24	D19-S22 WeakPolarHBondContact CB-OG 3.23Å; D19-S22 VanDerWaalsContact CG-OG 3.29Å; D19-S22 VanDerWaalsContact OD2-CB 3.27Å; D19-S22 WeakPolarHBondContact OD2-CB 3.41Å; D19-S22 PolarHBondContact OD2-N 3.17Å; D19-S22 VanDerWaalsContact OD2-N 3.15Å; D19-S22 PolarHBondContact OD2-OG 3.34Å; S22-M24 PolarHBondContact O-N 3.38Å; S22-M24 WeakPolarHBondContact OG-CB 3.29Å; S22-M24 PolarHBondContact OG-N 3.38Å
23	G	90.2	Very high	92.7	Very high	37 Å²	37	97.5 Å²	97.5	38%	0.381	51%	0.506	S	S	.	.			trans	74.3	6.1	-172.6	0	0	0	0	0	113.6	D19 G25 L26	D19-G23 VanDerWaalsContact O-CA 3.24Å; D19-G23 WeakPolarHBondContact O-CA 3.46Å; D19-G23 PolarHBondContact O-N 3.33Å; G23-G25 PolarHBondContact O-N 3.49Å; G23-L26 WeakPolarHBondContact O-CB 3.28Å; G23-L26 PolarHBondContact O-N 2.86Å
24	M	95.4	Very high	93.1	Very high	142 Å²	142	89.1 Å²	89.1	70%	0.7	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.7	135.4	179.5	-173.9	-174.1	-74.5	0	0	109.9	C18 D19 S22 L26	C18-M24 CarbonylContact C-O 3.55Å; C18-M24 WeakPolarHBondContact CA-O 3.44Å; C18-M24 VanDerWaalsContact CB-O 3.27Å; C18-M24 WeakPolarHBondContact CB-O 3.44Å; D19-M24 HydrophobicContact CB-CB 4.48Å; D19-M24 PolarHBondContact N-O 2.71Å; D19-M24 PolarHBondContact O-N 2.93Å; S22-M24 PolarHBondContact O-N 3.38Å; S22-M24 WeakPolarHBondContact OG-CB 3.29Å; S22-M24 PolarHBondContact OG-N 3.38Å; M24-L26 PolarHBondContact O-N 3.35Å
25	G	93	Very high	93	Very high	3 Å²	3	91.5 Å²	91.5	3%	0.031	49%	0.49	C	S	.	.	T	Hydrogen-bonded Turn	trans	79.9	-10.4	174.8	0	0	0	0	0	115.4	Q16 G23 E28 G29	Q16-G25 WeakPolarHBondContact CG-O 3.37Å; Q16-G25 VanDerWaalsContact NE2-CA 3.27Å; G23-G25 PolarHBondContact O-N 3.49Å; G25-E28 WeakPolarHBondContact CA-OE2 3.43Å; G25-E28 PolarHBondContact N-OE2 3.24Å; G25-G29 PolarHBondContact O-N 3.3Å
26	L	92.6	Very high	92.8	Very high	99 Å²	99	86.7 Å²	86.7	52%	0.518	46%	0.464	S	S	.	.	H	α-helix	trans	-67.7	-45.1	178	-177.8	63	0	0	0	111.3	G23 M24 G29 L30	G23-L26 WeakPolarHBondContact O-CB 3.28Å; G23-L26 PolarHBondContact O-N 2.86Å; M24-L26 PolarHBondContact O-N 3.35Å; L26-G29 PolarHBondContact O-N 3.42Å; L26-L30 HydrophobicContact CD1-CD1 4.06Å; L26-L30 HydrophobicContact CD1-CG 4.23Å; L26-L30 HydrophobicContact CG-CD1 3.96Å; L26-L30 HydrophobicContact CG-CG 4.48Å; L26-L30 WeakPolarHBondContact O-CB 3.44Å; L26-L30 VanDerWaalsContact O-CG 3.28Å; L26-L30 WeakPolarHBondContact O-CG 3.31Å; L26-L30 PolarHBondContact O-N 2.92Å
