PSK4_ORYSJ Loading...

Phytosulfokines 4

Promotes plant cell differentiation, organogenesis and somatic embryogenesis as well as cell proliferation.

AlphaFold DB , UniProt , Accession Q9AR88, Species ORYSJ (Oryza sativa subsp. japonica, Rice), Gene PSK4, Length 83 aa.

						>PSK4_ORYSJ|Q9AR88|PSK4
MAARTVAVAAALAVLLIFAASSATVAMAGRPTPTTSLDEEAAQAAAQSEIGGGCKEGEGEEECLARRTLTAHTDYIYTQQHHN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	69.8	Low	89.1	Confident	205 Å²	205	97.7 Å²	97.7	100%	1.01	61%	0.606	S	S	*	*				0	-45.3	0	-64.1	-175.2	-156	0	0	112.1	A3 R4 T5	M1-A3 PolarHBondContact O-N 2.84Å; M1-R4 WeakPolarHBondContact O-CB 3.4Å; M1-R4 PolarHBondContact O-N 3.25Å; M1-T5 PolarHBondContact O-N 2.93Å
2	A	84.2	Confident	89.6	Confident	71 Å²	71	98.1 Å²	98.1	59%	0.587	60%	0.6	S	S	*	*	H	α-helix	trans	-52.9	-42.2	179	0	0	0	0	0	115.1	R4 T5 V6	A2-R4 VanDerWaalsContact C-N 3.28Å; A2-R4 PolarHBondContact O-N 3.32Å; A2-T5 WeakPolarHBondContact CA-OG1 3.48Å; A2-T5 PolarHBondContact O-N 3.19Å; A2-T5 PolarHBondContact O-OG1 2.99Å; A2-V6 VanDerWaalsContact O-CG2 3.3Å; A2-V6 WeakPolarHBondContact O-CG2 3.3Å; A2-V6 PolarHBondContact O-N 3.05Å
3	A	86.4	Confident	89.9	Confident	83 Å²	83	94.3 Å²	94.3	69%	0.686	59%	0.585	S	S	*	*	H	α-helix	trans	-61.8	-36.1	178.1	0	0	0	0	0	112.9	M1 A7	M1-A3 PolarHBondContact O-N 2.84Å; A3-A7 WeakPolarHBondContact O-CB 3.49Å; A3-A7 PolarHBondContact O-N 3.28Å
4	R	90.1	Very high	90.2	Very high	208 Å²	208	94.6 Å²	94.6	79%	0.785	59%	0.586	S	S	*	*	H	α-helix	trans	-69.6	-43.1	176.4	-75.6	-176.9	161.9	179.7	-5.8	111.3	M1 A2 V6 A7 V8	M1-R4 WeakPolarHBondContact O-CB 3.4Å; M1-R4 PolarHBondContact O-N 3.25Å; A2-R4 VanDerWaalsContact C-N 3.28Å; A2-R4 PolarHBondContact O-N 3.32Å; R4-V6 VanDerWaalsContact C-N 3.34Å; R4-V6 PolarHBondContact O-N 3Å; R4-A7 PolarHBondContact O-N 3.46Å; R4-V8 VanDerWaalsContact O-CG2 3.26Å; R4-V8 WeakPolarHBondContact O-CG2 3.36Å; R4-V8 PolarHBondContact O-N 3.44Å
5	T	90.2	Very high	90.2	Very high	89 Å²	89	96.5 Å²	96.5	55%	0.546	59%	0.59	S	S	.	*	H	α-helix	trans	-65.9	-38.3	178.5	54.9	0	0	0	0	111.6	M1 A2 V8 A9	M1-T5 PolarHBondContact O-N 2.93Å; A2-T5 WeakPolarHBondContact CA-OG1 3.48Å; A2-T5 PolarHBondContact O-N 3.19Å; A2-T5 PolarHBondContact O-OG1 2.99Å; T5-V8 PolarHBondContact O-N 3.5Å; T5-A9 WeakPolarHBondContact O-CB 3.4Å; T5-A9 PolarHBondContact O-N 2.92Å
6	V	91.5	Very high	90.2	Very high	98 Å²	98	98.4 Å²	98.4	59%	0.594	60%	0.595	S	S	*	*	H	α-helix	trans	-65	-44	174.1	173.6	0	0	0	0	111.2	A2 R4 V8 A9 A10	A2-V6 VanDerWaalsContact O-CG2 3.3Å; A2-V6 WeakPolarHBondContact O-CG2 3.3Å; A2-V6 PolarHBondContact O-N 3.05Å; R4-V6 VanDerWaalsContact C-N 3.34Å; R4-V6 PolarHBondContact O-N 3Å; V6-V8 PolarHBondContact O-N 3.43Å; V6-A9 PolarHBondContact O-N 2.98Å; V6-A10 WeakPolarHBondContact O-CB 3.35Å; V6-A10 PolarHBondContact O-N 2.93Å
7	A	92.1	Very high	90	Very high	60 Å²	60	99.7 Å²	99.7	50%	0.496	60%	0.596	S	S	.	*	H	α-helix	trans	-62.6	-41.8	177	0	0	0	0	0	112.5	A3 R4 A10 A11	A3-A7 WeakPolarHBondContact O-CB 3.49Å; A3-A7 PolarHBondContact O-N 3.28Å; R4-A7 PolarHBondContact O-N 3.46Å; A7-A10 PolarHBondContact O-N 3.33Å; A7-A11 WeakPolarHBondContact O-CB 3.46Å; A7-A11 PolarHBondContact O-N 2.92Å
8	V	94.1	Very high	89.7	Confident	88 Å²	88	102.6 Å²	102.6	53%	0.533	60%	0.6	S	S	.	*	H	α-helix	trans	-65.5	-44.6	176.3	172.8	0	0	0	0	110.9	R4 T5 V6 A10 A11 L12	R4-V8 VanDerWaalsContact O-CG2 3.26Å; R4-V8 WeakPolarHBondContact O-CG2 3.36Å; R4-V8 PolarHBondContact O-N 3.44Å; T5-V8 PolarHBondContact O-N 3.5Å; V6-V8 PolarHBondContact O-N 3.43Å; V8-A10 VanDerWaalsContact C-N 3.34Å; V8-A10 PolarHBondContact O-N 3.06Å; V8-A11 PolarHBondContact O-N 3.35Å; V8-L12 HydrophobicContact CG1-CD1 4.09Å; V8-L12 HydrophobicContact CG1-CG 4.45Å; V8-L12 WeakPolarHBondContact O-CG 3.38Å; V8-L12 PolarHBondContact O-N 3.01Å
