HSPB2_MOUSE Loading...

Isoform 2 of Heat shock protein beta-2 AlphaSync

Canonical isoform description: May regulate the kinase DMPK.

AlphaFold DB , UniProt , Accession Q99PR8-2 (canonical: Q99PR8), Species MOUSE (Mus musculus, Mouse), Gene Hspb2, Length 88 aa.

						>HSPB2_MOUSE|Q99PR8-2|Hspb2
MSGRTVPHAHPATAEYEFANPSRLGEQRFGEDVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEIARVEP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.8	Very low	52.3	Low	242 Å²	242	140.5 Å²	140.5	100%	1.192	80%	0.796	S	S	*	*				0	81.4	0	-68	-162.5	-84.9	0	0	107.7	G3	M1-G3 PolarHBondContact O-N 3.44Å
2	S	50.2	Low	53.3	Low	125 Å²	125	135.3 Å²	135.3	87%	0.874	78%	0.783	S	S	*	*			trans	-74.4	114.7	-179.3	-63.6	0	0	0	0	108	R4	S2-R4 PolarHBondContact O-N 2.82Å
3	G	51.6	Low	54.5	Low	64 Å²	64	129.6 Å²	129.6	66%	0.66	75%	0.752	S	S	*	*			trans	-50.2	122.2	-176.2	0	0	0	0	0	110.3	M1 T5	M1-G3 PolarHBondContact O-N 3.44Å; G3-T5 PolarHBondContact O-N 3.36Å
4	R	52	Low	55.9	Low	247 Å²	247	126.3 Å²	126.3	93%	0.932	75%	0.747	S	S	*	*			trans	-65.4	89.2	166.2	-72.9	175.3	158	167.6	-6.7	106.4	S2 V6	S2-R4 PolarHBondContact O-N 2.82Å; R4-V6 PolarHBondContact O-N 3.16Å
5	T	50.4	Low	57.5	Low	121 Å²	121	128.5 Å²	128.5	74%	0.742	75%	0.747	S	S	*	*	P	Polyproline II helix	trans	-68.4	120.8	168.1	92.8	0	0	0	0	104.7	G3 P7	G3-T5 PolarHBondContact O-N 3.36Å; T5-P7 WeakPolarHBondContact O-CD 3.45Å
6	V	56.4	Low	58.6	Low	129 Å²	129	129.4 Å²	129.4	78%	0.782	74%	0.735	S	S	*	*	P	Polyproline II helix	trans	-64.8	119.6	166.2	-178.7	0	0	0	0	103.7	R4 H8	R4-V6 PolarHBondContact O-N 3.16Å; V6-H8 PolarHBondContact O-N 3.43Å
7	P	50.3	Low	59.7	Low	100 Å²	100	129.4 Å²	129.4	65%	0.649	73%	0.728	S	S	*	*	P	Polyproline II helix	trans	-54.9	118.1	173.4	23.5	-30.9	0	0	0	105.5	T5 A9	T5-P7 WeakPolarHBondContact O-CD 3.45Å; P7-A9 VanDerWaalsContact C-N 3.27Å; P7-A9 PolarHBondContact O-N 3.32Å
8	H	55.5	Low	60.7	Low	166 Å²	166	132.3 Å²	132.3	77%	0.769	73%	0.732	S	S	*	*			trans	-47.9	106	159.4	51.4	-5.6	0	0	0	105.2	V6 H10	V6-H8 PolarHBondContact O-N 3.43Å; H8-H10 PolarHBondContact O-N 3.37Å; H8-H10 VanDerWaalsContact O-N 3.1Å
9	A	56.6	Low	61.7	Low	92 Å²	92	128.9 Å²	128.9	76%	0.76	72%	0.723	S	S	*	*			trans	-52.1	124.8	168.8	0	0	0	0	0	104.4	P7	P7-A9 VanDerWaalsContact C-N 3.27Å; P7-A9 PolarHBondContact O-N 3.32Å
10	H	52	Low	62.6	Low	158 Å²	158	126.3 Å²	126.3	73%	0.731	71%	0.707	S	S	*	*	S	Bend	trans	0.4	128.8	-179.1	-75	-90.6	0	0	0	116.1	H8 A12	H8-H10 PolarHBondContact O-N 3.37Å; H8-H10 VanDerWaalsContact O-N 3.1Å; H10-A12 PolarHBondContact O-N 3.46Å
11	P	56.1	Low	63.1	Low	102 Å²	102	124.8 Å²	124.8	66%	0.662	70%	0.702	S	S	*	*	S	Bend	trans	-43.4	120.8	-178.3	21.9	-33.8	0	0	0	108.6	T13	P11-T13 VanDerWaalsContact C-N 3.34Å; P11-T13 WeakPolarHBondContact O-CA 3.04Å; P11-T13 PolarHBondContact O-N 3.13Å
12	A	65.1	Low	64.8	Low	78 Å²	78	119.3 Å²	119.3	65%	0.645	69%	0.688	S	S	*	*			trans	-35.2	99.6	-167.2	0	0	0	0	0	109.5	H10	H10-A12 PolarHBondContact O-N 3.46Å
13	T	68.6	Low	66.2	Low	61 Å²	61	123.6 Å²	123.6	37%	0.374	69%	0.685	S	S	.	*			trans	-66.7	145.3	-176.1	51.2	0	0	0	0	106.1	P11 E15 Y16 E17	P11-T13 VanDerWaalsContact C-N 3.34Å; P11-T13 WeakPolarHBondContact O-CA 3.04Å; P11-T13 PolarHBondContact O-N 3.13Å; T13-E15 PolarHBondContact O-N 2.89Å; T13-Y16 WeakPolarHBondContact O-CA 3.02Å; T13-Y16 WeakPolarHBondContact O-CB 3.35Å; T13-Y16 PolarHBondContact O-N 3.39Å; T13-Y16 WeakPolarHBondContact OG1-CB 3.48Å; T13-Y16 PolarHBondContact OG1-N 2.91Å; T13-E17 PolarHBondContact O-N 3.07Å