27	Y	94.3	Very high	92.4	Very high	174 Å²	174	86.8 Å²	86.8	68%	0.682	47%	0.466	S	S	*	.	H	α-helix	trans	-61.9	-46.9	-178.7	-179.7	-93.5	0	0	0	111.4	G29 L30 D31	Y27-G29 VanDerWaalsContact C-N 3.34Å; Y27-G29 PolarHBondContact O-N 3.1Å; Y27-L30 PolarHBondContact O-N 3.26Å; Y27-D31 HydrophobicContact CE1-CB 4.49Å; Y27-D31 WeakPolarHBondContact O-CB 3.46Å; Y27-D31 PolarHBondContact O-N 3.36Å
28	E	94.5	Very high	91.9	Very high	91 Å²	91	88.4 Å²	88.4	43%	0.425	46%	0.464	S	S	.	.	H	α-helix	trans	-63.1	-40	179.5	-65.3	80.8	-179.7	0	0	112.1	Q16 G25 W32	Q16-E28 HydrophobicContact CG-CB 4.44Å; G25-E28 WeakPolarHBondContact CA-OE2 3.43Å; G25-E28 PolarHBondContact N-OE2 3.24Å; E28-W32 WeakPolarHBondContact O-CB 3.47Å; E28-W32 PolarHBondContact O-N 3.27Å
29	G	94.1	Very high	91.3	Very high	19 Å²	19	88.4 Å²	88.4	20%	0.196	47%	0.47	C	S	.	.	H	α-helix	trans	-65.6	-41.1	176.4	0	0	0	0	0	112.7	G25 L26 Y27 L33	G25-G29 PolarHBondContact O-N 3.3Å; L26-G29 PolarHBondContact O-N 3.42Å; Y27-G29 VanDerWaalsContact C-N 3.34Å; Y27-G29 PolarHBondContact O-N 3.1Å; G29-L33 WeakPolarHBondContact O-CB 3.49Å; G29-L33 PolarHBondContact O-N 3.22Å
30	L	93.9	Very high	90.6	Very high	100 Å²	100	88.5 Å²	88.5	52%	0.524	48%	0.48	S	S	.	.	H	α-helix	trans	-71.7	-39.6	177.5	-68.7	176.1	0	0	0	112.4	L26 Y27 L33 S34	L26-L30 HydrophobicContact CD1-CD1 4.06Å; L26-L30 HydrophobicContact CD1-CG 4.23Å; L26-L30 HydrophobicContact CG-CD1 3.96Å; L26-L30 HydrophobicContact CG-CG 4.48Å; L26-L30 WeakPolarHBondContact O-CB 3.44Å; L26-L30 VanDerWaalsContact O-CG 3.28Å; L26-L30 WeakPolarHBondContact O-CG 3.31Å; L26-L30 PolarHBondContact O-N 2.92Å; Y27-L30 PolarHBondContact O-N 3.26Å; L30-L33 PolarHBondContact O-N 3.48Å; L30-S34 WeakPolarHBondContact O-CB 3.24Å; L30-S34 PolarHBondContact O-N 3.26Å
31	D	94.4	Very high	89.5	Confident	50 Å²	50	86.3 Å²	86.3	27%	0.267	47%	0.467	S	S	.	.	H	α-helix	trans	-61	-46	175	178.6	65.5	0	0	0	110.6	Y27 L33 S34 R35	Y27-D31 HydrophobicContact CE1-CB 4.49Å; Y27-D31 WeakPolarHBondContact O-CB 3.46Å; Y27-D31 PolarHBondContact O-N 3.36Å; D31-L33 PolarHBondContact O-N 3.02Å; D31-S34 PolarHBondContact O-N 2.67Å; D31-S34 PolarHBondContact O-OG 3.26Å; D31-R35 WeakPolarHBondContact O-CG 3.03Å; D31-R35 PolarHBondContact O-N 3.06Å; D31-R35 IonicContact OD1-NE 3.06Å; D31-R35 IonicContact OD1-NH2 2.67Å; D31-R35 IonicContact OD2-CZ 3.67Å; D31-R35 IonicContact OD2-NE 3.1Å; D31-R35 PolarHBondContact OD2-NE 3.01Å; D31-R35 IonicContact OD2-NH2 3.64Å; D31-R35 PolarHBondContact OD2-NH2 3.06Å