9	A	93.5	Very high	89.3	Confident	59 Å²	59	100.3 Å²	100.3	49%	0.488	59%	0.593	S	S	.	*	H	α-helix	trans	-61.6	-41.4	177.2	0	0	0	0	0	112.2	T5 V6 L12 A13	T5-A9 WeakPolarHBondContact O-CB 3.4Å; T5-A9 PolarHBondContact O-N 2.92Å; V6-A9 PolarHBondContact O-N 2.98Å; A9-L12 PolarHBondContact O-N 3.48Å; A9-A13 WeakPolarHBondContact O-CB 3.34Å; A9-A13 PolarHBondContact O-N 3.47Å
10	A	93.6	Very high	88.8	Confident	54 Å²	54	98.5 Å²	98.5	45%	0.446	59%	0.59	S	S	.	*	H	α-helix	trans	-63.7	-43.6	175.5	0	0	0	0	0	112	V6 A7 V8 L12 A13 V14	V6-A10 WeakPolarHBondContact O-CB 3.35Å; V6-A10 PolarHBondContact O-N 2.93Å; A7-A10 PolarHBondContact O-N 3.33Å; V8-A10 VanDerWaalsContact C-N 3.34Å; V8-A10 PolarHBondContact O-N 3.06Å; A10-L12 PolarHBondContact O-N 3.28Å; A10-A13 PolarHBondContact O-N 3.27Å; A10-V14 WeakPolarHBondContact O-CG2 3.32Å; A10-V14 PolarHBondContact O-N 3.32Å
11	A	94.8	Very high	88.1	Confident	60 Å²	60	96.5 Å²	96.5	50%	0.496	58%	0.581	S	S	.	*	H	α-helix	trans	-61.7	-43.4	176.8	0	0	0	0	0	112.1	A7 V8 V14 L15	A7-A11 WeakPolarHBondContact O-CB 3.46Å; A7-A11 PolarHBondContact O-N 2.92Å; V8-A11 PolarHBondContact O-N 3.35Å; A11-V14 PolarHBondContact O-N 3.08Å; A11-L15 WeakPolarHBondContact O-CB 3.26Å; A11-L15 PolarHBondContact O-N 3.49Å; A11-L15 VanDerWaalsContact O-N 3.08Å
12	L	94.9	Very high	88	Confident	102 Å²	102	90.4 Å²	90.4	53%	0.534	56%	0.559	S	S	.	*	H	α-helix	trans	-63.2	-41.8	176.3	-69.3	173.3	0	0	0	112	V8 A9 A10 V14 L15 L16	V8-L12 HydrophobicContact CG1-CD1 4.09Å; V8-L12 HydrophobicContact CG1-CG 4.45Å; V8-L12 WeakPolarHBondContact O-CG 3.38Å; V8-L12 PolarHBondContact O-N 3.01Å; A9-L12 PolarHBondContact O-N 3.48Å; A10-L12 PolarHBondContact O-N 3.28Å; L12-V14 PolarHBondContact O-N 3.49Å; L12-L15 PolarHBondContact O-N 2.97Å; L12-L16 WeakPolarHBondContact O-CG 3.37Å; L12-L16 PolarHBondContact O-N 3.49Å
13	A	93.7	Very high	87	Confident	49 Å²	49	90.7 Å²	90.7	41%	0.405	56%	0.561	S	S	.	*	H	α-helix	trans	-62.3	-42.6	177.3	0	0	0	0	0	112.4	A9 A10 L15 L16 I17	A9-A13 WeakPolarHBondContact O-CB 3.34Å; A9-A13 PolarHBondContact O-N 3.47Å; A10-A13 PolarHBondContact O-N 3.27Å; A13-L15 VanDerWaalsContact C-N 3.33Å; A13-L15 PolarHBondContact O-N 3.04Å; A13-L16 PolarHBondContact O-N 3.31Å; A13-I17 VanDerWaalsContact O-CG1 3.32Å; A13-I17 WeakPolarHBondContact O-CG1 3.48Å; A13-I17 PolarHBondContact O-N 3.4Å; A13-I17 VanDerWaalsContact O-N 3.08Å
14	V	93.4	Very high	85.7	Confident	98 Å²	98	91.8 Å²	91.8	59%	0.594	56%	0.559	S	S	*	*	H	α-helix	trans	-62.8	-41.5	176	173.2	0	0	0	0	111.3	A10 A11 L12 L16 I17 F18	A10-V14 WeakPolarHBondContact O-CG2 3.32Å; A10-V14 PolarHBondContact O-N 3.32Å; A11-V14 PolarHBondContact O-N 3.08Å; L12-V14 PolarHBondContact O-N 3.49Å; V14-L16 VanDerWaalsContact C-N 3.35Å; V14-L16 PolarHBondContact O-N 3.48Å; V14-I17 PolarHBondContact O-N 3.38Å; V14-F18 PolarHBondContact O-N 3.08Å
15	L	91.3	Very high	84.2	Confident	123 Å²	123	87.3 Å²	87.3	64%	0.644	56%	0.555	S	S	*	*	H	α-helix	trans	-64.8	-39.5	179.7	-143.7	154.3	0	0	0	111.5	A11 L12 A13 F18 A19	A11-L15 WeakPolarHBondContact O-CB 3.26Å; A11-L15 PolarHBondContact O-N 3.49Å; A11-L15 VanDerWaalsContact O-N 3.08Å; L12-L15 PolarHBondContact O-N 2.97Å; A13-L15 VanDerWaalsContact C-N 3.33Å; A13-L15 PolarHBondContact O-N 3.04Å; L15-F18 PolarHBondContact O-N 3.44Å; L15-A19 WeakPolarHBondContact O-CB 3.43Å; L15-A19 PolarHBondContact O-N 3.35Å