14	A	74.4	Confident	67.4	Low	83 Å²	83	126.9 Å²	126.9	69%	0.686	69%	0.687	S	S	*	*	H	α-helix	trans	-52.3	-32.2	175.1	0	0	0	0	0	111.2	F18	A14-F18 VanDerWaalsContact O-CB 3.29Å; A14-F18 WeakPolarHBondContact O-CB 3.3Å; A14-F18 PolarHBondContact O-N 2.92Å
15	E	79	Confident	68.8	Low	159 Å²	159	118 Å²	118	74%	0.743	67%	0.673	S	S	*	*	H	α-helix	trans	-62.1	-44.6	170.8	-62.7	-179.5	170.1	0	0	113.4	T13 F18 A19	T13-E15 PolarHBondContact O-N 2.89Å; E15-F18 PolarHBondContact O-N 3.42Å; E15-A19 VanDerWaalsContact O-CB 3.3Å; E15-A19 WeakPolarHBondContact O-CB 3.38Å; E15-A19 PolarHBondContact O-N 3.09Å
16	Y	76.1	Confident	70.3	Confident	143 Å²	143	121 Å²	121	56%	0.561	68%	0.678	S	S	*	*	H	α-helix	trans	-67.3	-39.5	177.5	-175.4	-89.8	0	0	0	112.2	T13 A19 N20	T13-Y16 WeakPolarHBondContact O-CA 3.02Å; T13-Y16 WeakPolarHBondContact O-CB 3.35Å; T13-Y16 PolarHBondContact O-N 3.39Å; T13-Y16 WeakPolarHBondContact OG1-CB 3.48Å; T13-Y16 PolarHBondContact OG1-N 2.91Å; Y16-A19 PolarHBondContact O-N 3.24Å; Y16-N20 HydrophobicContact CE1-CB 4.39Å; Y16-N20 VanDerWaalsContact CE2-ND2 3.31Å; Y16-N20 WeakPolarHBondContact CE2-ND2 3.46Å; Y16-N20 VanDerWaalsContact CZ-ND2 3.29Å; Y16-N20 WeakPolarHBondContact O-CB 3.31Å; Y16-N20 PolarHBondContact O-N 2.81Å; Y16-N20 PolarHBondContact O-ND2 2.78Å
17	E	76.8	Confident	71.6	Confident	130 Å²	130	121.3 Å²	121.3	61%	0.607	67%	0.671	S	S	*	*	H	α-helix	trans	-65.8	-41.8	175.1	-175.6	178.1	178.7	0	0	111.4	T13 A19 N20	T13-E17 PolarHBondContact O-N 3.07Å; E17-A19 VanDerWaalsContact C-N 3.35Å; E17-N20 CarbonylContact O-C 3.52Å; E17-N20 PolarHBondContact O-N 2.64Å
18	F	77.1	Confident	73.1	Confident	182 Å²	182	127.3 Å²	127.3	80%	0.798	68%	0.681	S	S	*	*	H	α-helix	trans	-63.7	-40.4	174.8	-176.1	-94.7	0	0	0	112.1	A14 E15 N20	A14-F18 VanDerWaalsContact O-CB 3.29Å; A14-F18 WeakPolarHBondContact O-CB 3.3Å; A14-F18 PolarHBondContact O-N 2.92Å; E15-F18 PolarHBondContact O-N 3.42Å; F18-N20 VanDerWaalsContact C-N 3.3Å; F18-N20 PolarHBondContact O-N 2.93Å
19	A	80.9	Confident	74.3	Confident	68 Å²	68	124 Å²	124	56%	0.562	66%	0.664	S	S	*	*	H	α-helix	trans	-70.5	-25.7	176.7	0	0	0	0	0	113.1	E15 Y16 E17 P21	E15-A19 VanDerWaalsContact O-CB 3.3Å; E15-A19 WeakPolarHBondContact O-CB 3.38Å; E15-A19 PolarHBondContact O-N 3.09Å; Y16-A19 PolarHBondContact O-N 3.24Å; E17-A19 VanDerWaalsContact C-N 3.35Å; A19-P21 WeakPolarHBondContact O-CD 3.41Å
20	N	78.3	Confident	75.5	Confident	75 Å²	75	122.3 Å²	122.3	40%	0.401	66%	0.656	S	S	.	*	S	Bend	trans	-124.4	70.4	179.8	-61.1	-74.8	0	0	0	110.4	Y16 E17 F18 S22	Y16-N20 HydrophobicContact CE1-CB 4.39Å; Y16-N20 VanDerWaalsContact CE2-ND2 3.31Å; Y16-N20 WeakPolarHBondContact CE2-ND2 3.46Å; Y16-N20 VanDerWaalsContact CZ-ND2 3.29Å; Y16-N20 WeakPolarHBondContact O-CB 3.31Å; Y16-N20 PolarHBondContact O-N 2.81Å; Y16-N20 PolarHBondContact O-ND2 2.78Å; E17-N20 CarbonylContact O-C 3.52Å; E17-N20 PolarHBondContact O-N 2.64Å; F18-N20 VanDerWaalsContact C-N 3.3Å; F18-N20 PolarHBondContact O-N 2.93Å; N20-S22 PolarHBondContact O-N 3.26Å
