Q99PU3_RAT Loading...

ATPase H+ transporting V0 subunit e1

AlphaFold DB , UniProt , Accession Q99PU3, Species RAT (Rattus norvegicus, Rat), Gene Atp6v0e1, Length 95 aa.

						>Q99PU3_RAT|Q99PU3|Atp6v0e1
MDAGTSAGPLSRYAACVPTVRESRKECTIVLQGLRAHWCLTSAFSFFSRVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.6	Very low	44.4	Very low	231 Å²	231	108 Å²	108	100%	1.138	70%	0.697	S	S	*	*				0	93.8	0	-76.5	168.8	171.6	0	0	106	A3	M1-A3 PolarHBondContact O-N 3.14Å
2	D	41	Very low	44.8	Very low	164 Å²	164	115.5 Å²	115.5	88%	0.877	70%	0.701	S	S	*	*			trans	-69	113.8	-156.7	-53.5	-75	0	0	0	110.4	G4	D2-G4 PolarHBondContact O-N 3.14Å
3	A	40.6	Very low	45.1	Very low	103 Å²	103	113.3 Å²	113.3	85%	0.851	67%	0.674	S	S	*	*			trans	-68.5	106.3	178.6	0	0	0	0	0	108.4	M1 T5	M1-A3 PolarHBondContact O-N 3.14Å; A3-T5 PolarHBondContact O-N 3.34Å
4	G	38.8	Very low	45.4	Very low	65 Å²	65	109.6 Å²	109.6	67%	0.67	66%	0.661	S	S	*	*			trans	-46.1	128.1	-179.8	0	0	0	0	0	113.2	D2 S6	D2-G4 PolarHBondContact O-N 3.14Å; G4-S6 PolarHBondContact O-N 3.2Å
5	T	46.8	Very low	45.7	Very low	144 Å²	144	106.7 Å²	106.7	88%	0.883	65%	0.654	S	S	*	*			trans	-26.6	86.4	151.2	-51.8	0	0	0	0	113.7	A3	A3-T5 PolarHBondContact O-N 3.34Å
6	S	43.1	Very low	45.6	Very low	112 Å²	112	102.8 Å²	102.8	78%	0.783	63%	0.632	S	S	*	*			trans	-112.6	64.3	158.2	69	0	0	0	0	108.8	G4 G8	G4-S6 PolarHBondContact O-N 3.2Å; S6-G8 VanDerWaalsContact C-N 3.29Å; S6-G8 PolarHBondContact O-N 3.21Å
7	A	45.8	Very low	45.9	Very low	56 Å²	56	102.1 Å²	102.1	46%	0.463	63%	0.627	S	S	.	*			trans	-65.5	93.4	164.9	0	0	0	0	0	107.6
8	G	45.1	Very low	45.9	Very low	33 Å²	33	100.6 Å²	100.6	34%	0.34	62%	0.619	S	S	.	*			trans	-57.7	164.6	172.1	0	0	0	0	0	111.1	S6 L10 S11	S6-G8 VanDerWaalsContact C-N 3.29Å; S6-G8 PolarHBondContact O-N 3.21Å; G8-L10 PolarHBondContact O-N 3.35Å; G8-L10 VanDerWaalsContact O-N 3.09Å; G8-S11 WeakPolarHBondContact O-CA 3.31Å; G8-S11 VanDerWaalsContact O-CB 3.29Å; G8-S11 WeakPolarHBondContact O-CB 3.44Å; G8-S11 PolarHBondContact O-N 3.19Å
9	P	51.6	Low	46.2	Very low	69 Å²	69	99.8 Å²	99.8	45%	0.448	61%	0.614	S	S	.	*	H	α-helix	trans	-54.1	-33.7	179.1	18.9	-29.4	0	0	0	112.2	S11 R12 Y13	P9-S11 VanDerWaalsContact C-N 3.3Å; P9-S11 PolarHBondContact O-N 3.24Å; P9-R12 PolarHBondContact O-N 3.39Å; P9-Y13 VanDerWaalsContact C-CE2 3.45Å; P9-Y13 HydrophobicContact CB-CE2 4.01Å; P9-Y13 WeakPolarHBondContact O-CD2 3.45Å; P9-Y13 WeakPolarHBondContact O-CE2 3.31Å; P9-Y13 PolarHBondContact O-N 3.3Å
10	L	50.1	Low	46.2	Very low	149 Å²	149	99.5 Å²	99.5	78%	0.78	61%	0.612	S	S	*	*	H	α-helix	trans	-59	-30.7	170.8	-108.5	122.1	0	0	0	115.2	G8 A14	G8-L10 PolarHBondContact O-N 3.35Å; G8-L10 VanDerWaalsContact O-N 3.09Å; L10-A14 WeakPolarHBondContact O-CB 3.22Å; L10-A14 PolarHBondContact O-N 3.25Å
11	S	45	Very low	46.2	Very low	62 Å²	62	103 Å²	103	43%	0.434	61%	0.614	S	S	.	*	H	α-helix	trans	-75.9	-31.6	178.8	-175.4	0	0	0	0	112.2	G8 P9 A14 A15	G8-S11 WeakPolarHBondContact O-CA 3.31Å; G8-S11 VanDerWaalsContact O-CB 3.29Å; G8-S11 WeakPolarHBondContact O-CB 3.44Å; G8-S11 PolarHBondContact O-N 3.19Å; P9-S11 VanDerWaalsContact C-N 3.3Å; P9-S11 PolarHBondContact O-N 3.24Å; S11-A14 PolarHBondContact O-N 3.05Å; S11-A15 PolarHBondContact O-N 2.87Å
12	R	49.9	Very low	46.7	Very low	198 Å²	198	96.5 Å²	96.5	75%	0.747	58%	0.581	S	S	*	*	H	α-helix	trans	-70.8	-34.7	171.2	-72.7	-165.6	-169.5	-176.9	4.3	112.3	P9 A15 C16	P9-R12 PolarHBondContact O-N 3.39Å; R12-A15 PolarHBondContact O-N 3.29Å; R12-C16 PolarHBondContact O-N 2.93Å
13	Y	48.6	Very low	46.9	Very low	87 Å²	87	91.4 Å²	91.4	34%	0.341	56%	0.558	S	S	.	*	H	α-helix	trans	-67.9	-40.3	170.9	-54.5	-53.4	0	0	0	111.8	P9 A15 C16 V17 Q73	P9-Y13 VanDerWaalsContact C-CE2 3.45Å; P9-Y13 HydrophobicContact CB-CE2 4.01Å; P9-Y13 WeakPolarHBondContact O-CD2 3.45Å; P9-Y13 WeakPolarHBondContact O-CE2 3.31Å; P9-Y13 PolarHBondContact O-N 3.3Å; Y13-A15 VanDerWaalsContact C-N 3.26Å; Y13-A15 PolarHBondContact O-N 3.24Å; Y13-C16 WeakPolarHBondContact O-CA 3.4Å; Y13-C16 WeakPolarHBondContact O-CB 3.41Å; Y13-C16 PolarHBondContact O-N 2.94Å; Y13-V17 WeakPolarHBondContact O-CG2 3.29Å; Y13-V17 PolarHBondContact O-N 2.96Å; Y13-Q73 HydrophobicContact CE1-CG 4.12Å; Y13-Q73 HydrophobicContact CE2-CG 4.16Å; Y13-Q73 VanDerWaalsContact CE2-OE1 3.29Å; Y13-Q73 VanDerWaalsContact CZ-CG 3.49Å; Y13-Q73 VanDerWaalsContact CZ-OE1 3.29Å; Y13-Q73 WeakPolarHBondContact OH-CG 3.45Å; Y13-Q73 PolarHBondContact OH-NE2 2.96Å
14	A	48.6	Very low	47.4	Very low	61 Å²	61	95.8 Å²	95.8	50%	0.504	55%	0.552	S	S	.	*	H	α-helix	trans	-64.2	-27.2	174.6	0	0	0	0	0	113.6	L10 S11 P18	L10-A14 WeakPolarHBondContact O-CB 3.22Å; L10-A14 PolarHBondContact O-N 3.25Å; S11-A14 PolarHBondContact O-N 3.05Å; A14-P18 WeakPolarHBondContact O-CD 3.44Å