16	L	89.1	Confident	82.6	Confident	128 Å²	128	87.5 Å²	87.5	67%	0.67	57%	0.566	S	S	*	*	H	α-helix	trans	-64.6	-42.3	174.2	-72.2	172.3	0	0	0	112.7	L12 A13 V14 F18 A19 A20	L12-L16 WeakPolarHBondContact O-CG 3.37Å; L12-L16 PolarHBondContact O-N 3.49Å; A13-L16 PolarHBondContact O-N 3.31Å; V14-L16 VanDerWaalsContact C-N 3.35Å; V14-L16 PolarHBondContact O-N 3.48Å; L16-F18 VanDerWaalsContact C-N 3.35Å; L16-A19 PolarHBondContact O-N 3.48Å; L16-A20 WeakPolarHBondContact O-CB 3.47Å; L16-A20 PolarHBondContact O-N 2.95Å
17	I	87.4	Confident	80.8	Confident	120 Å²	120	91 Å²	91	62%	0.615	58%	0.577	S	S	*	*	H	α-helix	trans	-62.7	-43.9	177.2	-67.2	164.3	0	0	0	110.5	A13 V14 A20 S21	A13-I17 VanDerWaalsContact O-CG1 3.32Å; A13-I17 WeakPolarHBondContact O-CG1 3.48Å; A13-I17 PolarHBondContact O-N 3.4Å; A13-I17 VanDerWaalsContact O-N 3.08Å; V14-I17 PolarHBondContact O-N 3.38Å; I17-A20 PolarHBondContact O-N 3.4Å; I17-S21 PolarHBondContact O-N 3.42Å
18	F	83.9	Confident	78.9	Confident	152 Å²	152	92.9 Å²	92.9	67%	0.667	59%	0.593	S	S	*	*	H	α-helix	trans	-63.8	-43.6	178.5	-165.7	-97.6	0	0	0	111.8	V14 L15 L16 A20 S21 S22	V14-F18 PolarHBondContact O-N 3.08Å; L15-F18 PolarHBondContact O-N 3.44Å; L16-F18 VanDerWaalsContact C-N 3.35Å; F18-A20 PolarHBondContact O-N 3.01Å; F18-S21 PolarHBondContact O-N 3.44Å; F18-S21 PolarHBondContact O-OG 3.33Å; F18-S22 PolarHBondContact O-N 3.01Å; F18-S22 PolarHBondContact O-OG 3.31Å
19	A	83.1	Confident	76.8	Confident	58 Å²	58	91.9 Å²	91.9	48%	0.479	60%	0.601	S	S	.	*	H	α-helix	trans	-60.5	-44.2	174.9	0	0	0	0	0	112.2	L15 L16 S21 S22	L15-A19 WeakPolarHBondContact O-CB 3.43Å; L15-A19 PolarHBondContact O-N 3.35Å; L16-A19 PolarHBondContact O-N 3.48Å; A19-S21 PolarHBondContact O-N 2.88Å; A19-S22 PolarHBondContact O-N 3.34Å
20	A	78.9	Confident	74.9	Confident	64 Å²	64	97.7 Å²	97.7	53%	0.529	61%	0.61	S	S	.	*	H	α-helix	trans	-63.9	-37.6	178.2	0	0	0	0	0	112.8	L16 I17 F18 S22 A23	L16-A20 WeakPolarHBondContact O-CB 3.47Å; L16-A20 PolarHBondContact O-N 2.95Å; I17-A20 PolarHBondContact O-N 3.4Å; F18-A20 PolarHBondContact O-N 3.01Å; A20-S22 VanDerWaalsContact C-N 3.28Å; A20-S22 PolarHBondContact O-N 3.25Å; A20-A23 PolarHBondContact O-N 2.72Å
21	S	74.1	Confident	72.8	Confident	57 Å²	57	101.1 Å²	101.1	40%	0.399	63%	0.628	S	S	.	*	H	α-helix	trans	-63.9	-32.6	179.5	64.6	0	0	0	0	113.1	I17 F18 A19 A23 T24	I17-S21 PolarHBondContact O-N 3.42Å; F18-S21 PolarHBondContact O-N 3.44Å; F18-S21 PolarHBondContact O-OG 3.33Å; A19-S21 PolarHBondContact O-N 2.88Å; S21-A23 VanDerWaalsContact C-N 3.27Å; S21-A23 PolarHBondContact O-N 3.42Å; S21-T24 PolarHBondContact O-N 3.28Å; S21-T24 PolarHBondContact O-OG1 3.34Å
22	S	68.3	Low	70.8	Confident	77 Å²	77	104.1 Å²	104.1	54%	0.538	64%	0.64	S	S	.	*	H	α-helix	trans	-66.2	-27.6	-179.4	-56.4	0	0	0	0	113	F18 A19 A20 T24	F18-S22 PolarHBondContact O-N 3.01Å; F18-S22 PolarHBondContact O-OG 3.31Å; A19-S22 PolarHBondContact O-N 3.34Å; A20-S22 VanDerWaalsContact C-N 3.28Å; A20-S22 PolarHBondContact O-N 3.25Å; S22-T24 VanDerWaalsContact C-N 3.3Å; S22-T24 PolarHBondContact O-N 3.31Å
23	A	62.5	Low	68.7	Low	78 Å²	78	104.6 Å²	104.6	65%	0.645	65%	0.649	S	S	*	*	H	α-helix	trans	-72.1	-21.8	-179.9	0	0	0	0	0	113.4	A20 S21	A20-A23 PolarHBondContact O-N 2.72Å; S21-A23 VanDerWaalsContact C-N 3.27Å; S21-A23 PolarHBondContact O-N 3.42Å
24	T	60	Low	66.3	Low	105 Å²	105	108.9 Å²	108.9	64%	0.644	67%	0.671	S	S	*	*	G	3₁₀ helix	trans	-84.8	-12.9	-171.1	60.8	0	0	0	0	114.7	S21 S22	S21-T24 PolarHBondContact O-N 3.28Å; S21-T24 PolarHBondContact O-OG1 3.34Å; S22-T24 VanDerWaalsContact C-N 3.3Å; S22-T24 PolarHBondContact O-N 3.31Å