21	P	74.4	Confident	76.8	Confident	95 Å²	95	123.4 Å²	123.4	62%	0.617	66%	0.662	S	S	*	*			trans	-59.8	114.3	179.4	25.5	-33.3	0	0	0	109.2	A19 R23	A19-P21 WeakPolarHBondContact O-CD 3.41Å; P21-R23 PolarHBondContact O-N 2.66Å
22	S	78.7	Confident	78	Confident	128 Å²	128	120.8 Å²	120.8	90%	0.895	64%	0.642	S	S	*	*	S	Bend	trans	-74.1	-11.2	177.1	-62.4	0	0	0	0	112.3	N20	N20-S22 PolarHBondContact O-N 3.26Å
23	R	78.9	Confident	79	Confident	214 Å²	214	118.7 Å²	118.7	81%	0.808	62%	0.621	S	S	*	*	S	Bend	trans	-118.9	124.1	-178.9	-176.7	178.7	-67.8	135.1	-0.6	109.5	P21	P21-R23 PolarHBondContact O-N 2.66Å
24	L	77	Confident	79.8	Confident	133 Å²	133	118.7 Å²	118.7	70%	0.696	62%	0.619	S	S	*	*			trans	-67.3	130	163.5	-60.6	177.1	0	0	0	108.2
25	G	81.6	Confident	80.4	Confident	62 Å²	62	119.5 Å²	119.5	64%	0.639	62%	0.617	S	S	*	*			trans	-61.7	176	175	0	0	0	0	0	112.7	Q27	G25-Q27 PolarHBondContact O-N 3.33Å
26	E	83.3	Confident	80.9	Confident	182 Å²	182	123.4 Å²	123.4	85%	0.85	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-64.7	118.2	175	-64.2	-170.7	153.6	0	0	110.7
27	Q	81.9	Confident	81.5	Confident	137 Å²	137	122.1 Å²	122.1	64%	0.64	62%	0.619	S	S	*	*	P	Polyproline II helix	trans	-94.9	117.9	172.8	-64.3	-150.5	91.5	0	0	110.2	G25	G25-Q27 PolarHBondContact O-N 3.33Å
28	R	83	Confident	82.2	Confident	226 Å²	226	118.2 Å²	118.2	85%	0.853	60%	0.604	S	S	*	*	P	Polyproline II helix	trans	-96.2	116.7	176.7	-69.1	-179.2	155.8	-155.4	-7.4	109.5	G30	R28-G30 PolarHBondContact O-N 3.12Å
29	F	80.6	Confident	83	Confident	96 Å²	96	118.8 Å²	118.8	42%	0.421	60%	0.601	S	S	.	*			trans	-76.6	3.1	179.8	-71.7	-84.6	0	0	0	114.7	V33 L50	F29-V33 HydrophobicContact CB-CB 3.89Å; F29-V33 HydrophobicContact CB-CG1 3.93Å; F29-V33 HydrophobicContact CB-CG2 3.87Å; F29-V33 HydrophobicContact CG-CG1 4.33Å; F29-L50 HydrophobicContact CE1-CB 4.24Å; F29-L50 HydrophobicContact CZ-CB 3.78Å; F29-L50 HydrophobicContact CZ-CD1 3.89Å; F29-L50 HydrophobicContact CZ-CG 4.49Å
30	G	80.9	Confident	83.6	Confident	57 Å²	57	119 Å²	119	59%	0.588	60%	0.603	S	S	*	*			trans	85.1	-178.2	-173	0	0	0	0	0	112.8	R28	R28-G30 PolarHBondContact O-N 3.12Å
31	E	80	Confident	84.4	Confident	181 Å²	181	118 Å²	118	85%	0.846	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.8	152.1	174.8	-62.1	-176.8	120.3	0	0	110.1
32	D	81.7	Confident	85.5	Confident	46 Å²	46	119.5 Å²	119.5	25%	0.246	61%	0.607	C	S	.	*	T	Hydrogen-bonded Turn	trans	74.5	23.3	177.3	-143.1	35.6	0	0	0	115.5	G55 R57	D32-G55 VanDerWaalsContact O-CA 3.31Å; D32-G55 WeakPolarHBondContact O-CA 3.34Å; D32-G55 PolarHBondContact O-N 3.5Å; D32-G55 WeakPolarHBondContact OD2-CA 3.37Å; D32-R57 WeakPolarHBondContact OD1-CG 3.49Å; D32-R57 IonicContact OD1-CZ 3.8Å; D32-R57 IonicContact OD1-NE 2.93Å; D32-R57 PolarHBondContact OD1-NE 3.07Å; D32-R57 IonicContact OD1-NH2 3.83Å; D32-R57 PolarHBondContact OD2-N 2.89Å; D32-R57 IonicContact OD2-NE 3.99Å
33	V	86.2	Confident	86.2	Confident	34 Å²	34	115 Å²	115	21%	0.206	58%	0.576	C	S	.	*	B	Isolated β-bridge	trans	-107.1	124.5	166.2	176.5	0	0	0	0	109.3	F29 P35 V38 A52	F29-V33 HydrophobicContact CB-CB 3.89Å; F29-V33 HydrophobicContact CB-CG1 3.93Å; F29-V33 HydrophobicContact CB-CG2 3.87Å; F29-V33 HydrophobicContact CG-CG1 4.33Å; V33-P35 WeakPolarHBondContact O-CD 3.31Å; V33-V38 HydrophobicContact CG1-CG2 4.38Å; V33-A52 HydrophobicContact CG1-CB 3.47Å; V33-A52 VanDerWaalsContact CG1-CB 3.47Å