32	W	93.6	Very high	88.1	Confident	66 Å²	66	79.7 Å²	79.7	25%	0.25	45%	0.453	C	S	.	.	H	α-helix	trans	-57.6	-49.4	173	175.9	86.3	0	0	0	111.7	S12 Y14 E28 S34 R35 Q36	S12-W32 VanDerWaalsContact O-CH2 3.31Å; S12-W32 WeakPolarHBondContact O-CH2 3.16Å; Y14-W32 VanDerWaalsContact CB-CZ2 3.41Å; Y14-W32 HydrophobicContact CD1-CB 3.68Å; Y14-W32 AromaticContact CD1-CD1 3.99Å; Y14-W32 AromaticContact CD1-CD2 3.69Å; Y14-W32 HydrophobicContact CD1-CD2 3.69Å; Y14-W32 HydrophobicContact CD1-CE3 4.05Å; Y14-W32 AromaticContact CD1-CG 3.48Å; Y14-W32 HydrophobicContact CD1-CG 3.48Å; Y14-W32 VanDerWaalsContact CD1-CG 3.48Å; Y14-W32 HydrophobicContact CE1-CB 3.91Å; Y14-W32 HydrophobicContact CE1-CG 4.14Å; Y14-W32 HydrophobicContact CG-CB 4.4Å; Y14-W32 AromaticContact CG-CD1 3.84Å; Y14-W32 AromaticContact CG-CD2 3.79Å; Y14-W32 HydrophobicContact CG-CD2 3.79Å; Y14-W32 AromaticContact CG-CE2 3.95Å; Y14-W32 HydrophobicContact CG-CE3 4.36Å; Y14-W32 AromaticContact CG-CG 3.75Å; Y14-W32 HydrophobicContact CG-CG 3.75Å; Y14-W32 AromaticContact CG-NE1 3.96Å; E28-W32 WeakPolarHBondContact O-CB 3.47Å; E28-W32 PolarHBondContact O-N 3.27Å; W32-S34 VanDerWaalsContact C-N 3.3Å; W32-S34 PolarHBondContact O-N 3.06Å; W32-R35 PolarHBondContact O-N 3.04Å; W32-Q36 HydrophobicContact CD2-CG 4.04Å; W32-Q36 HydrophobicContact CE3-CG 4.29Å; W32-Q36 HydrophobicContact CH2-CG 3.91Å; W32-Q36 HydrophobicContact CZ2-CG 3.62Å; W32-Q36 HydrophobicContact CZ3-CG 4.23Å; W32-Q36 WeakPolarHBondContact O-CG 3.49Å; W32-Q36 PolarHBondContact O-N 3.37Å
33	L	91.4	Very high	86.3	Confident	78 Å²	78	82 Å²	82	41%	0.408	46%	0.459	S	S	.	.	H	α-helix	trans	-59.3	-41.8	179.8	178.3	62.6	0	0	0	111.7	G29 L30 D31 R35 Q36 L37	G29-L33 WeakPolarHBondContact O-CB 3.49Å; G29-L33 PolarHBondContact O-N 3.22Å; L30-L33 PolarHBondContact O-N 3.48Å; D31-L33 PolarHBondContact O-N 3.02Å; L33-R35 VanDerWaalsContact C-N 3.31Å; L33-R35 PolarHBondContact O-N 2.83Å; L33-Q36 WeakPolarHBondContact O-CB 3.07Å; L33-Q36 PolarHBondContact O-N 3.23Å; L33-Q36 VanDerWaalsContact O-N 3.1Å; L33-L37 HydrophobicContact CD1-CG 4.43Å; L33-L37 HydrophobicContact CG-CD1 4.29Å; L33-L37 HydrophobicContact CG-CG 4.49Å; L33-L37 WeakPolarHBondContact O-CG 3.48Å; L33-L37 PolarHBondContact O-N 3.44Å
34	S	91.9	Very high	84.4	Confident	52 Å²	52	87.2 Å²	87.2	36%	0.364	48%	0.478	S	S	.	.	H	α-helix	trans	-58.6	-42.8	-179.6	78.5	0	0	0	0	112	L30 D31 W32 Q36 L37 V38	L30-S34 WeakPolarHBondContact O-CB 3.24Å; L30-S34 PolarHBondContact O-N 3.26Å; D31-S34 PolarHBondContact O-N 2.67Å; D31-S34 PolarHBondContact O-OG 3.26Å; W32-S34 VanDerWaalsContact C-N 3.3Å; W32-S34 PolarHBondContact O-N 3.06Å; S34-Q36 VanDerWaalsContact C-N 3.31Å; S34-Q36 PolarHBondContact O-N 3.31Å; S34-L37 PolarHBondContact O-N 3.47Å; S34-V38 WeakPolarHBondContact O-CG2 3.39Å; S34-V38 PolarHBondContact O-N 3.15Å