25	V	57	Low	63.9	Low	114 Å²	114	109.9 Å²	109.9	69%	0.691	68%	0.677	S	S	*	*	G	3₁₀ helix	trans	-84.3	-10.6	-173.6	-171.8	0	0	0	0	113.1	M27	V25-M27 VanDerWaalsContact C-N 3.31Å; V25-M27 PolarHBondContact O-N 3.26Å
26	A	56.9	Low	61.8	Low	94 Å²	94	108.8 Å²	108.8	78%	0.777	68%	0.68	S	S	*	*	G	3₁₀ helix	trans	-76.3	-9.3	-175.7	0	0	0	0	0	115.2
27	M	55.1	Low	59.8	Low	170 Å²	170	109.7 Å²	109.7	84%	0.837	69%	0.685	S	S	*	*	G	3₁₀ helix	trans	-104.7	-3.7	-168.7	-45.8	-150.5	-51.9	0	0	115.7	V25 G29	V25-M27 VanDerWaalsContact C-N 3.31Å; V25-M27 PolarHBondContact O-N 3.26Å; M27-G29 PolarHBondContact O-N 3.32Å
28	A	51.3	Low	58.1	Low	100 Å²	100	109.9 Å²	109.9	83%	0.826	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.9	13.9	-169.1	0	0	0	0	0	115.8
29	G	49.8	Very low	56.7	Low	67 Å²	67	109.7 Å²	109.7	69%	0.691	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.3	-8.1	-167.7	0	0	0	0	0	117.9	M27	M27-G29 PolarHBondContact O-N 3.32Å
30	R	53.7	Low	55.2	Low	182 Å²	182	115.3 Å²	115.3	69%	0.687	70%	0.704	S	S	*	*			trans	-126	106.4	-175.5	-64.9	-170.8	-179.5	-151.8	2.4	110.7	T32	R30-T32 PolarHBondContact O-N 2.86Å
31	P	50.5	Low	53.9	Low	125 Å²	125	115.2 Å²	115.2	81%	0.812	70%	0.704	S	S	*	*			trans	-60.3	110.1	166	24.7	-30.2	0	0	0	107.3	P33	P31-P33 WeakPolarHBondContact O-CD 3.21Å
32	T	51.4	Low	52.9	Low	123 Å²	123	115.2 Å²	115.2	76%	0.755	71%	0.707	S	S	*	*			trans	-56.9	116.7	174.4	39.5	0	0	0	0	108.5	R30 T34	R30-T32 PolarHBondContact O-N 2.86Å; T32-T34 PolarHBondContact O-N 3.25Å
33	P	51	Low	52.1	Low	113 Å²	113	117.8 Å²	117.8	73%	0.734	71%	0.71	S	S	*	*			trans	-64.7	120.2	172.8	26.2	-31.2	0	0	0	108	P31 T35	P31-P33 WeakPolarHBondContact O-CD 3.21Å; P33-T35 VanDerWaalsContact C-N 3.34Å; P33-T35 PolarHBondContact O-N 3.13Å
34	T	43.7	Very low	51.7	Low	139 Å²	139	117.3 Å²	117.3	85%	0.853	71%	0.706	S	S	*	*			trans	-65.4	92.4	173.6	51.9	0	0	0	0	108.9	T32	T32-T34 PolarHBondContact O-N 3.25Å
35	T	43.9	Very low	51.3	Low	118 Å²	118	115 Å²	115	72%	0.724	70%	0.697	S	S	*	*			trans	-126.1	99.9	158.4	34.3	0	0	0	0	106.9	P33	P33-T35 VanDerWaalsContact C-N 3.34Å; P33-T35 PolarHBondContact O-N 3.13Å
36	S	45.4	Very low	51.1	Low	100 Å²	100	112 Å²	112	70%	0.699	69%	0.685	S	S	*	*			trans	-45.7	141.6	171.9	40	0	0	0	0	112.4
37	L	48.8	Very low	50.9	Low	148 Å²	148	115.4 Å²	115.4	78%	0.775	69%	0.685	S	S	*	*	S	Bend	trans	84.5	120.2	-179.7	-46.6	168.5	0	0	0	111.3
38	D	51	Low	50.7	Low	124 Å²	124	111.5 Å²	111.5	66%	0.663	68%	0.675	S	S	*	*			trans	92.2	26	-178.7	-48.7	-53.4	0	0	0	117.6	E40 A41 A42	D38-E40 VanDerWaalsContact C-N 3.3Å; D38-E40 PolarHBondContact O-N 2.93Å; D38-A41 HydrophobicContact CB-CB 4.47Å; D38-A41 PolarHBondContact O-N 3.3Å; D38-A42 WeakPolarHBondContact O-CB 3.29Å; D38-A42 PolarHBondContact O-N 3.18Å
39	E	53.9	Low	50.9	Low	148 Å²	148	114.9 Å²	114.9	69%	0.692	67%	0.673	S	S	*	*	H	α-helix	trans	-53.2	-39	174.9	-95.9	163.2	91.3	0	0	114	Q43	E39-Q43 VanDerWaalsContact O-CB 3.3Å; E39-Q43 WeakPolarHBondContact O-CB 3.3Å; E39-Q43 VanDerWaalsContact O-CG 3.29Å; E39-Q43 WeakPolarHBondContact O-CG 3.27Å; E39-Q43 PolarHBondContact O-N 2.97Å; E39-Q43 VanDerWaalsContact O-N 3.13Å
40	E	52.5	Low	51.1	Low	176 Å²	176	116.6 Å²	116.6	82%	0.822	67%	0.666	S	S	*	*	H	α-helix	trans	-73.9	-40.1	178.9	-88.5	172.1	78.4	0	0	113.2	D38 A44	D38-E40 VanDerWaalsContact C-N 3.3Å; D38-E40 PolarHBondContact O-N 2.93Å; E40-A44 PolarHBondContact O-N 3.33Å