34	D	85.3	Confident	87.1	Confident	61 Å²	61	113.3 Å²	113.3	33%	0.326	58%	0.577	S	S	.	*			trans	-80.1	117.1	174.3	178.8	2.6	0	0	0	109.8	W36 R37	D34-W36 PolarHBondContact O-N 2.9Å; D34-W36 VanDerWaalsContact O-N 3.16Å; D34-W36 WeakPolarHBondContact OD1-CB 3.35Å; D34-W36 PolarHBondContact OD1-N 2.87Å; D34-R37 HydrophobicContact CB-CB 4.21Å; D34-R37 HydrophobicContact CB-CG 4.05Å; D34-R37 PolarHBondContact O-N 2.81Å; D34-R37 VanDerWaalsContact OD2-CD 3.28Å; D34-R37 WeakPolarHBondContact OD2-CD 3.45Å; D34-R37 WeakPolarHBondContact OD2-CG 3.48Å
35	P	85.9	Confident	87.9	Confident	101 Å²	101	112.4 Å²	112.4	66%	0.656	57%	0.572	S	S	*	*	G	3₁₀ helix	trans	-56.6	-30.7	178.5	-24.2	34.7	0	0	0	113.6	V33 R37 V38	V33-P35 WeakPolarHBondContact O-CD 3.31Å; P35-R37 PolarHBondContact O-N 2.9Å; P35-V38 WeakPolarHBondContact O-CG2 3.42Å; P35-V38 PolarHBondContact O-N 3.38Å
36	W	89.3	Confident	88.5	Confident	240 Å²	240	112.1 Å²	112.1	91%	0.909	57%	0.57	S	S	*	*	G	3₁₀ helix	trans	-74.6	-14.5	-179.7	-60.5	107.4	0	0	0	113.5	D34	D34-W36 PolarHBondContact O-N 2.9Å; D34-W36 VanDerWaalsContact O-N 3.16Å; D34-W36 WeakPolarHBondContact OD1-CB 3.35Å; D34-W36 PolarHBondContact OD1-N 2.87Å
37	R	90.2	Very high	89	Confident	117 Å²	117	108.2 Å²	108.2	44%	0.442	55%	0.554	S	S	.	*	G	3₁₀ helix	trans	-100.9	-0.2	179.5	-63.7	172.4	72.7	-148.8	4	112.8	D34 P35 P53	D34-R37 HydrophobicContact CB-CB 4.21Å; D34-R37 HydrophobicContact CB-CG 4.05Å; D34-R37 PolarHBondContact O-N 2.81Å; D34-R37 VanDerWaalsContact OD2-CD 3.28Å; D34-R37 WeakPolarHBondContact OD2-CD 3.45Å; D34-R37 WeakPolarHBondContact OD2-CG 3.48Å; P35-R37 PolarHBondContact O-N 2.9Å; R37-P53 HydrophobicContact CB-CG 3.67Å; R37-P53 HydrophobicContact CG-CG 4.42Å; R37-P53 VanDerWaalsContact NE-CG 3.33Å; R37-P53 VanDerWaalsContact NH2-CB 3.31Å; R37-P53 VanDerWaalsContact O-CD 3.32Å; R37-P53 WeakPolarHBondContact O-CD 3.37Å
38	V	91.6	Very high	89.5	Confident	48 Å²	48	106 Å²	106	29%	0.291	55%	0.546	S	S	.	.			trans	-67.6	132.3	173.7	-177.8	0	0	0	0	109.5	V33 P35 E51 A52	V33-V38 HydrophobicContact CG1-CG2 4.38Å; P35-V38 WeakPolarHBondContact O-CG2 3.42Å; P35-V38 PolarHBondContact O-N 3.38Å; V38-E51 CarbonylContact C-O 3.59Å; V38-E51 WeakPolarHBondContact CA-O 3.28Å; V38-A52 HydrophobicContact CB-CB 4.34Å; V38-A52 HydrophobicContact CG2-CB 3.8Å
39	R	93.3	Very high	89.9	Confident	193 Å²	193	98.7 Å²	98.7	73%	0.728	52%	0.524	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-117.2	139.8	175.5	-63.1	-178.7	178.9	-174	-1.7	109	L50 E51	R39-L50 CarbonylContact O-C 3.12Å; R39-L50 WeakPolarHBondContact O-CA 3.49Å; R39-E51 PolarHBondContact N-O 2.81Å; R39-E51 PolarHBondContact O-N 3.2Å
40	A	93.5	Very high	90.5	Very high	74 Å²	74	97.2 Å²	97.2	61%	0.612	52%	0.52	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116	135.1	176.5	0	0	0	0	0	110.1	L48 N49 L50	A40-L48 HydrophobicContact CB-CD1 4.25Å; A40-N49 CarbonylContact C-O 3.6Å; A40-N49 WeakPolarHBondContact CA-O 3.29Å; A40-L50 HydrophobicContact CB-CD2 3.6Å
41	A	95.8	Very high	91	Very high	53 Å²	53	101 Å²	101	44%	0.438	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.8	124.3	174.8	0	0	0	0	0	109.8	N49	A41-N49 PolarHBondContact N-O 2.9Å; A41-N49 PolarHBondContact O-N 2.93Å