15	A	49.4	Very low	47.8	Very low	66 Å²	66	97.5 Å²	97.5	55%	0.545	54%	0.542	S	S	.	.	H	α-helix	trans	-77.9	-21.6	170.3	0	0	0	0	0	113.4	S11 R12 Y13 P18 T19	S11-A15 PolarHBondContact O-N 2.87Å; R12-A15 PolarHBondContact O-N 3.29Å; Y13-A15 VanDerWaalsContact C-N 3.26Å; Y13-A15 PolarHBondContact O-N 3.24Å; A15-P18 WeakPolarHBondContact O-CD 2.89Å; A15-P18 WeakPolarHBondContact O-CG 3.38Å; A15-T19 PolarHBondContact O-OG1 3.49Å
16	C	45.1	Very low	48.1	Very low	45 Å²	45	96.3 Å²	96.3	30%	0.304	53%	0.526	S	S	.	.	H	α-helix	trans	-82	-28.2	173.2	-163.1	0	0	0	0	112.7	R12 Y13 T19 V20	R12-C16 PolarHBondContact O-N 2.93Å; Y13-C16 WeakPolarHBondContact O-CA 3.4Å; Y13-C16 WeakPolarHBondContact O-CB 3.41Å; Y13-C16 PolarHBondContact O-N 2.94Å; C16-T19 VanDerWaalsContact C-OG1 3.26Å; C16-T19 VanDerWaalsContact CA-OG1 3.25Å; C16-T19 WeakPolarHBondContact CA-OG1 3.5Å; C16-T19 PolarHBondContact O-N 3.33Å; C16-T19 PolarHBondContact O-OG1 3.42Å; C16-V20 WeakPolarHBondContact O-CG2 3.02Å; C16-V20 PolarHBondContact O-N 3.28Å; C16-V20 VanDerWaalsContact O-N 3.08Å
17	V	50.6	Low	48.4	Very low	90 Å²	90	94.8 Å²	94.8	55%	0.545	52%	0.515	S	S	.	.	H	α-helix	trans	-59	-43.1	177.1	171.7	0	0	0	0	114.2	Y13 T19 V20 R21	Y13-V17 WeakPolarHBondContact O-CG2 3.29Å; Y13-V17 PolarHBondContact O-N 2.96Å; V17-T19 VanDerWaalsContact C-N 3.32Å; V17-T19 PolarHBondContact O-N 3.33Å; V17-V20 PolarHBondContact O-N 3.47Å; V17-R21 PolarHBondContact O-N 3.28Å
18	P	45.7	Very low	48.8	Very low	75 Å²	75	95.5 Å²	95.5	49%	0.487	51%	0.513	S	S	.	.	H	α-helix	trans	-67.9	-29.3	175.2	25.1	-33.2	0	0	0	112.6	A14 A15 R21 E22	A14-P18 WeakPolarHBondContact O-CD 3.44Å; A15-P18 WeakPolarHBondContact O-CD 2.89Å; A15-P18 WeakPolarHBondContact O-CG 3.38Å; P18-R21 PolarHBondContact O-N 2.84Å; P18-E22 PolarHBondContact O-N 3.07Å
19	T	51.3	Low	49.2	Very low	86 Å²	86	99.6 Å²	99.6	53%	0.528	53%	0.526	S	S	.	.	H	α-helix	trans	-69.3	-38	173.7	19.1	0	0	0	0	112.1	A15 C16 V17 R21 E22 S23	A15-T19 PolarHBondContact O-OG1 3.49Å; C16-T19 VanDerWaalsContact C-OG1 3.26Å; C16-T19 VanDerWaalsContact CA-OG1 3.25Å; C16-T19 WeakPolarHBondContact CA-OG1 3.5Å; C16-T19 PolarHBondContact O-N 3.33Å; C16-T19 PolarHBondContact O-OG1 3.42Å; V17-T19 VanDerWaalsContact C-N 3.32Å; V17-T19 PolarHBondContact O-N 3.33Å; T19-R21 VanDerWaalsContact C-N 3.34Å; T19-E22 WeakPolarHBondContact O-CB 3.46Å; T19-E22 PolarHBondContact O-N 3.4Å; T19-S23 PolarHBondContact O-N 3.01Å
20	V	47.5	Very low	49.4	Very low	94 Å²	94	100.5 Å²	100.5	57%	0.57	53%	0.53	S	S	*	.	H	α-helix	trans	-71.9	-28.5	173	-149.1	0	0	0	0	112.4	C16 V17 E22 S23	C16-V20 WeakPolarHBondContact O-CG2 3.02Å; C16-V20 PolarHBondContact O-N 3.28Å; C16-V20 VanDerWaalsContact O-N 3.08Å; V17-V20 PolarHBondContact O-N 3.47Å; V20-E22 VanDerWaalsContact C-N 3.31Å; V20-S23 PolarHBondContact O-N 3.3Å
21	R	46.1	Very low	49.5	Very low	172 Å²	172	99.5 Å²	99.5	65%	0.649	53%	0.525	S	S	*	.	H	α-helix	trans	-70.7	-27.7	173.4	-174.2	171.9	-76.2	-149.9	-1.5	112	V17 P18 T19 K25	V17-R21 PolarHBondContact O-N 3.28Å; P18-R21 PolarHBondContact O-N 2.84Å; T19-R21 VanDerWaalsContact C-N 3.34Å; R21-K25 WeakPolarHBondContact O-CG 3.44Å
22	E	50.8	Low	49.8	Very low	95 Å²	95	103.1 Å²	103.1	44%	0.444	54%	0.535	S	S	.	.	H	α-helix	trans	-70.2	-39.5	172.1	-158.9	61.6	-144.6	0	0	112.1	P18 T19 V20 R24 K25 E26	P18-E22 PolarHBondContact O-N 3.07Å; T19-E22 WeakPolarHBondContact O-CB 3.46Å; T19-E22 PolarHBondContact O-N 3.4Å; V20-E22 VanDerWaalsContact C-N 3.31Å; E22-R24 PolarHBondContact O-N 3.49Å; E22-R24 VanDerWaalsContact O-N 3.17Å; E22-K25 WeakPolarHBondContact O-CA 3Å; E22-K25 VanDerWaalsContact O-CB 3.28Å; E22-K25 WeakPolarHBondContact O-CB 2.9Å; E22-K25 WeakPolarHBondContact O-CG 3.39Å; E22-K25 PolarHBondContact O-N 3.28Å; E22-K25 WeakPolarHBondContact OE1-CD 3.44Å; E22-K25 IonicContact OE1-NZ 3.73Å; E22-K25 WeakPolarHBondContact OE2-CE 3.46Å; E22-K25 IonicContact OE2-NZ 2.63Å; E22-K25 PolarHBondContact OE2-NZ 3.25Å; E22-E26 PolarHBondContact O-N 3.48Å
23	S	45.5	Very low	50.1	Low	57 Å²	57	95.5 Å²	95.5	40%	0.399	52%	0.518	S	S	.	.	H	α-helix	trans	-61.9	-24.9	175.2	-60.6	0	0	0	0	114.1	T19 V20 K25 C27	T19-S23 PolarHBondContact O-N 3.01Å; V20-S23 PolarHBondContact O-N 3.3Å; S23-K25 PolarHBondContact O-N 3.35Å; S23-C27 PolarHBondContact O-N 2.93Å
24	R	51.2	Low	50.4	Low	195 Å²	195	96.7 Å²	96.7	74%	0.736	53%	0.53	S	S	*	.	H	α-helix	trans	-69.6	-22.8	172.4	-152.3	-172.5	-62.1	-140.1	0.9	112.5	E22 T28	E22-R24 PolarHBondContact O-N 3.49Å; E22-R24 VanDerWaalsContact O-N 3.17Å; R24-T28 PolarHBondContact O-OG1 3.3Å