41	A	51.4	Low	51.2	Low	62 Å²	62	109.7 Å²	109.7	51%	0.512	65%	0.651	S	S	.	*	H	α-helix	trans	-75.6	-38.2	-179.6	0	0	0	0	0	111.7	D38 A44 A45	D38-A41 HydrophobicContact CB-CB 4.47Å; D38-A41 PolarHBondContact O-N 3.3Å; A41-A44 PolarHBondContact O-N 2.96Å; A41-A45 WeakPolarHBondContact O-CB 3.25Å; A41-A45 PolarHBondContact O-N 3.18Å
42	A	53.4	Low	51.7	Low	56 Å²	56	105.4 Å²	105.4	46%	0.463	63%	0.629	S	S	.	*	H	α-helix	trans	-69	-36.5	177.3	0	0	0	0	0	112	D38 A45 A46	D38-A42 WeakPolarHBondContact O-CB 3.29Å; D38-A42 PolarHBondContact O-N 3.18Å; A42-A45 PolarHBondContact O-N 2.88Å; A42-A46 WeakPolarHBondContact O-CB 3Å; A42-A46 PolarHBondContact O-N 3.45Å
43	Q	51	Low	52.5	Low	132 Å²	132	102 Å²	102	62%	0.617	62%	0.619	S	S	*	*	H	α-helix	trans	-63.7	-41.2	173.8	-85.1	-178.4	-22	0	0	112.3	E39 Q47	E39-Q43 VanDerWaalsContact O-CB 3.3Å; E39-Q43 WeakPolarHBondContact O-CB 3.3Å; E39-Q43 VanDerWaalsContact O-CG 3.29Å; E39-Q43 WeakPolarHBondContact O-CG 3.27Å; E39-Q43 PolarHBondContact O-N 2.97Å; E39-Q43 VanDerWaalsContact O-N 3.13Å; Q43-Q47 PolarHBondContact O-N 3.25Å
44	A	53.2	Low	53.7	Low	67 Å²	67	100.1 Å²	100.1	55%	0.554	61%	0.607	S	S	*	*	H	α-helix	trans	-67	-42.4	176.8	0	0	0	0	0	112.1	E40 A41 S48	E40-A44 PolarHBondContact O-N 3.33Å; A41-A44 PolarHBondContact O-N 2.96Å; A44-S48 PolarHBondContact O-N 3Å
45	A	53.4	Low	55.5	Low	56 Å²	56	100.5 Å²	100.5	46%	0.463	60%	0.597	S	S	.	*	H	α-helix	trans	-68.1	-43.4	178.7	0	0	0	0	0	112.5	A41 A42 Q47 S48 E49	A41-A45 WeakPolarHBondContact O-CB 3.25Å; A41-A45 PolarHBondContact O-N 3.18Å; A42-A45 PolarHBondContact O-N 2.88Å; A45-Q47 VanDerWaalsContact C-N 3.33Å; A45-Q47 PolarHBondContact O-N 3.39Å; A45-S48 WeakPolarHBondContact O-CB 3.21Å; A45-S48 PolarHBondContact O-N 3.39Å; A45-E49 PolarHBondContact O-N 3.41Å
46	A	52.7	Low	57.1	Low	53 Å²	53	104.6 Å²	104.6	44%	0.438	61%	0.608	S	S	.	*	H	α-helix	trans	-65.9	-33.9	-179.1	0	0	0	0	0	112.8	A42 S48	A42-A46 WeakPolarHBondContact O-CB 3Å; A42-A46 PolarHBondContact O-N 3.45Å; A46-S48 VanDerWaalsContact C-N 3.29Å; A46-S48 PolarHBondContact O-N 3.05Å
47	Q	51.2	Low	58.8	Low	165 Å²	165	104 Å²	104	77%	0.771	62%	0.617	S	S	*	*	H	α-helix	trans	-66.6	-30.7	172.1	-100.5	-178.4	64.3	0	0	112.7	Q43 A45	Q43-Q47 PolarHBondContact O-N 3.25Å; A45-Q47 VanDerWaalsContact C-N 3.33Å; A45-Q47 PolarHBondContact O-N 3.39Å
48	S	52.4	Low	60.4	Low	88 Å²	88	98.6 Å²	98.6	62%	0.615	59%	0.588	S	S	*	*	H	α-helix	trans	-77.2	-28.6	-179.2	-169.3	0	0	0	0	113.1	A44 A45 A46	A44-S48 PolarHBondContact O-N 3Å; A45-S48 WeakPolarHBondContact O-CB 3.21Å; A45-S48 PolarHBondContact O-N 3.39Å; A46-S48 VanDerWaalsContact C-N 3.29Å; A46-S48 PolarHBondContact O-N 3.05Å
49	E	54.5	Low	61.9	Low	170 Å²	170	94.1 Å²	94.1	79%	0.794	57%	0.572	S	S	*	*	H	α-helix	trans	-91.5	-28.7	-166.8	-135.7	-172	128.2	0	0	114.7	A45 G51	A45-E49 PolarHBondContact O-N 3.41Å; E49-G51 VanDerWaalsContact C-N 3.31Å; E49-G51 PolarHBondContact O-N 3.49Å
50	I	54.9	Low	63.3	Low	104 Å²	104	94.7 Å²	94.7	53%	0.533	57%	0.574	S	S	.	*	T	Hydrogen-bonded Turn	trans	-88.3	3	-167.3	-59.8	167.5	0	0	0	113.5
51	G	54.9	Low	64.8	Low	37 Å²	37	93.4 Å²	93.4	38%	0.381	57%	0.568	S	S	.	*	T	Hydrogen-bonded Turn	trans	143.5	69.9	177.3	0	0	0	0	0	108.9	E49 G53	E49-G51 VanDerWaalsContact C-N 3.31Å; E49-G51 PolarHBondContact O-N 3.49Å; G51-G53 PolarHBondContact O-N 3.21Å
52	G	62.2	Low	66.5	Low	35 Å²	35	95.8 Å²	95.8	36%	0.361	57%	0.569	S	S	.	*			trans	-30.4	119.4	-174.2	0	0	0	0	0	111.3
53	G	67.3	Low	68	Low	51 Å²	51	93.2 Å²	93.2	53%	0.526	55%	0.548	S	S	.	.	P	Polyproline II helix	trans	-52.2	162.8	-179.4	0	0	0	0	0	112	G51 K55	G51-G53 PolarHBondContact O-N 3.21Å; G53-K55 PolarHBondContact O-N 2.01Å
