Q9AS11_ORYSJ Loading...

Os01g0327500 protein

AlphaFold DB , UniProt , Accession Q9AS11, Species ORYSJ (Oryza sativa subsp. japonica, Rice), Gene n/a, Length 113 aa.

						>Q9AS11_ORYSJ|Q9AS11
MAGSSSVGAVHRAGLAVGLLLLAAGAAACHGARAVPGEPEPATYRPQNVYGFGGFYPGPNINWVFPGPNGVTPQVGFGGMPGSSSSVFPGAGGASPLTPGGGVIGIHGATKKP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44	Very low	61.3	Low	249 Å²	249	99.9 Å²	99.9	100%	1.227	65%	0.652	S	S	*	*				0	95.1	0	-66.7	172.4	-163.3	0	0	107.5
2	A	51.5	Low	62.6	Low	99 Å²	99	108.5 Å²	108.5	82%	0.818	66%	0.661	S	S	*	*			trans	-128.7	26.8	-163.7	0	0	0	0	0	113.4
3	G	53.1	Low	63.9	Low	56 Å²	56	104.4 Å²	104.4	58%	0.577	65%	0.645	S	S	*	*	S	Bend	trans	-106.8	-6.5	-170.3	0	0	0	0	0	116.3
4	S	56.6	Low	65.3	Low	106 Å²	106	100.1 Å²	100.1	74%	0.741	63%	0.632	S	S	*	*	S	Bend	trans	-100.2	-13.8	-168.1	-32.2	0	0	0	0	114.3
5	S	61.4	Low	66.7	Low	95 Å²	95	101.3 Å²	101.3	66%	0.664	63%	0.631	S	S	*	*	H	α-helix	trans	-78.3	-30.3	-172.4	47.2	0	0	0	0	113.6	A9	S5-A9 PolarHBondContact O-N 3.02Å
6	S	61.9	Low	68	Low	75 Å²	75	98.5 Å²	98.5	52%	0.524	62%	0.621	S	S	.	*	H	α-helix	trans	-72.7	-41.1	-177.9	55.5	0	0	0	0	112.5	G8 A9 V10	S6-G8 PolarHBondContact O-N 2.9Å; S6-A9 PolarHBondContact O-N 2.79Å; S6-V10 VanDerWaalsContact O-CG2 3.31Å; S6-V10 WeakPolarHBondContact O-CG2 3.45Å; S6-V10 PolarHBondContact O-N 3.35Å
7	V	61.6	Low	69.2	Low	84 Å²	84	97.5 Å²	97.5	51%	0.509	61%	0.614	S	S	.	*	H	α-helix	trans	-64.2	-43.2	-179.5	179.9	0	0	0	0	110.8	A9 V10 H11	V7-A9 VanDerWaalsContact C-N 3.33Å; V7-A9 PolarHBondContact O-N 2.99Å; V7-V10 PolarHBondContact O-N 3.31Å; V7-H11 PolarHBondContact O-CD2 2.92Å; V7-H11 VanDerWaalsContact O-CD2 3.27Å; V7-H11 PolarHBondContact O-N 3.03Å
8	G	66.7	Low	70.4	Confident	34 Å²	34	94.2 Å²	94.2	35%	0.351	60%	0.601	S	S	.	*	H	α-helix	trans	-62.7	-37.9	175.5	0	0	0	0	0	113.1	S6 R12	S6-G8 PolarHBondContact O-N 2.9Å; G8-R12 WeakPolarHBondContact O-CB 3.43Å; G8-R12 VanDerWaalsContact O-CG 3.23Å; G8-R12 WeakPolarHBondContact O-CG 3.28Å; G8-R12 PolarHBondContact O-N 3.23Å
9	A	69	Low	71.4	Confident	59 Å²	59	94.7 Å²	94.7	49%	0.488	60%	0.598	S	S	.	*	H	α-helix	trans	-67.1	-42.9	176.9	0	0	0	0	0	112.1	S5 S6 V7 R12 A13	S5-A9 PolarHBondContact O-N 3.02Å; S6-A9 PolarHBondContact O-N 2.79Å; V7-A9 VanDerWaalsContact C-N 3.33Å; V7-A9 PolarHBondContact O-N 2.99Å; A9-R12 PolarHBondContact O-N 2.75Å; A9-A13 WeakPolarHBondContact O-CB 2.83Å; A9-A13 PolarHBondContact O-N 3.18Å