25	K	46.5	Very low	50.7	Low	102 Å²	102	104.5 Å²	104.5	44%	0.443	55%	0.546	S	S	.	.	H	α-helix	trans	-84.7	-35.6	178.5	-40.6	-173.2	-165.5	165.2	0	111.1	R21 E22 S23 C27 T28 I29	R21-K25 WeakPolarHBondContact O-CG 3.44Å; E22-K25 WeakPolarHBondContact O-CA 3Å; E22-K25 VanDerWaalsContact O-CB 3.28Å; E22-K25 WeakPolarHBondContact O-CB 2.9Å; E22-K25 WeakPolarHBondContact O-CG 3.39Å; E22-K25 PolarHBondContact O-N 3.28Å; E22-K25 WeakPolarHBondContact OE1-CD 3.44Å; E22-K25 IonicContact OE1-NZ 3.73Å; E22-K25 WeakPolarHBondContact OE2-CE 3.46Å; E22-K25 IonicContact OE2-NZ 2.63Å; E22-K25 PolarHBondContact OE2-NZ 3.25Å; S23-K25 PolarHBondContact O-N 3.35Å; K25-C27 VanDerWaalsContact C-N 3.29Å; K25-C27 PolarHBondContact O-N 3.26Å; K25-T28 WeakPolarHBondContact O-CB 3.45Å; K25-T28 PolarHBondContact O-N 3.31Å; K25-I29 PolarHBondContact O-N 2.79Å
26	E	52.4	Low	50.9	Low	118 Å²	118	104.4 Å²	104.4	55%	0.551	55%	0.546	S	S	*	.	H	α-helix	trans	-61.8	-37.3	171.2	-62.7	-177.4	125.1	0	0	111.5	E22 T28 I29 V30	E22-E26 PolarHBondContact O-N 3.48Å; E26-T28 VanDerWaalsContact C-N 3.28Å; E26-T28 PolarHBondContact O-N 3.09Å; E26-I29 WeakPolarHBondContact O-CB 3.44Å; E26-I29 PolarHBondContact O-N 2.96Å; E26-V30 PolarHBondContact O-N 3.31Å; E26-V30 VanDerWaalsContact O-N 3.16Å
27	C	50.1	Low	51.1	Low	81 Å²	81	106 Å²	106	55%	0.547	55%	0.548	S	S	.	.	H	α-helix	trans	-59.4	-31.2	170.3	-95.5	0	0	0	0	114	S23 K25 V30 L31	S23-C27 PolarHBondContact O-N 2.93Å; K25-C27 VanDerWaalsContact C-N 3.29Å; K25-C27 PolarHBondContact O-N 3.26Å; C27-V30 WeakPolarHBondContact O-CG2 3.38Å; C27-L31 WeakPolarHBondContact O-CB 3.41Å; C27-L31 PolarHBondContact O-N 2.91Å; C27-L31 VanDerWaalsContact O-N 3.1Å
28	T	52.8	Low	51	Low	70 Å²	70	112.5 Å²	112.5	43%	0.429	56%	0.563	S	S	.	*	H	α-helix	trans	-76.9	-33	177	-53.3	0	0	0	0	111.6	R24 K25 E26 L31 Q32	R24-T28 PolarHBondContact O-OG1 3.3Å; K25-T28 WeakPolarHBondContact O-CB 3.45Å; K25-T28 PolarHBondContact O-N 3.31Å; E26-T28 VanDerWaalsContact C-N 3.28Å; E26-T28 PolarHBondContact O-N 3.09Å; T28-L31 PolarHBondContact O-N 3.49Å; T28-Q32 HydrophobicContact CG2-CG 4.5Å; T28-Q32 WeakPolarHBondContact O-CB 3.47Å; T28-Q32 PolarHBondContact O-N 2.99Å
29	I	55.4	Low	51.1	Low	119 Å²	119	114.2 Å²	114.2	61%	0.61	58%	0.575	S	S	*	*	H	α-helix	trans	-64	-40.5	173.6	-64.9	171.2	0	0	0	110.5	K25 E26 G33	K25-I29 PolarHBondContact O-N 2.79Å; E26-I29 WeakPolarHBondContact O-CB 3.44Å; E26-I29 PolarHBondContact O-N 2.96Å; I29-G33 PolarHBondContact O-N 3.29Å
30	V	53.8	Low	51	Low	89 Å²	89	116.3 Å²	116.3	54%	0.539	58%	0.583	S	S	.	*	H	α-helix	trans	-70.7	-32.3	172.6	-73.1	0	0	0	0	113.1	E26 C27 G33 L34	E26-V30 PolarHBondContact O-N 3.31Å; E26-V30 VanDerWaalsContact O-N 3.16Å; C27-V30 WeakPolarHBondContact O-CG2 3.38Å; V30-G33 PolarHBondContact O-N 3.24Å; V30-L34 WeakPolarHBondContact O-CD1 3.46Å; V30-L34 PolarHBondContact O-N 3.08Å
31	L	52.8	Low	51.3	Low	128 Å²	128	115.2 Å²	115.2	67%	0.67	58%	0.576	S	S	*	*	H	α-helix	trans	-72.3	-36.6	177.1	-145	80.9	0	0	0	112.9	C27 T28	C27-L31 WeakPolarHBondContact O-CB 3.41Å; C27-L31 PolarHBondContact O-N 2.91Å; C27-L31 VanDerWaalsContact O-N 3.1Å; T28-L31 PolarHBondContact O-N 3.49Å
32	Q	52.2	Low	51.6	Low	138 Å²	138	112.7 Å²	112.7	65%	0.645	59%	0.585	S	S	*	*	H	α-helix	trans	-73.1	-33.4	172.7	-74.3	169.9	-31.4	0	0	111.6	T28 R35	T28-Q32 HydrophobicContact CG2-CG 4.5Å; T28-Q32 WeakPolarHBondContact O-CB 3.47Å; T28-Q32 PolarHBondContact O-N 2.99Å; Q32-R35 PolarHBondContact O-N 3.11Å
33	G	55.8	Low	51.7	Low	38 Å²	38	112.1 Å²	112.1	39%	0.392	60%	0.597	S	S	.	*	H	α-helix	trans	-64	-35.1	170.7	0	0	0	0	0	113.9	I29 V30 R35 A36 H37	I29-G33 PolarHBondContact O-N 3.29Å; V30-G33 PolarHBondContact O-N 3.24Å; G33-R35 VanDerWaalsContact C-N 3.25Å; G33-R35 PolarHBondContact O-N 3.42Å; G33-A36 PolarHBondContact O-N 3.44Å; G33-H37 PolarHBondContact O-N 3.11Å
34	L	55.2	Low	52.1	Low	112 Å²	112	113.8 Å²	113.8	59%	0.586	60%	0.597	S	S	*	*	H	α-helix	trans	-63.7	-27.3	176	-112	76.3	0	0	0	113.5	V30 H37	V30-L34 WeakPolarHBondContact O-CD1 3.46Å; V30-L34 PolarHBondContact O-N 3.08Å; L34-H37 WeakPolarHBondContact O-CB 3.41Å; L34-H37 PolarHBondContact O-N 3.3Å
35	R	54.7	Low	52.3	Low	224 Å²	224	110 Å²	110	85%	0.845	60%	0.6	S	S	*	*	H	α-helix	trans	-78.8	-28.4	177.4	-158.3	169.7	170.4	153.4	-3.4	112.3	Q32 G33	Q32-R35 PolarHBondContact O-N 3.11Å; G33-R35 VanDerWaalsContact C-N 3.25Å; G33-R35 PolarHBondContact O-N 3.42Å
36	A	53.3	Low	52.7	Low	65 Å²	65	113.7 Å²	113.7	54%	0.537	62%	0.617	S	S	.	*	H	α-helix	trans	-76.9	-27.8	168.1	0	0	0	0	0	112.2	G33 W38 C39	G33-A36 PolarHBondContact O-N 3.44Å; A36-W38 VanDerWaalsContact C-N 3.34Å; A36-W38 PolarHBondContact O-N 3.03Å; A36-C39 WeakPolarHBondContact O-CB 3.25Å; A36-C39 PolarHBondContact O-N 3.31Å