42	L	96	Very high	91.4	Very high	127 Å²	127	93.8 Å²	93.8	67%	0.665	49%	0.494	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.3	118.4	172.2	-177.2	64	0	0	0	108.8	L48	L42-L48 HydrophobicContact CD1-CB 4.3Å
43	S	95.3	Very high	91.7	Very high	33 Å²	33	94 Å²	94	23%	0.231	50%	0.497	C	S	.	.			trans	-75.2	161.9	174.4	63	0	0	0	0	111.9	D45 G46 I47	S43-D45 PolarHBondContact O-N 3.48Å; S43-G46 PolarHBondContact O-N 3.24Å; S43-G46 VanDerWaalsContact O-N 3.07Å; S43-I47 PolarHBondContact N-O 2.66Å; S43-I47 WeakPolarHBondContact OG-CA 3.4Å; S43-I47 WeakPolarHBondContact OG-CB 3.32Å; S43-I47 PolarHBondContact OG-N 3.14Å; S43-I47 VanDerWaalsContact OG-N 3.12Å; S43-I47 PolarHBondContact OG-O 3.43Å
44	H	96	Very high	91.5	Very high	178 Å²	178	101.6 Å²	101.6	82%	0.824	52%	0.522	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.8	-25.2	176.7	69.2	-70	0	0	0	113.7	G46	H44-G46 PolarHBondContact O-N 3.43Å
45	D	95.6	Very high	91.2	Very high	114 Å²	114	99.6 Å²	99.6	61%	0.61	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.8	3.3	176.5	-57.9	-50.1	0	0	0	113.2	S43	S43-D45 PolarHBondContact O-N 3.48Å
46	G	93.3	Very high	90.2	Very high	57 Å²	57	98.5 Å²	98.5	59%	0.588	52%	0.523	S	S	*	.	S	Bend	trans	81.7	11.2	180	0	0	0	0	0	114.6	S43 H44	S43-G46 PolarHBondContact O-N 3.24Å; S43-G46 VanDerWaalsContact O-N 3.07Å; H44-G46 PolarHBondContact O-N 3.43Å
47	I	92.9	Very high	88.9	Confident	99 Å²	99	95.2 Å²	95.2	51%	0.508	51%	0.511	S	S	.	.			trans	-89.1	121.8	177.1	-54.3	172	0	0	0	109.6	S43	S43-I47 PolarHBondContact N-O 2.66Å; S43-I47 WeakPolarHBondContact OG-CA 3.4Å; S43-I47 WeakPolarHBondContact OG-CB 3.32Å; S43-I47 PolarHBondContact OG-N 3.14Å; S43-I47 VanDerWaalsContact OG-N 3.12Å; S43-I47 PolarHBondContact OG-O 3.43Å
48	L	92.5	Very high	87.5	Confident	91 Å²	91	97.2 Å²	97.2	48%	0.476	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85	114.1	171.9	178.8	64.3	0	0	0	110.1	A40 L42 L50	A40-L48 HydrophobicContact CB-CD1 4.25Å; L42-L48 HydrophobicContact CD1-CB 4.3Å; L48-L50 HydrophobicContact CG-CD2 4.39Å
49	N	93.2	Very high	86.1	Confident	73 Å²	73	100.5 Å²	100.5	39%	0.39	54%	0.54	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98	133.9	175.9	-63.1	-45.2	0	0	0	110.2	A40 A41	A40-N49 CarbonylContact C-O 3.6Å; A40-N49 WeakPolarHBondContact CA-O 3.29Å; A41-N49 PolarHBondContact N-O 2.9Å; A41-N49 PolarHBondContact O-N 2.93Å
50	L	91.6	Very high	84.6	Confident	65 Å²	65	98.1 Å²	98.1	34%	0.34	54%	0.542	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	121.6	174.4	-59	177.5	0	0	0	108.9	F29 R39 A40 L48	F29-L50 HydrophobicContact CE1-CB 4.24Å; F29-L50 HydrophobicContact CZ-CB 3.78Å; F29-L50 HydrophobicContact CZ-CD1 3.89Å; F29-L50 HydrophobicContact CZ-CG 4.49Å; R39-L50 CarbonylContact O-C 3.12Å; R39-L50 WeakPolarHBondContact O-CA 3.49Å; A40-L50 HydrophobicContact CB-CD2 3.6Å; L48-L50 HydrophobicContact CG-CD2 4.39Å
51	E	91.4	Very high	83.3	Confident	135 Å²	135	99.3 Å²	99.3	63%	0.631	54%	0.541	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122	136.1	-179.6	-67.9	178.2	-161.2	0	0	109.8	V38 R39	V38-E51 CarbonylContact C-O 3.59Å; V38-E51 WeakPolarHBondContact CA-O 3.28Å; R39-E51 PolarHBondContact N-O 2.81Å; R39-E51 PolarHBondContact O-N 3.2Å