54	C	76.1	Confident	69.5	Low	74 Å²	74	92.1 Å²	92.1	50%	0.5	55%	0.545	S	S	.	.	P	Polyproline II helix	trans	-57.6	129.9	176.5	-48.5	0	0	0	0	109.2	C63	C54-C63 WeakPolarHBondContact CA-SG 3.45Å; C54-C63 HydrophobicContact CB-CB 3.51Å; C54-C63 WeakPolarHBondContact CB-SG 2.96Å; C54-C63 WeakPolarHBondContact SG-CB 3.47Å; C54-C63 CovalentContact SG-SG 2.01Å; C54-C63 PolarHBondContact SG-SG 3.46Å
55	K	80.9	Confident	70.9	Confident	146 Å²	146	91.2 Å²	91.2	64%	0.635	54%	0.538	S	S	*	.	P	Polyproline II helix	trans	-66.8	146.9	176.4	-70.5	-173.7	172.3	-175.8	0	109.6	G53 G57 E58	G53-K55 PolarHBondContact O-N 2.01Å; K55-G57 PolarHBondContact O-N 3.03Å; K55-E58 HydrophobicContact CB-CB 4.1Å; K55-E58 VanDerWaalsContact O-CB 3.25Å; K55-E58 WeakPolarHBondContact O-CB 3.42Å; K55-E58 PolarHBondContact O-N 3.28Å
56	E	78.9	Confident	72.1	Confident	205 Å²	205	93.8 Å²	93.8	96%	0.958	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.5	120.3	176.2	-166.2	166.3	-175.5	0	0	109.7
57	G	81	Confident	73.2	Confident	86 Å²	86	98.2 Å²	98.2	89%	0.887	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	90.4	-3.6	-174	0	0	0	0	0	115.7	K55	K55-G57 PolarHBondContact O-N 3.03Å
58	E	81.3	Confident	74.4	Confident	35 Å²	35	95.1 Å²	95.1	16%	0.164	53%	0.533	C	S	.	.			trans	-75.6	139.4	169.5	-168.6	175.6	130	0	0	109.8	K55 E62 C63 R66	K55-E58 HydrophobicContact CB-CB 4.1Å; K55-E58 VanDerWaalsContact O-CB 3.25Å; K55-E58 WeakPolarHBondContact O-CB 3.42Å; K55-E58 PolarHBondContact O-N 3.28Å; E58-E62 HydrophobicContact CG-CB 4Å; E58-E62 HydrophobicContact CG-CG 4.13Å; E58-C63 WeakPolarHBondContact OE1-CA 3.33Å; E58-C63 WeakPolarHBondContact OE1-CB 3.4Å; E58-C63 PolarHBondContact OE1-N 2.81Å; E58-C63 VanDerWaalsContact OE1-N 3.17Å; E58-R66 IonicContact OE1-NH1 3.09Å; E58-R66 PolarHBondContact OE1-NH1 3.31Å; E58-R66 VanDerWaalsContact OE1-NH1 3.09Å; E58-R66 IonicContact OE2-NH1 2.81Å; E58-R66 PolarHBondContact OE2-NH1 3.05Å
59	G	82.2	Confident	75.5	Confident	31 Å²	31	98 Å²	98	32%	0.32	54%	0.541	S	S	.	.			trans	-63.1	140.6	174.3	0	0	0	0	0	110.9	E61 E62 C63	G59-E61 PolarHBondContact O-N 3.09Å; G59-E61 VanDerWaalsContact O-N 3.16Å; G59-E62 PolarHBondContact O-N 3.12Å; G59-C63 PolarHBondContact O-N 3.17Å; G59-C63 VanDerWaalsContact O-N 3.12Å
60	E	83.2	Confident	76.3	Confident	159 Å²	159	94.4 Å²	94.4	74%	0.743	53%	0.531	S	S	*	.	H	α-helix	trans	-55.3	-34.9	179.4	62.2	-161.1	124.8	0	0	112.6	L64	E60-L64 WeakPolarHBondContact O-CB 3.07Å; E60-L64 WeakPolarHBondContact O-CG 3.33Å; E60-L64 PolarHBondContact O-N 3.04Å
61	E	85.7	Confident	77	Confident	150 Å²	150	92.9 Å²	92.9	70%	0.701	53%	0.534	S	S	*	.	H	α-helix	trans	-66.9	-40.7	175.9	63.6	-150.6	104.9	0	0	113.6	G59 L64 A65	G59-E61 PolarHBondContact O-N 3.09Å; G59-E61 VanDerWaalsContact O-N 3.16Å; E61-L64 PolarHBondContact O-N 3.26Å; E61-A65 WeakPolarHBondContact O-CB 3.49Å; E61-A65 PolarHBondContact O-N 3.49Å
62	E	85.9	Confident	78	Confident	111 Å²	111	98.4 Å²	98.4	52%	0.519	55%	0.549	S	S	.	.	H	α-helix	trans	-69	-42.6	179	-173	-176.6	164.8	0	0	110.4	E58 G59 A65 R66	E58-E62 HydrophobicContact CG-CB 4Å; E58-E62 HydrophobicContact CG-CG 4.13Å; G59-E62 PolarHBondContact O-N 3.12Å; E62-A65 PolarHBondContact O-N 2.92Å; E62-R66 WeakPolarHBondContact O-CG 3.36Å; E62-R66 PolarHBondContact O-N 3.16Å