37	H	49.6	Very low	52.8	Low	77 Å²	77	114.6 Å²	114.6	36%	0.356	62%	0.619	S	S	.	*	H	α-helix	trans	-62.4	-35.1	179.1	-161.7	118.4	0	0	0	113.2	G33 L34 C39 L40 T41 F44	G33-H37 PolarHBondContact O-N 3.11Å; L34-H37 WeakPolarHBondContact O-CB 3.41Å; L34-H37 PolarHBondContact O-N 3.3Å; H37-C39 PolarHBondContact O-N 3.09Å; H37-C39 VanDerWaalsContact O-N 3.13Å; H37-L40 PolarHBondContact O-N 3.39Å; H37-T41 PolarHBondContact O-N 3.15Å; H37-T41 PolarHBondContact O-OG1 3.14Å; H37-T41 VanDerWaalsContact O-OG1 3.13Å; H37-F44 AromaticContact NE2-CD2 3.81Å; H37-F44 AromaticContact NE2-CE2 3.59Å
38	W	47.6	Very low	53.3	Low	228 Å²	228	112.4 Å²	112.4	86%	0.864	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.2	-18.5	178.8	-146	-83.8	0	0	0	113.3	A36	A36-W38 VanDerWaalsContact C-N 3.34Å; A36-W38 PolarHBondContact O-N 3.03Å
39	C	47.7	Very low	54	Low	110 Å²	110	119.1 Å²	119.1	74%	0.743	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.5	-16.6	173.8	-154.8	0	0	0	0	112.5	A36 H37	A36-C39 WeakPolarHBondContact O-CB 3.25Å; A36-C39 PolarHBondContact O-N 3.31Å; H37-C39 PolarHBondContact O-N 3.09Å; H37-C39 VanDerWaalsContact O-N 3.13Å
40	L	49.1	Very low	55.1	Low	131 Å²	131	117 Å²	117	69%	0.686	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.9	-0.5	-172.4	-126.5	76.6	0	0	0	114.2	H37 S42 A43	H37-L40 PolarHBondContact O-N 3.39Å; L40-S42 PolarHBondContact O-N 3.02Å; L40-A43 PolarHBondContact O-N 3Å
41	T	55.6	Low	56.4	Low	70 Å²	70	116.2 Å²	116.2	43%	0.429	61%	0.607	S	S	.	*	G	3₁₀ helix	trans	-62.7	-6.7	-177.4	-43.7	0	0	0	0	114.1	H37 A43	H37-T41 PolarHBondContact O-N 3.15Å; H37-T41 PolarHBondContact O-OG1 3.14Å; H37-T41 VanDerWaalsContact O-OG1 3.13Å; T41-A43 VanDerWaalsContact C-N 3.33Å; T41-A43 PolarHBondContact O-N 3.18Å
42	S	50.5	Low	57.7	Low	119 Å²	119	115.2 Å²	115.2	83%	0.832	60%	0.601	S	S	*	*	G	3₁₀ helix	trans	-76.7	-6.9	177	31.9	0	0	0	0	115.1	L40	L40-S42 PolarHBondContact O-N 3.02Å
43	A	53.5	Low	59.1	Low	83 Å²	83	112.3 Å²	112.3	69%	0.686	59%	0.593	S	S	*	*	G	3₁₀ helix	trans	-116.9	14.5	179	0	0	0	0	0	114.9	L40 T41 S45	L40-A43 PolarHBondContact O-N 3Å; T41-A43 VanDerWaalsContact C-N 3.33Å; T41-A43 PolarHBondContact O-N 3.18Å; A43-S45 PolarHBondContact O-N 2.99Å
44	F	54.9	Low	60.1	Low	93 Å²	93	116.2 Å²	116.2	41%	0.408	60%	0.602	S	S	.	*			trans	-95.1	79.1	-158.2	-173.7	-97.6	0	0	0	114.8	H37	H37-F44 AromaticContact NE2-CD2 3.81Å; H37-F44 AromaticContact NE2-CE2 3.59Å
45	S	54.2	Low	61.2	Low	115 Å²	115	116.5 Å²	116.5	80%	0.804	60%	0.604	S	S	*	*	S	Bend	trans	-141.7	-18.8	167.4	-86.9	0	0	0	0	116.7	A43	A43-S45 PolarHBondContact O-N 2.99Å
46	F	54.8	Low	62.8	Low	180 Å²	180	109.7 Å²	109.7	79%	0.789	59%	0.587	S	S	*	*	S	Bend	trans	-95.1	-29.5	176.4	-160.7	-103.3	0	0	0	113.4	S48	F46-S48 PolarHBondContact O-N 3.35Å
47	F	55	Low	64.2	Low	136 Å²	136	110.5 Å²	110.5	60%	0.596	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.8	-17.8	-174.4	-75.1	-78.2	0	0	0	115	R49 V50 I51	F47-R49 PolarHBondContact O-N 3.4Å; F47-V50 PolarHBondContact O-N 3.33Å; F47-I51 HydrophobicContact CB-CD1 4.25Å; F47-I51 WeakPolarHBondContact O-CG1 3.36Å; F47-I51 PolarHBondContact O-N 3.11Å; F47-I51 VanDerWaalsContact O-N 3.16Å
48	S	60.9	Low	65.9	Low	36 Å²	36	110.2 Å²	110.2	25%	0.252	59%	0.591	S	S	.	*	H	α-helix	trans	-60.3	-34.7	-174.6	-46.3	0	0	0	0	112.6	F46 I52	F46-S48 PolarHBondContact O-N 3.35Å; S48-I52 VanDerWaalsContact O-CD1 3.29Å; S48-I52 WeakPolarHBondContact O-CD1 3.25Å; S48-I52 WeakPolarHBondContact O-CG1 3.45Å; S48-I52 PolarHBondContact O-N 3.04Å
49	R	67.3	Low	67.4	Low	210 Å²	210	102.8 Å²	102.8	79%	0.792	57%	0.574	S	S	*	*	H	α-helix	trans	-66.9	-42.5	178.7	-71.1	-179.5	164.1	-92.1	-0.9	112.4	F47 T53	F47-R49 PolarHBondContact O-N 3.4Å; R49-T53 WeakPolarHBondContact O-CG2 3.45Å; R49-T53 PolarHBondContact O-N 3.09Å; R49-T53 PolarHBondContact O-OG1 3.32Å
50	V	78.4	Confident	69.5	Low	75 Å²	75	101.1 Å²	101.1	46%	0.455	56%	0.56	S	S	.	*	H	α-helix	trans	-70.8	-40.7	-177.7	-179.4	0	0	0	0	111.2	F47 I52 T53 M54	F47-V50 PolarHBondContact O-N 3.33Å; V50-I52 PolarHBondContact O-N 3.43Å; V50-T53 WeakPolarHBondContact CA-OG1 3.41Å; V50-T53 PolarHBondContact O-N 2.99Å; V50-T53 PolarHBondContact O-OG1 3.46Å; V50-M54 HydrophobicContact CG1-CG 4.42Å; V50-M54 WeakPolarHBondContact O-CG 3.38Å; V50-M54 PolarHBondContact O-N 3.37Å
51	I	80.6	Confident	71	Confident	73 Å²	73	98.3 Å²	98.3	37%	0.374	55%	0.55	S	S	.	*	H	α-helix	trans	-63.7	-42.2	179	-62.9	166.4	0	0	0	110.8	F47 T53 M54 L55	F47-I51 HydrophobicContact CB-CD1 4.25Å; F47-I51 WeakPolarHBondContact O-CG1 3.36Å; F47-I51 PolarHBondContact O-N 3.11Å; F47-I51 VanDerWaalsContact O-N 3.16Å; I51-T53 VanDerWaalsContact C-N 3.34Å; I51-T53 PolarHBondContact O-N 3.18Å; I51-M54 PolarHBondContact O-N 2.93Å; I51-L55 HydrophobicContact CG2-CD1 3.96Å; I51-L55 HydrophobicContact CG2-CG 4.45Å; I51-L55 WeakPolarHBondContact O-CG 2.93Å; I51-L55 PolarHBondContact O-N 3.5Å