10	V	74.1	Confident	72.3	Confident	103 Å²	103	96.4 Å²	96.4	62%	0.624	60%	0.602	S	S	*	*	H	α-helix	trans	-66.3	-43	178.7	177	0	0	0	0	111.2	S6 V7 R12 A13 G14	S6-V10 VanDerWaalsContact O-CG2 3.31Å; S6-V10 WeakPolarHBondContact O-CG2 3.45Å; S6-V10 PolarHBondContact O-N 3.35Å; V7-V10 PolarHBondContact O-N 3.31Å; V10-R12 PolarHBondContact O-N 2.84Å; V10-A13 PolarHBondContact O-N 3.19Å; V10-G14 PolarHBondContact O-N 3.16Å
11	H	74.6	Confident	73.1	Confident	139 Å²	139	97.6 Å²	97.6	64%	0.644	60%	0.603	S	S	*	*	H	α-helix	trans	-63.7	-41.3	175.8	-84.9	-72.4	0	0	0	112.5	V7 G14 L15	V7-H11 PolarHBondContact O-CD2 2.92Å; V7-H11 VanDerWaalsContact O-CD2 3.27Å; V7-H11 PolarHBondContact O-N 3.03Å; H11-G14 PolarHBondContact O-N 3.2Å; H11-L15 WeakPolarHBondContact O-CB 3.06Å; H11-L15 PolarHBondContact O-N 2.66Å
12	R	77.1	Confident	75.2	Confident	203 Å²	203	91.8 Å²	91.8	77%	0.766	58%	0.577	S	S	*	*	H	α-helix	trans	-63.8	-42.9	175.5	-75.5	176.8	179.3	-167.2	0.4	111.6	G8 A9 V10 L15 A16	G8-R12 WeakPolarHBondContact O-CB 3.43Å; G8-R12 VanDerWaalsContact O-CG 3.23Å; G8-R12 WeakPolarHBondContact O-CG 3.28Å; G8-R12 PolarHBondContact O-N 3.23Å; A9-R12 PolarHBondContact O-N 2.75Å; V10-R12 PolarHBondContact O-N 2.84Å; R12-L15 PolarHBondContact O-N 3.17Å; R12-A16 WeakPolarHBondContact O-CB 3.16Å; R12-A16 PolarHBondContact O-N 2.95Å
13	A	79.2	Confident	76.7	Confident	55 Å²	55	90 Å²	90	46%	0.455	56%	0.561	S	S	.	*	H	α-helix	trans	-62.4	-45.7	175.7	0	0	0	0	0	111.4	A9 V10 L15 A16 V17	A9-A13 WeakPolarHBondContact O-CB 2.83Å; A9-A13 PolarHBondContact O-N 3.18Å; V10-A13 PolarHBondContact O-N 3.19Å; A13-L15 PolarHBondContact O-N 3.37Å; A13-A16 PolarHBondContact O-N 3.29Å; A13-V17 VanDerWaalsContact O-CG2 3.3Å; A13-V17 WeakPolarHBondContact O-CG2 3.09Å; A13-V17 PolarHBondContact O-N 2.85Å
14	G	83	Confident	77.9	Confident	45 Å²	45	90.1 Å²	90.1	46%	0.464	56%	0.557	S	S	.	*	H	α-helix	trans	-61.8	-42.4	177.5	0	0	0	0	0	113	V10 H11 V17 G18	V10-G14 PolarHBondContact O-N 3.16Å; H11-G14 PolarHBondContact O-N 3.2Å; G14-V17 PolarHBondContact O-N 2.88Å; G14-G18 PolarHBondContact O-N 2.74Å
15	L	87.3	Confident	79	Confident	117 Å²	117	86.8 Å²	86.8	61%	0.613	54%	0.539	S	S	*	.	H	α-helix	trans	-66.8	-40.3	176.9	-171.5	137.9	0	0	0	111.8	H11 R12 A13 G18 L19	H11-L15 WeakPolarHBondContact O-CB 3.06Å; H11-L15 PolarHBondContact O-N 2.66Å; R12-L15 PolarHBondContact O-N 3.17Å; A13-L15 PolarHBondContact O-N 3.37Å; L15-G18 PolarHBondContact O-N 3.26Å; L15-L19 HydrophobicContact CD2-CD1 3.64Å; L15-L19 HydrophobicContact CD2-CG 4.38Å; L15-L19 HydrophobicContact CG-CD1 4.49Å; L15-L19 WeakPolarHBondContact O-CB 3.06Å; L15-L19 WeakPolarHBondContact O-CG 2.83Å; L15-L19 PolarHBondContact O-N 3.44Å