63	C	85.8	Confident	78.6	Confident	3 Å²	3	101.6 Å²	101.6	2%	0.02	56%	0.562	C	S	.	*	H	α-helix	trans	-61.9	-46.4	175.7	175.9	0	0	0	0	112	C54 E58 G59 A65 R66 R67	C54-C63 WeakPolarHBondContact CA-SG 3.45Å; C54-C63 HydrophobicContact CB-CB 3.51Å; C54-C63 WeakPolarHBondContact CB-SG 2.96Å; C54-C63 WeakPolarHBondContact SG-CB 3.47Å; C54-C63 CovalentContact SG-SG 2.01Å; C54-C63 PolarHBondContact SG-SG 3.46Å; E58-C63 WeakPolarHBondContact OE1-CA 3.33Å; E58-C63 WeakPolarHBondContact OE1-CB 3.4Å; E58-C63 PolarHBondContact OE1-N 2.81Å; E58-C63 VanDerWaalsContact OE1-N 3.17Å; G59-C63 PolarHBondContact O-N 3.17Å; G59-C63 VanDerWaalsContact O-N 3.12Å; C63-A65 VanDerWaalsContact C-N 3.33Å; C63-A65 PolarHBondContact O-N 3.24Å; C63-R66 PolarHBondContact O-N 3.03Å; C63-R67 WeakPolarHBondContact O-CG 3.39Å; C63-R67 PolarHBondContact O-N 3.33Å
64	L	81.5	Confident	79.2	Confident	109 Å²	109	105.6 Å²	105.6	57%	0.571	57%	0.571	S	S	*	*	H	α-helix	trans	-61.4	-41.6	175.7	-84.6	169.9	0	0	0	111.9	E60 E61 R66 R67 T68	E60-L64 WeakPolarHBondContact O-CB 3.07Å; E60-L64 WeakPolarHBondContact O-CG 3.33Å; E60-L64 PolarHBondContact O-N 3.04Å; E61-L64 PolarHBondContact O-N 3.26Å; L64-R66 PolarHBondContact O-N 3.33Å; L64-R67 PolarHBondContact O-N 3.42Å; L64-T68 WeakPolarHBondContact O-CG2 3.46Å; L64-T68 PolarHBondContact O-N 3.12Å; L64-T68 PolarHBondContact O-OG1 2.92Å; L64-T68 VanDerWaalsContact O-OG1 3.12Å
65	A	82.7	Confident	79.3	Confident	48 Å²	48	111.4 Å²	111.4	40%	0.397	58%	0.584	S	S	.	*	H	α-helix	trans	-61	-45.5	176.5	0	0	0	0	0	111.6	E61 E62 C63 R67 T68 L69	E61-A65 WeakPolarHBondContact O-CB 3.49Å; E61-A65 PolarHBondContact O-N 3.49Å; E62-A65 PolarHBondContact O-N 2.92Å; C63-A65 VanDerWaalsContact C-N 3.33Å; C63-A65 PolarHBondContact O-N 3.24Å; A65-R67 VanDerWaalsContact C-N 3.35Å; A65-R67 PolarHBondContact O-N 3.32Å; A65-T68 PolarHBondContact O-N 3.5Å; A65-T68 PolarHBondContact O-OG1 2.93Å; A65-L69 WeakPolarHBondContact O-CB 3.47Å; A65-L69 PolarHBondContact O-N 3.42Å
66	R	79.2	Confident	79.4	Confident	109 Å²	109	111.3 Å²	111.3	41%	0.411	59%	0.589	S	S	.	*	H	α-helix	trans	-61.9	-40.3	176.9	-72.4	174.2	61.4	-141.5	-8.4	112.7	E58 E62 C63 L64 L69 T70	E58-R66 IonicContact OE1-NH1 3.09Å; E58-R66 PolarHBondContact OE1-NH1 3.31Å; E58-R66 VanDerWaalsContact OE1-NH1 3.09Å; E58-R66 IonicContact OE2-NH1 2.81Å; E58-R66 PolarHBondContact OE2-NH1 3.05Å; E62-R66 WeakPolarHBondContact O-CG 3.36Å; E62-R66 PolarHBondContact O-N 3.16Å; C63-R66 PolarHBondContact O-N 3.03Å; L64-R66 PolarHBondContact O-N 3.33Å; R66-L69 PolarHBondContact O-N 3.3Å; R66-T70 PolarHBondContact O-N 3.49Å; R66-T70 PolarHBondContact O-OG1 2.85Å
67	R	74.8	Confident	79.6	Confident	147 Å²	147	111.7 Å²	111.7	56%	0.555	58%	0.583	S	S	*	*	H	α-helix	trans	-65.3	-39.4	178.1	-71.9	-178.5	77.7	166.3	6.9	112.3	C63 L64 A65	C63-R67 WeakPolarHBondContact O-CG 3.39Å; C63-R67 PolarHBondContact O-N 3.33Å; L64-R67 PolarHBondContact O-N 3.42Å; A65-R67 VanDerWaalsContact C-N 3.35Å; A65-R67 PolarHBondContact O-N 3.32Å
68	T	77.8	Confident	79.7	Confident	100 Å²	100	113.4 Å²	113.4	61%	0.613	58%	0.576	S	S	*	*	H	α-helix	trans	-74.3	-33.8	179.1	52.6	0	0	0	0	112.8	L64 A65 T70 A71	L64-T68 WeakPolarHBondContact O-CG2 3.46Å; L64-T68 PolarHBondContact O-N 3.12Å; L64-T68 PolarHBondContact O-OG1 2.92Å; L64-T68 VanDerWaalsContact O-OG1 3.12Å; A65-T68 PolarHBondContact O-N 3.5Å; A65-T68 PolarHBondContact O-OG1 2.93Å; T68-T70 PolarHBondContact O-N 3.01Å; T68-A71 PolarHBondContact O-N 3.28Å
69	L	75.2	Confident	79.9	Confident	148 Å²	148	120 Å²	120	78%	0.775	61%	0.607	S	S	*	*	H	α-helix	trans	-63	-27.6	175.7	-116.1	153.5	0	0	0	113.5	A65 R66	A65-L69 WeakPolarHBondContact O-CB 3.47Å; A65-L69 PolarHBondContact O-N 3.42Å; R66-L69 PolarHBondContact O-N 3.3Å