52	I	81.5	Confident	72.2	Confident	107 Å²	107	98.6 Å²	98.6	55%	0.549	55%	0.554	S	S	.	*	H	α-helix	trans	-61.6	-44.1	176.3	-67	164.4	0	0	0	110.4	S48 V50 M54 L55 V56	S48-I52 VanDerWaalsContact O-CD1 3.29Å; S48-I52 WeakPolarHBondContact O-CD1 3.25Å; S48-I52 WeakPolarHBondContact O-CG1 3.45Å; S48-I52 PolarHBondContact O-N 3.04Å; V50-I52 PolarHBondContact O-N 3.43Å; I52-M54 PolarHBondContact O-N 2.99Å; I52-L55 PolarHBondContact O-N 3.3Å; I52-V56 HydrophobicContact CG2-CG2 4.28Å; I52-V56 WeakPolarHBondContact O-CB 3.39Å; I52-V56 WeakPolarHBondContact O-CG2 3.42Å; I52-V56 PolarHBondContact O-N 3.11Å
53	T	81.2	Confident	73.5	Confident	76 Å²	76	99.7 Å²	99.7	47%	0.466	54%	0.541	S	S	.	.	H	α-helix	trans	-62.9	-41.7	178.1	54.2	0	0	0	0	112.5	R49 V50 I51 V56 T57	R49-T53 WeakPolarHBondContact O-CG2 3.45Å; R49-T53 PolarHBondContact O-N 3.09Å; R49-T53 PolarHBondContact O-OG1 3.32Å; V50-T53 WeakPolarHBondContact CA-OG1 3.41Å; V50-T53 PolarHBondContact O-N 2.99Å; V50-T53 PolarHBondContact O-OG1 3.46Å; I51-T53 VanDerWaalsContact C-N 3.34Å; I51-T53 PolarHBondContact O-N 3.18Å; T53-V56 PolarHBondContact O-N 3.41Å; T53-T57 WeakPolarHBondContact O-CG2 3.18Å; T53-T57 PolarHBondContact O-N 2.71Å; T53-T57 PolarHBondContact O-OG1 2.99Å
54	M	76.2	Confident	74.6	Confident	120 Å²	120	100 Å²	100	59%	0.591	53%	0.531	S	S	*	.	H	α-helix	trans	-68	-37.8	-179.8	-68	-64.6	155.3	0	0	112.6	V50 I51 I52 T57 C58	V50-M54 HydrophobicContact CG1-CG 4.42Å; V50-M54 WeakPolarHBondContact O-CG 3.38Å; V50-M54 PolarHBondContact O-N 3.37Å; I51-M54 PolarHBondContact O-N 2.93Å; I52-M54 PolarHBondContact O-N 2.99Å; M54-T57 PolarHBondContact O-OG1 3.39Å; M54-C58 WeakPolarHBondContact O-CB 3.46Å; M54-C58 PolarHBondContact O-N 3.08Å; M54-C58 VanDerWaalsContact O-N 3.11Å
55	L	78.6	Confident	75.7	Confident	118 Å²	118	102.2 Å²	102.2	62%	0.618	54%	0.541	S	S	*	.	H	α-helix	trans	-68.1	-40	175.1	-71.6	172	0	0	0	112.1	I51 I52 S59	I51-L55 HydrophobicContact CG2-CD1 3.96Å; I51-L55 HydrophobicContact CG2-CG 4.45Å; I51-L55 WeakPolarHBondContact O-CG 2.93Å; I51-L55 PolarHBondContact O-N 3.5Å; I52-L55 PolarHBondContact O-N 3.3Å; L55-S59 PolarHBondContact O-N 3.3Å; L55-S59 VanDerWaalsContact O-N 3.09Å; L55-S59 PolarHBondContact O-OG 3.22Å
56	V	88.4	Confident	77.1	Confident	81 Å²	81	104.1 Å²	104.1	49%	0.491	53%	0.53	S	S	.	.	H	α-helix	trans	-69.7	-44.1	178.6	172.8	0	0	0	0	111.3	I52 T53 C58 S59 V60	I52-V56 HydrophobicContact CG2-CG2 4.28Å; I52-V56 WeakPolarHBondContact O-CB 3.39Å; I52-V56 WeakPolarHBondContact O-CG2 3.42Å; I52-V56 PolarHBondContact O-N 3.11Å; T53-V56 PolarHBondContact O-N 3.41Å; V56-C58 VanDerWaalsContact C-N 3.33Å; V56-C58 PolarHBondContact O-N 2.76Å; V56-S59 PolarHBondContact O-N 3.3Å; V56-S59 PolarHBondContact O-OG 3.48Å; V56-V60 HydrophobicContact CG1-CG2 4.46Å; V56-V60 VanDerWaalsContact O-CG2 3.25Å; V56-V60 WeakPolarHBondContact O-CG2 3.22Å; V56-V60 PolarHBondContact O-N 3Å; V56-V60 VanDerWaalsContact O-N 3.11Å
57	T	82.9	Confident	78.4	Confident	83 Å²	83	98.6 Å²	98.6	51%	0.509	51%	0.509	S	S	.	.	H	α-helix	trans	-66	-37.7	178.3	51.1	0	0	0	0	112	T53 M54 C61	T53-T57 WeakPolarHBondContact O-CG2 3.18Å; T53-T57 PolarHBondContact O-N 2.71Å; T53-T57 PolarHBondContact O-OG1 2.99Å; M54-T57 PolarHBondContact O-OG1 3.39Å; T57-C61 WeakPolarHBondContact O-CB 3.45Å; T57-C61 PolarHBondContact O-N 3.45Å; T57-C61 PolarHBondContact O-SG 3.2Å
58	C	85.8	Confident	79.9	Confident	70 Å²	70	97.2 Å²	97.2	47%	0.473	51%	0.507	S	S	.	.	H	α-helix	trans	-65.8	-41.7	177.5	-170.8	0	0	0	0	112.3	M54 V56 C61 C62	M54-C58 WeakPolarHBondContact O-CB 3.46Å; M54-C58 PolarHBondContact O-N 3.08Å; M54-C58 VanDerWaalsContact O-N 3.11Å; V56-C58 VanDerWaalsContact C-N 3.33Å; V56-C58 PolarHBondContact O-N 2.76Å; C58-C61 VanDerWaalsContact CA-SG 3.53Å; C58-C61 PolarHBondContact O-SG 3.47Å; C58-C62 WeakPolarHBondContact O-CB 3.44Å; C58-C62 PolarHBondContact O-N 3.2Å; C58-C62 PolarHBondContact O-SG 3.43Å
59	S	77.9	Confident	80.6	Confident	72 Å²	72	97.3 Å²	97.3	50%	0.503	51%	0.509	S	S	.	.	H	α-helix	trans	-68	-40.1	178.1	68.5	0	0	0	0	112.3	L55 V56 Y63	L55-S59 PolarHBondContact O-N 3.3Å; L55-S59 VanDerWaalsContact O-N 3.09Å; L55-S59 PolarHBondContact O-OG 3.22Å; V56-S59 PolarHBondContact O-N 3.3Å; V56-S59 PolarHBondContact O-OG 3.48Å; S59-Y63 WeakPolarHBondContact O-CB 3.09Å; S59-Y63 PolarHBondContact O-N 3.01Å; S59-Y63 VanDerWaalsContact O-N 3.09Å
60	V	91.4	Very high	81.3	Confident	75 Å²	75	90.2 Å²	90.2	46%	0.455	49%	0.487	S	S	.	.	H	α-helix	trans	-67.9	-44.3	179	174.1	0	0	0	0	111.5	V56 Y63 L64	V56-V60 HydrophobicContact CG1-CG2 4.46Å; V56-V60 VanDerWaalsContact O-CG2 3.25Å; V56-V60 WeakPolarHBondContact O-CG2 3.22Å; V56-V60 PolarHBondContact O-N 3Å; V56-V60 VanDerWaalsContact O-N 3.11Å; V60-Y63 PolarHBondContact O-N 3.41Å; V60-L64 HydrophobicContact CG1-CD1 3.88Å; V60-L64 HydrophobicContact CG1-CG 4.32Å; V60-L64 WeakPolarHBondContact O-CG 3.2Å; V60-L64 PolarHBondContact O-N 3.06Å