35	R	88.9	Confident	82.3	Confident	152 Å²	152	86.9 Å²	86.9	57%	0.574	48%	0.483	S	S	*	.	H	α-helix	trans	-64.6	-36.9	177.2	-63.5	169.9	-169.7	-156.9	4.3	111.6	D31 W32 L33 V38 A39	D31-R35 WeakPolarHBondContact O-CG 3.03Å; D31-R35 PolarHBondContact O-N 3.06Å; D31-R35 IonicContact OD1-NE 3.06Å; D31-R35 IonicContact OD1-NH2 2.67Å; D31-R35 IonicContact OD2-CZ 3.67Å; D31-R35 IonicContact OD2-NE 3.1Å; D31-R35 PolarHBondContact OD2-NE 3.01Å; D31-R35 IonicContact OD2-NH2 3.64Å; D31-R35 PolarHBondContact OD2-NH2 3.06Å; W32-R35 PolarHBondContact O-N 3.04Å; L33-R35 VanDerWaalsContact C-N 3.31Å; L33-R35 PolarHBondContact O-N 2.83Å; R35-V38 PolarHBondContact O-N 3.49Å; R35-A39 VanDerWaalsContact O-CB 3.29Å; R35-A39 WeakPolarHBondContact O-CB 3.27Å; R35-A39 PolarHBondContact O-N 3.29Å
36	Q	88.3	Confident	79.8	Confident	59 Å²	59	94.4 Å²	94.4	28%	0.276	55%	0.545	S	S	.	.	H	α-helix	trans	-67.2	-38	176.2	-61.7	-52.4	111.6	0	0	112.2	S12 W32 L33 S34 A39 A40	S12-Q36 PolarHBondContact OG-NE2 3.17Å; W32-Q36 HydrophobicContact CD2-CG 4.04Å; W32-Q36 HydrophobicContact CE3-CG 4.29Å; W32-Q36 HydrophobicContact CH2-CG 3.91Å; W32-Q36 HydrophobicContact CZ2-CG 3.62Å; W32-Q36 HydrophobicContact CZ3-CG 4.23Å; W32-Q36 WeakPolarHBondContact O-CG 3.49Å; W32-Q36 PolarHBondContact O-N 3.37Å; L33-Q36 WeakPolarHBondContact O-CB 3.07Å; L33-Q36 PolarHBondContact O-N 3.23Å; L33-Q36 VanDerWaalsContact O-N 3.1Å; S34-Q36 VanDerWaalsContact C-N 3.31Å; S34-Q36 PolarHBondContact O-N 3.31Å; Q36-A39 PolarHBondContact O-N 2.8Å; Q36-A40 VanDerWaalsContact O-CB 3.23Å; Q36-A40 WeakPolarHBondContact O-CB 3.27Å; Q36-A40 PolarHBondContact O-N 3.27Å
37	L	85.1	Confident	79.1	Confident	71 Å²	71	94.2 Å²	94.2	37%	0.372	55%	0.547	S	S	.	.	H	α-helix	trans	-67.9	-40.6	176.8	-65.5	174.3	0	0	0	112	L33 S34 A40 G41 V42	L33-L37 HydrophobicContact CD1-CG 4.43Å; L33-L37 HydrophobicContact CG-CD1 4.29Å; L33-L37 HydrophobicContact CG-CG 4.49Å; L33-L37 WeakPolarHBondContact O-CG 3.48Å; L33-L37 PolarHBondContact O-N 3.44Å; S34-L37 PolarHBondContact O-N 3.47Å; L37-A40 PolarHBondContact O-N 3.39Å; L37-G41 PolarHBondContact O-N 3.44Å; L37-V42 PolarHBondContact O-N 3.02Å