70	T	70.6	Confident	79.6	Confident	94 Å²	94	125.8 Å²	125.8	58%	0.577	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.5	-3.9	-177.4	-42.5	0	0	0	0	112.7	R66 T68 H72	R66-T70 PolarHBondContact O-N 3.49Å; R66-T70 PolarHBondContact O-OG1 2.85Å; T68-T70 PolarHBondContact O-N 3.01Å; T70-H72 VanDerWaalsContact C-N 3.31Å; T70-H72 PolarHBondContact O-CD2 2.91Å; T70-H72 VanDerWaalsContact O-CD2 3.28Å; T70-H72 PolarHBondContact O-N 3.27Å
71	A	70.9	Confident	79.3	Confident	72 Å²	72	126 Å²	126	60%	0.595	63%	0.627	S	S	*	*			trans	-71.6	88.3	175.3	0	0	0	0	0	109.8	T68 T73	T68-A71 PolarHBondContact O-N 3.28Å; A71-T73 PolarHBondContact O-N 3.3Å
72	H	74.8	Confident	78.8	Confident	154 Å²	154	126.8 Å²	126.8	71%	0.713	63%	0.63	S	S	*	*			trans	-63.5	122.7	173.5	-68.3	-77.5	0	0	0	109.5	T70 D74	T70-H72 VanDerWaalsContact C-N 3.31Å; T70-H72 PolarHBondContact O-CD2 2.91Å; T70-H72 VanDerWaalsContact O-CD2 3.28Å; T70-H72 PolarHBondContact O-N 3.27Å; H72-D74 PolarHBondContact O-N 3.32Å
73	T	74.2	Confident	77.8	Confident	101 Å²	101	131.9 Å²	131.9	62%	0.62	66%	0.661	S	S	*	*			trans	-85.8	92.7	166.5	45.2	0	0	0	0	107.7	A71 Y75	A71-T73 PolarHBondContact O-N 3.3Å; T73-Y75 VanDerWaalsContact C-N 3.27Å; T73-Y75 VanDerWaalsContact O-CD2 3.29Å; T73-Y75 WeakPolarHBondContact O-CD2 3.29Å; T73-Y75 PolarHBondContact O-N 2.85Å; T73-Y75 VanDerWaalsContact OG1-CE2 3.26Å; T73-Y75 WeakPolarHBondContact OG1-CE2 3.26Å
74	D	79.7	Confident	77.4	Confident	136 Å²	136	138.4 Å²	138.4	73%	0.727	69%	0.693	S	S	*	*			trans	-69	88.1	172.7	-68.2	-37.6	0	0	0	109	H72 I76	H72-D74 PolarHBondContact O-N 3.32Å; D74-I76 PolarHBondContact O-N 3.38Å
75	Y	79.4	Confident	77.2	Confident	196 Å²	196	139.9 Å²	139.9	77%	0.769	70%	0.699	S	S	*	*			trans	-71.4	96.4	172.9	-75.6	-83.3	0	0	0	109.4	T73 Y77	T73-Y75 VanDerWaalsContact C-N 3.27Å; T73-Y75 VanDerWaalsContact O-CD2 3.29Å; T73-Y75 WeakPolarHBondContact O-CD2 3.29Å; T73-Y75 PolarHBondContact O-N 2.85Å; T73-Y75 VanDerWaalsContact OG1-CE2 3.26Å; T73-Y75 WeakPolarHBondContact OG1-CE2 3.26Å; Y75-Y77 PolarHBondContact O-N 3.03Å
76	I	81.7	Confident	76.9	Confident	143 Å²	143	145 Å²	145	73%	0.733	72%	0.716	S	S	*	*			trans	-84.7	109.7	175	-58.1	174.6	0	0	0	109	D74 T78	D74-I76 PolarHBondContact O-N 3.38Å; I76-T78 PolarHBondContact O-N 3.45Å
77	Y	83.2	Confident	76.8	Confident	214 Å²	214	147.1 Å²	147.1	84%	0.839	73%	0.734	S	S	*	*			trans	-77.4	111.2	172.9	-111.9	-88.3	0	0	0	110.5	Y75 Q79	Y75-Y77 PolarHBondContact O-N 3.03Å; Y77-Q79 PolarHBondContact O-N 3.42Å
78	T	84.7	Confident	76.9	Confident	121 Å²	121	147.1 Å²	147.1	74%	0.742	75%	0.745	S	S	*	*			trans	-92.7	84.4	169	60.2	0	0	0	0	109.1	I76 Q80	I76-T78 PolarHBondContact O-N 3.45Å; T78-Q80 PolarHBondContact O-N 3.25Å
79	Q	84	Confident	76.8	Confident	173 Å²	173	150.3 Å²	150.3	81%	0.808	75%	0.754	S	S	*	*			trans	-71.3	113.9	167.5	-97.8	-152.7	92.5	0	0	109.2	Y77 H81	Y77-Q79 PolarHBondContact O-N 3.42Å; Q79-H81 PolarHBondContact O-N 3.46Å
80	Q	77.5	Confident	77	Confident	154 Å²	154	150.4 Å²	150.4	72%	0.72	75%	0.753	S	S	*	*			trans	-75.3	115.1	165	-75.7	-92.9	45	0	0	108.1	T78 H82	T78-Q80 PolarHBondContact O-N 3.25Å; Q80-H82 PolarHBondContact O-N 3.36Å
81	H	77	Confident	77.5	Confident	164 Å²	164	154.8 Å²	154.8	76%	0.759	77%	0.766	S	S	*	*			trans	-83.5	103.3	173.4	-156.7	-95.6	0	0	0	108.3	Q79	Q79-H81 PolarHBondContact O-N 3.46Å
82	H	74.1	Confident	78	Confident	166 Å²	166	161.7 Å²	161.7	77%	0.769	78%	0.78	S	S	*	*			trans	-82.5	112.4	169	-59.7	145.4	0	0	0	108.3	Q80	Q80-H82 PolarHBondContact O-N 3.36Å
83	N	65.8	Low	78.3	Confident	218 Å²	218	162.4 Å²	162.4	100%	1.166	79%	0.787	S	S	*	*			trans	-109.9	0	165.8	-164.1	45.3	0	0	0	108.3

Retrieved 83 of 83 residues in 276.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).