61	C	81.4	Confident	81.3	Confident	72 Å²	72	91.6 Å²	91.6	49%	0.486	49%	0.491	S	S	.	.	H	α-helix	trans	-67.6	-38.1	-179.4	65.6	0	0	0	0	112.3	T57 C58 Y63 F65	T57-C61 WeakPolarHBondContact O-CB 3.45Å; T57-C61 PolarHBondContact O-N 3.45Å; T57-C61 PolarHBondContact O-SG 3.2Å; C58-C61 VanDerWaalsContact CA-SG 3.53Å; C58-C61 PolarHBondContact O-SG 3.47Å; C61-Y63 PolarHBondContact O-N 3.43Å; C61-F65 WeakPolarHBondContact O-CB 3.44Å; C61-F65 PolarHBondContact O-N 3.17Å; C61-F65 VanDerWaalsContact O-N 3.11Å
62	C	80.5	Confident	80.9	Confident	76 Å²	76	91.5 Å²	91.5	51%	0.514	50%	0.501	S	S	.	.	H	α-helix	trans	-62.8	-41.4	173.5	-67.1	0	0	0	0	112.2	C58 W66	C58-C62 WeakPolarHBondContact O-CB 3.44Å; C58-C62 PolarHBondContact O-N 3.2Å; C58-C62 PolarHBondContact O-SG 3.43Å; C62-W66 WeakPolarHBondContact O-CB 3.46Å; C62-W66 PolarHBondContact O-N 3.46Å; C62-W66 VanDerWaalsContact O-N 3.11Å
63	Y	77.4	Confident	80.2	Confident	142 Å²	142	90.2 Å²	90.2	56%	0.557	49%	0.493	S	S	*	.	H	α-helix	trans	-70.3	-42.4	-179.2	-173.1	-102.9	0	0	0	112.7	S59 V60 C61 W66 L67	S59-Y63 WeakPolarHBondContact O-CB 3.09Å; S59-Y63 PolarHBondContact O-N 3.01Å; S59-Y63 VanDerWaalsContact O-N 3.09Å; V60-Y63 PolarHBondContact O-N 3.41Å; C61-Y63 PolarHBondContact O-N 3.43Å; Y63-W66 HydrophobicContact CE2-CE3 4.32Å; Y63-W66 HydrophobicContact CE2-CZ3 4.44Å; Y63-W66 PolarHBondContact O-N 3.09Å; Y63-L67 WeakPolarHBondContact O-CB 3.36Å; Y63-L67 PolarHBondContact O-N 3.13Å
64	L	77.4	Confident	79.5	Confident	91 Å²	91	92.7 Å²	92.7	48%	0.476	50%	0.503	S	S	.	.	H	α-helix	trans	-63.5	-43.3	176.9	-73	174.8	0	0	0	111.7	V60 W66 L67 I68	V60-L64 HydrophobicContact CG1-CD1 3.88Å; V60-L64 HydrophobicContact CG1-CG 4.32Å; V60-L64 WeakPolarHBondContact O-CG 3.2Å; V60-L64 PolarHBondContact O-N 3.06Å; L64-W66 VanDerWaalsContact C-N 3.32Å; L64-W66 PolarHBondContact O-N 3.24Å; L64-L67 PolarHBondContact O-N 2.87Å; L64-I68 WeakPolarHBondContact O-CD1 3.5Å; L64-I68 VanDerWaalsContact O-CG1 3.22Å; L64-I68 WeakPolarHBondContact O-CG1 3.38Å; L64-I68 PolarHBondContact O-N 3.36Å
65	F	78.1	Confident	79	Confident	139 Å²	139	93.1 Å²	93.1	61%	0.61	51%	0.507	S	S	*	.	H	α-helix	trans	-60.6	-43.6	175.9	179	-104.4	0	0	0	111.7	C61 I68 A69	C61-F65 WeakPolarHBondContact O-CB 3.44Å; C61-F65 PolarHBondContact O-N 3.17Å; C61-F65 VanDerWaalsContact O-N 3.11Å; F65-I68 PolarHBondContact O-N 3.24Å; F65-A69 WeakPolarHBondContact O-CB 3.28Å; F65-A69 PolarHBondContact O-N 3.16Å; F65-A69 VanDerWaalsContact O-N 3.08Å
66	W	83.4	Confident	78.1	Confident	154 Å²	154	91.4 Å²	91.4	58%	0.583	50%	0.503	S	S	*	.	H	α-helix	trans	-62.1	-43.2	176.5	-172.5	78.7	0	0	0	112.4	C62 Y63 L64 A69 I70	C62-W66 WeakPolarHBondContact O-CB 3.46Å; C62-W66 PolarHBondContact O-N 3.46Å; C62-W66 VanDerWaalsContact O-N 3.11Å; Y63-W66 HydrophobicContact CE2-CE3 4.32Å; Y63-W66 HydrophobicContact CE2-CZ3 4.44Å; Y63-W66 PolarHBondContact O-N 3.09Å; L64-W66 VanDerWaalsContact C-N 3.32Å; L64-W66 PolarHBondContact O-N 3.24Å; W66-A69 PolarHBondContact O-N 3.47Å; W66-I70 HydrophobicContact CD2-CD1 3.74Å; W66-I70 HydrophobicContact CE3-CD1 3.79Å; W66-I70 HydrophobicContact CH2-CD1 3.5Å; W66-I70 HydrophobicContact CZ2-CD1 3.44Å; W66-I70 VanDerWaalsContact CZ2-CD1 3.44Å; W66-I70 HydrophobicContact CZ3-CD1 3.68Å; W66-I70 WeakPolarHBondContact O-CG1 3.29Å; W66-I70 PolarHBondContact O-N 2.63Å
67	L	82.8	Confident	76.8	Confident	64 Å²	64	93.9 Å²	93.9	34%	0.335	51%	0.513	S	S	.	.	H	α-helix	trans	-66	-43.1	179.6	-163.7	81.6	0	0	0	112.2	Y63 L64 A69 I70 L71	Y63-L67 WeakPolarHBondContact O-CB 3.36Å; Y63-L67 PolarHBondContact O-N 3.13Å; L64-L67 PolarHBondContact O-N 2.87Å; L67-A69 VanDerWaalsContact C-N 3.34Å; L67-A69 PolarHBondContact O-N 3.17Å; L67-I70 PolarHBondContact O-N 3.27Å; L67-L71 HydrophobicContact CD2-CD1 4.2Å; L67-L71 HydrophobicContact CG-CD1 4.05Å; L67-L71 WeakPolarHBondContact O-CG 3.19Å; L67-L71 PolarHBondContact O-N 3.06Å
68	I	85.6	Confident	75.9	Confident	108 Å²	108	98.3 Å²	98.3	55%	0.554	53%	0.526	S	S	*	.	H	α-helix	trans	-64.3	-40.6	178.3	-64.8	163.7	0	0	0	110.5	L64 F65 I70 L71 A72	L64-I68 WeakPolarHBondContact O-CD1 3.5Å; L64-I68 VanDerWaalsContact O-CG1 3.22Å; L64-I68 WeakPolarHBondContact O-CG1 3.38Å; L64-I68 PolarHBondContact O-N 3.36Å; F65-I68 PolarHBondContact O-N 3.24Å; I68-I70 PolarHBondContact O-N 3.01Å; I68-L71 PolarHBondContact O-N 3.26Å; I68-A72 WeakPolarHBondContact O-CB 3.41Å; I68-A72 PolarHBondContact O-N 3.16Å
69	A	76.8	Confident	75.3	Confident	37 Å²	37	97.8 Å²	97.8	31%	0.306	53%	0.532	S	S	.	.	H	α-helix	trans	-61.2	-34.2	177.1	0	0	0	0	0	112.5	F65 W66 L67 Q73	F65-A69 WeakPolarHBondContact O-CB 3.28Å; F65-A69 PolarHBondContact O-N 3.16Å; F65-A69 VanDerWaalsContact O-N 3.08Å; W66-A69 PolarHBondContact O-N 3.47Å; L67-A69 VanDerWaalsContact C-N 3.34Å; L67-A69 PolarHBondContact O-N 3.17Å; A69-Q73 PolarHBondContact O-NE2 3.42Å