52	A	89.2	Confident	82.4	Confident	30 Å²	30	105 Å²	105	25%	0.248	56%	0.559	C	S	.	*			trans	-143	133.1	174.3	0	0	0	0	0	109.7	V33 V38 R54	V33-A52 HydrophobicContact CG1-CB 3.47Å; V33-A52 VanDerWaalsContact CG1-CB 3.47Å; V38-A52 HydrophobicContact CB-CB 4.34Å; V38-A52 HydrophobicContact CG2-CB 3.8Å; A52-R54 PolarHBondContact O-N 3.04Å
53	P	87.2	Confident	81.7	Confident	50 Å²	50	104.8 Å²	104.8	33%	0.325	56%	0.563	S	S	.	*	P	Polyproline II helix	trans	-64.9	131.7	172.1	27.6	-33.1	0	0	0	109.1	R37 G55	R37-P53 HydrophobicContact CB-CG 3.67Å; R37-P53 HydrophobicContact CG-CG 4.42Å; R37-P53 VanDerWaalsContact NE-CG 3.33Å; R37-P53 VanDerWaalsContact NH2-CB 3.31Å; R37-P53 VanDerWaalsContact O-CD 3.32Å; R37-P53 WeakPolarHBondContact O-CD 3.37Å; P53-G55 PolarHBondContact O-N 2.94Å
54	R	83.6	Confident	81.1	Confident	194 Å²	194	109.7 Å²	109.7	73%	0.732	59%	0.587	S	S	*	*	B	Isolated β-bridge	trans	-61.6	138.9	168.5	-63.7	-176.8	69.6	173.4	0.3	108.7	A52 G56	A52-R54 PolarHBondContact O-N 3.04Å; R54-G56 PolarHBondContact O-N 3.26Å
55	G	77.3	Confident	80.8	Confident	19 Å²	19	107.1 Å²	107.1	20%	0.196	58%	0.575	C	S	.	*	P	Polyproline II helix	trans	-52.8	133.2	164.8	0	0	0	0	0	107.7	D32 P53 R57	D32-G55 VanDerWaalsContact O-CA 3.31Å; D32-G55 WeakPolarHBondContact O-CA 3.34Å; D32-G55 PolarHBondContact O-N 3.5Å; D32-G55 WeakPolarHBondContact OD2-CA 3.37Å; P53-G55 PolarHBondContact O-N 2.94Å; G55-R57 PolarHBondContact O-N 3.01Å; G55-R57 VanDerWaalsContact O-N 3.14Å
56	G	65.2	Low	80.5	Confident	78 Å²	78	107 Å²	107	80%	0.804	58%	0.578	S	S	*	*			trans	-85.7	52.1	176.5	0	0	0	0	0	109.5	R54 H58	R54-G56 PolarHBondContact O-N 3.26Å; G56-H58 PolarHBondContact O-N 2.96Å
57	R	63.1	Low	80.3	Confident	171 Å²	171	113.1 Å²	113.1	65%	0.645	59%	0.585	S	S	*	*			trans	-63.6	93.7	145.4	-58.1	-178.1	-150.5	-158.4	3.5	102.2	D32 G55 L59	D32-R57 WeakPolarHBondContact OD1-CG 3.49Å; D32-R57 IonicContact OD1-CZ 3.8Å; D32-R57 IonicContact OD1-NE 2.93Å; D32-R57 PolarHBondContact OD1-NE 3.07Å; D32-R57 IonicContact OD1-NH2 3.83Å; D32-R57 PolarHBondContact OD2-N 2.89Å; D32-R57 IonicContact OD2-NE 3.99Å; G55-R57 PolarHBondContact O-N 3.01Å; G55-R57 VanDerWaalsContact O-N 3.14Å; R57-L59 PolarHBondContact O-N 3.42Å
58	H	60.3	Low	80.2	Confident	159 Å²	159	115.3 Å²	115.3	74%	0.736	60%	0.596	S	S	*	*			trans	-53.4	91	155	-153.8	-104.1	0	0	0	101.3	G56 D60	G56-H58 PolarHBondContact O-N 2.96Å; H58-D60 IonicContact ND1-OD1 3.54Å; H58-D60 PolarHBondContact O-N 3.32Å
59	L	62.4	Low	80.1	Confident	117 Å²	117	116.3 Å²	116.3	61%	0.613	61%	0.61	S	S	*	*			trans	-54.3	116.9	159	-61.8	175.6	0	0	0	99.1	R57 T61	R57-L59 PolarHBondContact O-N 3.42Å; L59-T61 WeakPolarHBondContact CB-OG1 3.36Å; L59-T61 PolarHBondContact O-N 2.74Å
60	D	61.5	Low	79.8	Confident	144 Å²	144	120.5 Å²	120.5	77%	0.77	63%	0.632	S	S	*	*			trans	-63.8	54.9	159.2	-59.8	-44.3	0	0	0	106.2	H58 E62	H58-D60 IonicContact ND1-OD1 3.54Å; H58-D60 PolarHBondContact O-N 3.32Å; D60-E62 PolarHBondContact O-N 3.44Å
61	T	65.5	Low	79.6	Confident	98 Å²	98	124.9 Å²	124.9	60%	0.601	66%	0.655	S	S	*	*			trans	-68.6	88	167.9	-62.2	0	0	0	0	101.6	L59 V63	L59-T61 WeakPolarHBondContact CB-OG1 3.36Å; L59-T61 PolarHBondContact O-N 2.74Å; T61-V63 PolarHBondContact O-N 3.44Å; T61-V63 VanDerWaalsContact O-N 3.09Å