38	V	85.6	Confident	78.3	Confident	96 Å²	96	89.9 Å²	89.9	58%	0.582	54%	0.539	S	S	*	.	H	α-helix	trans	-62.6	-48.5	173.2	173.1	0	0	0	0	110.5	S34 R35 A40 G41	S34-V38 WeakPolarHBondContact O-CG2 3.39Å; S34-V38 PolarHBondContact O-N 3.15Å; R35-V38 PolarHBondContact O-N 3.49Å; V38-A40 PolarHBondContact O-N 3.41Å; V38-G41 PolarHBondContact O-N 3.41Å
39	A	79	Confident	77.4	Confident	83 Å²	83	89.9 Å²	89.9	69%	0.686	55%	0.546	S	S	*	.	H	α-helix	trans	-62.8	-28.9	178	0	0	0	0	0	112.9	R35 Q36 G41	R35-A39 VanDerWaalsContact O-CB 3.29Å; R35-A39 WeakPolarHBondContact O-CB 3.27Å; R35-A39 PolarHBondContact O-N 3.29Å; Q36-A39 PolarHBondContact O-N 2.8Å; A39-G41 VanDerWaalsContact C-N 3.27Å; A39-G41 PolarHBondContact O-N 3.03Å
40	A	78.3	Confident	76.4	Confident	71 Å²	71	94.1 Å²	94.1	59%	0.587	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80	-3.4	175.7	0	0	0	0	0	113.9	Q36 L37 V38 V42	Q36-A40 VanDerWaalsContact O-CB 3.23Å; Q36-A40 WeakPolarHBondContact O-CB 3.27Å; Q36-A40 PolarHBondContact O-N 3.27Å; L37-A40 PolarHBondContact O-N 3.39Å; V38-A40 PolarHBondContact O-N 3.41Å; A40-V42 VanDerWaalsContact C-N 3.25Å; A40-V42 HydrophobicContact CB-CG2 3.94Å; A40-V42 PolarHBondContact O-N 2.92Å
41	G	68.4	Low	75.3	Confident	53 Å²	53	93.7 Å²	93.7	55%	0.546	57%	0.569	S	S	.	*	T	Hydrogen-bonded Turn	trans	70.1	18.2	-179.4	0	0	0	0	0	114.1	L37 V38 A39 L43	L37-G41 PolarHBondContact O-N 3.44Å; V38-G41 PolarHBondContact O-N 3.41Å; A39-G41 VanDerWaalsContact C-N 3.27Å; A39-G41 PolarHBondContact O-N 3.03Å; G41-L43 PolarHBondContact O-N 3.48Å
42	V	62.9	Low	74.1	Confident	100 Å²	100	96.6 Å²	96.6	61%	0.606	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.4	-9	-178.5	-178.6	0	0	0	0	111.9	L37 A40	L37-V42 PolarHBondContact O-N 3.02Å; A40-V42 VanDerWaalsContact C-N 3.25Å; A40-V42 HydrophobicContact CB-CG2 3.94Å; A40-V42 PolarHBondContact O-N 2.92Å
43	L	55.5	Low	72.7	Confident	127 Å²	127	98.8 Å²	98.8	67%	0.665	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.1	38.4	177.6	-110.5	114.6	0	0	0	113.3	G41 V45	G41-L43 PolarHBondContact O-N 3.48Å; L43-V45 VanDerWaalsContact C-N 3.26Å; L43-V45 PolarHBondContact O-N 2.61Å
44	D	51.9	Low	71.2	Confident	146 Å²	146	100.4 Å²	100.4	78%	0.781	63%	0.629	S	S	*	*			trans	-87.8	66.4	160.3	-165.2	-108.9	0	0	0	109.5
45	V	49.8	Very low	69.5	Low	134 Å²	134	104.4 Å²	104.4	81%	0.812	65%	0.651	S	S	*	*			trans	-106.3	96.8	168.6	172.9	0	0	0	0	107.4	L43	L43-V45 VanDerWaalsContact C-N 3.26Å; L43-V45 PolarHBondContact O-N 2.61Å
46	A	40.5	Very low	67.7	Low	161 Å²	161	100.1 Å²	100.1	100%	1.331	66%	0.658	S	S	*	*			trans	-67.3	0	160.1	0	0	0	0	0	111.6

Retrieved 46 of 46 residues in 27.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).