70	I	81.9	Confident	75	Confident	61 Å²	61	99 Å²	99	31%	0.313	54%	0.538	S	S	.	.	H	α-helix	trans	-75.4	-48.6	175.7	-68.6	170.6	0	0	0	110.5	W66 L67 I68 A72 Q73 L74	W66-I70 HydrophobicContact CD2-CD1 3.74Å; W66-I70 HydrophobicContact CE3-CD1 3.79Å; W66-I70 HydrophobicContact CH2-CD1 3.5Å; W66-I70 HydrophobicContact CZ2-CD1 3.44Å; W66-I70 VanDerWaalsContact CZ2-CD1 3.44Å; W66-I70 HydrophobicContact CZ3-CD1 3.68Å; W66-I70 WeakPolarHBondContact O-CG1 3.29Å; W66-I70 PolarHBondContact O-N 2.63Å; L67-I70 PolarHBondContact O-N 3.27Å; I68-I70 PolarHBondContact O-N 3.01Å; I70-A72 VanDerWaalsContact C-N 3.28Å; I70-A72 PolarHBondContact O-N 3.2Å; I70-Q73 WeakPolarHBondContact O-CA 3.48Å; I70-Q73 WeakPolarHBondContact O-CB 3.46Å; I70-Q73 PolarHBondContact O-N 3.33Å; I70-L74 HydrophobicContact CG2-CD1 3.41Å; I70-L74 VanDerWaalsContact CG2-CD1 3.41Å; I70-L74 WeakPolarHBondContact O-CD1 3.08Å; I70-L74 PolarHBondContact O-N 3.25Å
71	L	77.1	Confident	74.1	Confident	104 Å²	104	104.5 Å²	104.5	55%	0.545	56%	0.559	S	S	.	*	H	α-helix	trans	-59.8	-37.1	-179.7	-75.4	162.6	0	0	0	113.1	L67 I68 Q73 L74	L67-L71 HydrophobicContact CD2-CD1 4.2Å; L67-L71 HydrophobicContact CG-CD1 4.05Å; L67-L71 WeakPolarHBondContact O-CG 3.19Å; L67-L71 PolarHBondContact O-N 3.06Å; I68-L71 PolarHBondContact O-N 3.26Å; L71-Q73 PolarHBondContact O-N 3.42Å; L71-L74 PolarHBondContact O-N 3.21Å
72	A	71.8	Confident	74	Confident	72 Å²	72	104.9 Å²	104.9	60%	0.595	56%	0.556	S	S	*	*	H	α-helix	trans	-62.6	-21.9	175.4	0	0	0	0	0	113.4	I68 I70	I68-A72 WeakPolarHBondContact O-CB 3.41Å; I68-A72 PolarHBondContact O-N 3.16Å; I70-A72 VanDerWaalsContact C-N 3.28Å; I70-A72 PolarHBondContact O-N 3.2Å
73	Q	67.9	Low	73.7	Confident	80 Å²	80	108.8 Å²	108.8	37%	0.374	56%	0.564	S	S	.	*	H	α-helix	trans	-94.1	-18.7	177.7	-71.3	173.8	70.5	0	0	114.1	Y13 A69 I70 L71 P76	Y13-Q73 HydrophobicContact CE1-CG 4.12Å; Y13-Q73 HydrophobicContact CE2-CG 4.16Å; Y13-Q73 VanDerWaalsContact CE2-OE1 3.29Å; Y13-Q73 VanDerWaalsContact CZ-CG 3.49Å; Y13-Q73 VanDerWaalsContact CZ-OE1 3.29Å; Y13-Q73 WeakPolarHBondContact OH-CG 3.45Å; Y13-Q73 PolarHBondContact OH-NE2 2.96Å; A69-Q73 PolarHBondContact O-NE2 3.42Å; I70-Q73 WeakPolarHBondContact O-CA 3.48Å; I70-Q73 WeakPolarHBondContact O-CB 3.46Å; I70-Q73 PolarHBondContact O-N 3.33Å; L71-Q73 PolarHBondContact O-N 3.42Å; Q73-P76 VanDerWaalsContact O-CD 3.31Å; Q73-P76 WeakPolarHBondContact O-CD 3.47Å
74	L	67.1	Low	73.9	Confident	128 Å²	128	106.8 Å²	106.8	67%	0.67	56%	0.563	S	S	*	*	H	α-helix	trans	-86.3	-23.1	-177.9	-87.8	87.3	0	0	0	114.1	I70 L71 P76	I70-L74 HydrophobicContact CG2-CD1 3.41Å; I70-L74 VanDerWaalsContact CG2-CD1 3.41Å; I70-L74 WeakPolarHBondContact O-CD1 3.08Å; I70-L74 PolarHBondContact O-N 3.25Å; L71-L74 PolarHBondContact O-N 3.21Å; L74-P76 VanDerWaalsContact O-CD 3.31Å; L74-P76 WeakPolarHBondContact O-CD 3.33Å
75	N	65.4	Low	74	Confident	128 Å²	128	108.5 Å²	108.5	68%	0.684	57%	0.568	S	S	*	*	S	Bend	trans	-116.3	58.3	169.9	-166.3	46	0	0	0	112.2	L77	N75-L77 PolarHBondContact O-N 3.45Å; N75-L77 VanDerWaalsContact O-N 3.14Å
76	P	58.9	Low	74.2	Confident	82 Å²	82	104.8 Å²	104.8	53%	0.532	56%	0.557	S	S	.	*			trans	-75.8	106.3	179.8	31.7	-30	0	0	0	108.7	Q73 L74 F78	Q73-P76 VanDerWaalsContact O-CD 3.31Å; Q73-P76 WeakPolarHBondContact O-CD 3.47Å; L74-P76 VanDerWaalsContact O-CD 3.31Å; L74-P76 WeakPolarHBondContact O-CD 3.33Å; P76-F78 PolarHBondContact O-N 3.05Å; P76-F78 VanDerWaalsContact O-N 3.14Å
77	L	61.9	Low	74.2	Confident	133 Å²	133	101.3 Å²	101.3	70%	0.696	55%	0.549	S	S	*	.	S	Bend	trans	-64.4	-13.3	176.1	-122.4	72	0	0	0	113.2	N75	N75-L77 PolarHBondContact O-N 3.45Å; N75-L77 VanDerWaalsContact O-N 3.14Å
78	F	63.1	Low	74.2	Confident	177 Å²	177	106.2 Å²	106.2	78%	0.776	56%	0.563	S	S	*	*	S	Bend	trans	-141.2	129.1	-178	-59.7	-74.5	0	0	0	111.3	P76	P76-F78 PolarHBondContact O-N 3.05Å; P76-F78 VanDerWaalsContact O-N 3.14Å
79	G	72.9	Confident	74	Confident	59 Å²	59	109.9 Å²	109.9	61%	0.608	57%	0.571	S	S	*	*			trans	-85.8	157.9	173.3	0	0	0	0	0	112.8	Q81	G79-Q81 PolarHBondContact O-N 3.48Å
80	P	71.3	Confident	74.3	Confident	96 Å²	96	113 Å²	113	62%	0.623	58%	0.583	S	S	*	*			trans	-63.2	125.3	176.4	25.7	-32.4	0	0	0	111.2	L82	P80-L82 PolarHBondContact O-N 3.1Å
81	Q	73.8	Confident	74.3	Confident	192 Å²	192	117.7 Å²	117.7	90%	0.897	60%	0.6	S	S	*	*			trans	-78	108.2	174.3	-81.4	-72.4	-40.6	0	0	110	G79	G79-Q81 PolarHBondContact O-N 3.48Å
82	L	78.8	Confident	74.7	Confident	80 Å²	80	122.9 Å²	122.9	42%	0.419	61%	0.614	S	S	.	*			trans	-113.6	139.3	-177.3	-130.5	73.6	0	0	0	111.3	P80 T86 I87 L90	P80-L82 PolarHBondContact O-N 3.1Å; L82-T86 HydrophobicContact CD2-CG2 3.65Å; L82-T86 HydrophobicContact CG-CG2 3.97Å; L82-I87 HydrophobicContact CB-CD1 4.42Å; L82-I87 HydrophobicContact CB-CG1 4.04Å; L82-I87 HydrophobicContact CD2-CG1 4.13Å; L82-L90 HydrophobicContact CD2-CD1 3.88Å