62	E	76.6	Confident	79.2	Confident	173 Å²	173	124 Å²	124	81%	0.808	66%	0.66	S	S	*	*			trans	-41.7	121.1	156.4	-65.7	-176.4	162	0	0	106.1	D60 N64	D60-E62 PolarHBondContact O-N 3.44Å; E62-N64 PolarHBondContact O-N 3.05Å
63	V	81.3	Confident	79	Confident	123 Å²	123	126.8 Å²	126.8	75%	0.745	68%	0.684	S	S	*	*			trans	-60.1	108.8	175.5	174.9	0	0	0	0	105.7	T61 E65	T61-V63 PolarHBondContact O-N 3.44Å; T61-V63 VanDerWaalsContact O-N 3.09Å; V63-E65 HydrophobicContact CG1-CG 4.13Å; V63-E65 PolarHBondContact O-N 2.94Å
64	N	84	Confident	78.8	Confident	136 Å²	136	129.7 Å²	129.7	73%	0.727	70%	0.703	S	S	*	*			trans	-78.2	95.1	174.5	-175.3	30.4	0	0	0	108.3	E62 V66	E62-N64 PolarHBondContact O-N 3.05Å; N64-V66 PolarHBondContact O-N 3.2Å
65	E	88.2	Confident	78.6	Confident	124 Å²	124	124.9 Å²	124.9	58%	0.579	70%	0.696	S	S	*	*			trans	-72	108.9	171.9	-65.1	-174	172.6	0	0	109.6	V63 Y67	V63-E65 HydrophobicContact CG1-CG 4.13Å; V63-E65 PolarHBondContact O-N 2.94Å; E65-Y67 HydrophobicContact CB-CE2 4.16Å; E65-Y67 PolarHBondContact OE2-OH 3.01Å
66	V	90	Very high	78.6	Confident	110 Å²	110	129.2 Å²	129.2	67%	0.667	72%	0.715	S	S	*	*			trans	-97.8	114.4	174.3	-176.4	0	0	0	0	109	N64	N64-V66 PolarHBondContact O-N 3.2Å
67	Y	90	Very high	79.1	Confident	187 Å²	187	130.4 Å²	130.4	73%	0.733	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-80.5	121.4	175.4	-67	-89.7	0	0	0	110.4	E65	E65-Y67 HydrophobicContact CB-CE2 4.16Å; E65-Y67 PolarHBondContact OE2-OH 3.01Å
68	I	90.6	Very high	79.4	Confident	145 Å²	145	130 Å²	130	74%	0.744	71%	0.714	S	S	*	*	P	Polyproline II helix	trans	-90.9	131	172.7	57.9	172.5	0	0	0	109.8
69	S	89.1	Confident	79.4	Confident	111 Å²	111	128.8 Å²	128.8	78%	0.776	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-92.8	125.4	170.6	-62.2	0	0	0	0	108.8	L71	S69-L71 PolarHBondContact O-N 3.16Å
70	L	88.6	Confident	79.3	Confident	161 Å²	161	129.3 Å²	129.3	84%	0.843	71%	0.708	S	S	*	*			trans	-75.9	115.8	170.3	-64	173.3	0	0	0	107.8
71	L	86.3	Confident	79.3	Confident	158 Å²	158	128.1 Å²	128.1	83%	0.827	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-70.9	145	167.3	-67.2	172.6	0	0	0	108.7	S69	S69-L71 PolarHBondContact O-N 3.16Å
72	P	84.2	Confident	79	Confident	115 Å²	115	130.6 Å²	130.6	75%	0.747	70%	0.703	S	S	*	*	P	Polyproline II helix	trans	-56.6	147.2	172.3	25.3	-32.9	0	0	0	109.7
73	A	84.9	Confident	78.1	Confident	90 Å²	90	128.4 Å²	128.4	74%	0.744	70%	0.695	S	S	*	*	P	Polyproline II helix	trans	-54.3	136.1	172.4	0	0	0	0	0	108.7
74	P	81.7	Confident	77.1	Confident	111 Å²	111	126.4 Å²	126.4	72%	0.721	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-55.6	144.4	172.4	20.6	-27.8	0	0	0	109.4	D76	P74-D76 PolarHBondContact O-N 2.94Å
75	P	79.2	Confident	76.1	Confident	92 Å²	92	128.9 Å²	128.9	60%	0.597	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-57.5	137.2	180	24.3	-32.7	0	0	0	109.7
76	D	78.8	Confident	74.5	Confident	110 Å²	110	128.6 Å²	128.6	59%	0.588	70%	0.697	S	S	*	*	P	Polyproline II helix	trans	-61.2	131.2	172.9	-73.2	-47.1	0	0	0	107.9	P74 E78 E79	P74-D76 PolarHBondContact O-N 2.94Å; D76-E78 PolarHBondContact O-N 2.8Å; D76-E79 PolarHBondContact O-N 3.1Å; D76-E79 VanDerWaalsContact O-N 3.13Å
77	P	75.4	Confident	72.7	Confident	103 Å²	103	131.5 Å²	131.5	67%	0.669	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.3	-9.6	-176.2	25.4	-34.8	0	0	0	113.4