83	K	74.6	Confident	75.4	Confident	158 Å²	158	127 Å²	127	69%	0.687	62%	0.621	S	S	*	*			trans	-71.5	148.3	174.6	-61.7	-178.8	-177.1	178.3	0	110	E85 T86 I87	K83-E85 HydrophobicContact CB-CG 4.5Å; K83-E85 PolarHBondContact O-N 3.21Å; K83-T86 WeakPolarHBondContact O-CB 3.37Å; K83-T86 PolarHBondContact O-N 3.39Å; K83-I87 PolarHBondContact O-N 2.99Å
84	N	81.2	Confident	75.8	Confident	100 Å²	100	133.6 Å²	133.6	54%	0.535	64%	0.643	S	S	.	*	H	α-helix	trans	-59.8	-36.2	-169.6	-153.3	60.7	0	0	0	112.3	T86 I87 W88	N84-T86 VanDerWaalsContact C-N 3.31Å; N84-T86 PolarHBondContact O-N 3.46Å; N84-I87 PolarHBondContact O-N 3.01Å; N84-W88 VanDerWaalsContact O-CD1 3.24Å; N84-W88 PolarHBondContact O-N 2.94Å
85	E	80.1	Confident	75.6	Confident	127 Å²	127	136.4 Å²	136.4	59%	0.593	67%	0.668	S	S	*	*	H	α-helix	trans	-61.6	-38.4	176.5	9.1	-62	128.9	0	0	111.8	K83 Y89	K83-E85 HydrophobicContact CB-CG 4.5Å; K83-E85 PolarHBondContact O-N 3.21Å; E85-Y89 WeakPolarHBondContact O-CD2 3.47Å; E85-Y89 PolarHBondContact O-N 3.31Å
86	T	82.3	Confident	76.1	Confident	61 Å²	61	136.8 Å²	136.8	37%	0.374	67%	0.668	S	S	.	*	H	α-helix	trans	-72.7	-30.6	179.5	-45.8	0	0	0	0	112.1	L82 K83 N84 Y89 L90	L82-T86 HydrophobicContact CD2-CG2 3.65Å; L82-T86 HydrophobicContact CG-CG2 3.97Å; K83-T86 WeakPolarHBondContact O-CB 3.37Å; K83-T86 PolarHBondContact O-N 3.39Å; N84-T86 VanDerWaalsContact C-N 3.31Å; N84-T86 PolarHBondContact O-N 3.46Å; T86-Y89 PolarHBondContact O-N 2.88Å; T86-L90 HydrophobicContact CG2-CD1 4.14Å; T86-L90 PolarHBondContact O-N 3.24Å
87	I	81.9	Confident	77	Confident	80 Å²	80	139.7 Å²	139.7	41%	0.41	68%	0.675	S	S	.	*	H	α-helix	trans	-66.5	-44.5	177.4	-63.8	169.7	0	0	0	110.6	L82 K83 N84 Y89 L90 K91	L82-I87 HydrophobicContact CB-CD1 4.42Å; L82-I87 HydrophobicContact CB-CG1 4.04Å; L82-I87 HydrophobicContact CD2-CG1 4.13Å; K83-I87 PolarHBondContact O-N 2.99Å; N84-I87 PolarHBondContact O-N 3.01Å; I87-Y89 VanDerWaalsContact C-N 3.33Å; I87-Y89 PolarHBondContact O-N 3.43Å; I87-L90 PolarHBondContact O-N 3.21Å; I87-K91 PolarHBondContact O-N 3.42Å
88	W	82.9	Confident	77.8	Confident	167 Å²	167	140.1 Å²	140.1	63%	0.633	67%	0.673	S	S	*	*	H	α-helix	trans	-61.7	-42	175.8	-77.8	107	0	0	0	112.1	N84 L90 K91 Y92	N84-W88 VanDerWaalsContact O-CD1 3.24Å; N84-W88 PolarHBondContact O-N 2.94Å; W88-L90 PolarHBondContact O-N 3.42Å; W88-K91 PolarHBondContact O-N 3.35Å; W88-Y92 PolarHBondContact O-N 3.4Å
89	Y	82.5	Confident	78.7	Confident	185 Å²	185	137.9 Å²	137.9	73%	0.725	67%	0.667	S	S	*	*	H	α-helix	trans	-60.6	-43.4	174.4	-98.2	-78.9	0	0	0	112.9	E85 T86 I87 Y92 H93	E85-Y89 WeakPolarHBondContact O-CD2 3.47Å; E85-Y89 PolarHBondContact O-N 3.31Å; T86-Y89 PolarHBondContact O-N 2.88Å; I87-Y89 VanDerWaalsContact C-N 3.33Å; I87-Y89 PolarHBondContact O-N 3.43Å; Y89-Y92 PolarHBondContact O-N 3Å; Y89-H93 WeakPolarHBondContact O-CB 3.39Å; Y89-H93 PolarHBondContact O-N 2.9Å; Y89-H93 VanDerWaalsContact O-N 3.09Å
90	L	83.2	Confident	79	Confident	104 Å²	104	142.8 Å²	142.8	55%	0.545	67%	0.671	S	S	.	*	H	α-helix	trans	-63.8	-45	179.2	-110.2	109.8	0	0	0	112.3	L82 T86 I87 W88 Y92 H93 W94	L82-L90 HydrophobicContact CD2-CD1 3.88Å; T86-L90 HydrophobicContact CG2-CD1 4.14Å; T86-L90 PolarHBondContact O-N 3.24Å; I87-L90 PolarHBondContact O-N 3.21Å; W88-L90 PolarHBondContact O-N 3.42Å; L90-Y92 PolarHBondContact O-N 3.29Å; L90-H93 PolarHBondContact O-N 3.13Å; L90-W94 PolarHBondContact O-N 3.13Å
91	K	81.6	Confident	79.5	Confident	158 Å²	158	145.9 Å²	145.9	69%	0.687	67%	0.674	S	S	*	*	H	α-helix	trans	-63.4	-29.2	-179.6	-169.4	-176.8	179.6	178.1	0	112.7	I87 W88	I87-K91 PolarHBondContact O-N 3.42Å; W88-K91 PolarHBondContact O-N 3.35Å
92	Y	84.4	Confident	80	Confident	213 Å²	213	142.6 Å²	142.6	84%	0.835	66%	0.658	S	S	*	*	H	α-helix	trans	-83.8	-34.4	178.9	-168	-96.1	0	0	0	112.7	W88 Y89 L90	W88-Y92 PolarHBondContact O-N 3.4Å; Y89-Y92 PolarHBondContact O-N 3Å; L90-Y92 PolarHBondContact O-N 3.29Å
93	H	88.4	Confident	80	Confident	160 Å²	160	147.5 Å²	147.5	74%	0.741	68%	0.677	S	S	*	*	H	α-helix	trans	-86.1	-22.2	-176.1	-158.7	66.4	0	0	0	113.8	Y89 L90	Y89-H93 WeakPolarHBondContact O-CB 3.39Å; Y89-H93 PolarHBondContact O-N 2.9Å; Y89-H93 VanDerWaalsContact O-N 3.09Å; L90-H93 PolarHBondContact O-N 3.13Å
94	W	75	Confident	80.5	Confident	218 Å²	218	146.6 Å²	146.6	83%	0.826	68%	0.676	S	S	*	*			trans	-122.5	95.8	176.9	-118.4	42.3	0	0	0	109.5	L90	L90-W94 PolarHBondContact O-N 3.13Å
95	P	62.5	Low	80.4	Confident	186 Å²	186	150.8 Å²	150.8	100%	1.208	69%	0.689	S	S	*	*			trans	-68.2	0	-179.7	29.3	-34.8	0	0	0	113.1

Retrieved 95 of 95 residues in 147.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).