78	E	68.4	Low	71	Confident	163 Å²	163	132.2 Å²	132.2	76%	0.762	73%	0.731	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.8	-26.3	-179.7	-57.3	-174.9	175.3	0	0	112.7	D76	D76-E78 PolarHBondContact O-N 2.8Å
79	E	61.2	Low	70.1	Confident	134 Å²	134	131.6 Å²	131.6	63%	0.626	73%	0.73	S	S	*	*	H	α-helix	trans	-81.3	-26.5	-179.4	-70.7	-174.5	164.7	0	0	113	D76 E81 E82 I83	D76-E79 PolarHBondContact O-N 3.1Å; D76-E79 VanDerWaalsContact O-N 3.13Å; E79-E81 VanDerWaalsContact C-N 3.26Å; E79-E81 PolarHBondContact O-N 2.99Å; E79-E82 PolarHBondContact O-N 3.37Å; E79-I83 WeakPolarHBondContact O-CG1 3.46Å; E79-I83 PolarHBondContact O-N 2.74Å
80	E	59.9	Low	69.1	Low	128 Å²	128	132.7 Å²	132.7	60%	0.598	73%	0.728	S	S	*	*	H	α-helix	trans	-66.6	-26.5	175.3	-82.3	-176.6	158.3	0	0	112.8	I83 A84	E80-I83 HydrophobicContact CG-CD1 4.47Å; E80-A84 PolarHBondContact O-N 3.19Å
81	E	60.7	Low	68	Low	118 Å²	118	131.1 Å²	131.1	55%	0.551	72%	0.722	S	S	*	*	H	α-helix	trans	-77.9	-25.4	178.1	-143.5	-170.2	140.2	0	0	112.5	E79 R85	E79-E81 VanDerWaalsContact C-N 3.26Å; E79-E81 PolarHBondContact O-N 2.99Å; E81-R85 WeakPolarHBondContact O-CG 3.47Å; E81-R85 IonicContact OE1-CZ 3.61Å; E81-R85 IonicContact OE1-NE 3.61Å; E81-R85 IonicContact OE1-NH2 2.82Å; E81-R85 PolarHBondContact OE1-NH2 3.22Å
82	E	60.6	Low	66.9	Low	150 Å²	150	129.5 Å²	129.5	70%	0.701	72%	0.715	S	S	*	*	H	α-helix	trans	-77	-40.7	178.1	-169	171.6	142	0	0	111.7	E79 A84 R85	E79-E82 PolarHBondContact O-N 3.37Å; E82-A84 VanDerWaalsContact C-N 3.27Å; E82-A84 PolarHBondContact O-N 2.96Å; E82-R85 PolarHBondContact O-N 2.85Å; E82-R85 VanDerWaalsContact O-N 3.16Å
83	I	57.5	Low	65.8	Low	128 Å²	128	130.4 Å²	130.4	66%	0.656	71%	0.713	S	S	*	*	H	α-helix	trans	-64.9	-30.1	174.4	10.5	168.5	0	0	0	112.4	E79 E80 R85	E79-I83 WeakPolarHBondContact O-CG1 3.46Å; E79-I83 PolarHBondContact O-N 2.74Å; E80-I83 HydrophobicContact CG-CD1 4.47Å; I83-R85 VanDerWaalsContact C-N 3.28Å; I83-R85 PolarHBondContact O-N 3.3Å
84	A	60.3	Low	64.5	Low	80 Å²	80	133.1 Å²	133.1	66%	0.661	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.3	-14	176.6	0	0	0	0	0	113.9	E80 E82	E80-A84 PolarHBondContact O-N 3.19Å; E82-A84 VanDerWaalsContact C-N 3.27Å; E82-A84 PolarHBondContact O-N 2.96Å
85	R	63.4	Low	63.3	Low	189 Å²	189	134.7 Å²	134.7	71%	0.713	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.5	-5.5	-179.7	-71.7	-174	-174.7	-149.1	7.9	114.2	E81 E82 I83	E81-R85 WeakPolarHBondContact O-CG 3.47Å; E81-R85 IonicContact OE1-CZ 3.61Å; E81-R85 IonicContact OE1-NE 3.61Å; E81-R85 IonicContact OE1-NH2 2.82Å; E81-R85 PolarHBondContact OE1-NH2 3.22Å; E82-R85 PolarHBondContact O-N 2.85Å; E82-R85 VanDerWaalsContact O-N 3.16Å; I83-R85 VanDerWaalsContact C-N 3.28Å; I83-R85 PolarHBondContact O-N 3.3Å
86	V	53.1	Low	62.1	Low	117 Å²	117	138 Å²	138	71%	0.709	72%	0.719	S	S	*	*			trans	-108.4	55.2	176.6	-169.5	0	0	0	0	109.9
87	E	53.6	Low	60.7	Low	171 Å²	171	140.3 Å²	140.3	80%	0.799	73%	0.73	S	S	*	*			trans	-107	132.3	153.1	-77.2	-161	126.5	0	0	108.7
88	P	54.3	Low	59.4	Low	203 Å²	203	143.7 Å²	143.7	100%	1.318	74%	0.736	S	S	*	*			trans	-75.1	0	-163	31.1	-37	0	0	0	115.8

Retrieved 88 of 88 residues in 113.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).