16	A	87.5	Confident	79.7	Confident	57 Å²	57	84.4 Å²	84.4	47%	0.471	53%	0.526	S	S	.	.	H	α-helix	trans	-62.6	-44	174.7	0	0	0	0	0	112	R12 A13 L19 L20	R12-A16 WeakPolarHBondContact O-CB 3.16Å; R12-A16 PolarHBondContact O-N 2.95Å; A13-A16 PolarHBondContact O-N 3.29Å; A16-L19 PolarHBondContact O-N 3.35Å; A16-L20 WeakPolarHBondContact O-CB 3.49Å; A16-L20 PolarHBondContact O-N 2.7Å
17	V	88.1	Confident	80.1	Confident	82 Å²	82	84 Å²	84	50%	0.497	53%	0.527	S	S	.	.	H	α-helix	trans	-64.4	-43.1	176.1	172.9	0	0	0	0	111.1	A13 G14 L19 L20 L21	A13-V17 VanDerWaalsContact O-CG2 3.3Å; A13-V17 WeakPolarHBondContact O-CG2 3.09Å; A13-V17 PolarHBondContact O-N 2.85Å; G14-V17 PolarHBondContact O-N 2.88Å; V17-L19 PolarHBondContact O-N 3.18Å; V17-L20 WeakPolarHBondContact O-CB 2.8Å; V17-L20 PolarHBondContact O-N 3.34Å; V17-L21 HydrophobicContact CG1-CD1 4.09Å; V17-L21 HydrophobicContact CG1-CG 4.49Å; V17-L21 WeakPolarHBondContact O-CG 3.42Å; V17-L21 PolarHBondContact O-N 2.71Å
18	G	90.3	Very high	80.2	Confident	37 Å²	37	83.3 Å²	83.3	38%	0.381	53%	0.53	S	S	.	.	H	α-helix	trans	-61.2	-44.1	177.1	0	0	0	0	0	113	G14 L15 L21 L22	G14-G18 PolarHBondContact O-N 2.74Å; L15-G18 PolarHBondContact O-N 3.26Å; G18-L21 PolarHBondContact O-N 2.99Å; G18-L22 WeakPolarHBondContact O-CB 3.36Å; G18-L22 PolarHBondContact O-N 2.92Å
19	L	90	Very high	79.9	Confident	104 Å²	104	86.4 Å²	86.4	55%	0.545	55%	0.545	S	S	.	.	H	α-helix	trans	-64.3	-39.4	174.9	-73.9	173.1	0	0	0	112.2	L15 A16 V17 L22 A23	L15-L19 HydrophobicContact CD2-CD1 3.64Å; L15-L19 HydrophobicContact CD2-CG 4.38Å; L15-L19 HydrophobicContact CG-CD1 4.49Å; L15-L19 WeakPolarHBondContact O-CB 3.06Å; L15-L19 WeakPolarHBondContact O-CG 2.83Å; L15-L19 PolarHBondContact O-N 3.44Å; A16-L19 PolarHBondContact O-N 3.35Å; V17-L19 PolarHBondContact O-N 3.18Å; L19-L22 PolarHBondContact O-N 2.81Å; L19-A23 WeakPolarHBondContact O-CB 3.05Å; L19-A23 PolarHBondContact O-N 2.75Å
20	L	89.5	Confident	79.4	Confident	129 Å²	129	90.2 Å²	90.2	68%	0.675	55%	0.552	S	S	*	*	H	α-helix	trans	-62.9	-44.7	177.2	-169.2	76.3	0	0	0	111.5	A16 V17 A23 A24	A16-L20 WeakPolarHBondContact O-CB 3.49Å; A16-L20 PolarHBondContact O-N 2.7Å; V17-L20 WeakPolarHBondContact O-CB 2.8Å; V17-L20 PolarHBondContact O-N 3.34Å; L20-A23 PolarHBondContact O-N 3.35Å; L20-A24 WeakPolarHBondContact O-CB 3.47Å; L20-A24 PolarHBondContact O-N 3.26Å
21	L	88.7	Confident	78.4	Confident	121 Å²	121	87.7 Å²	87.7	63%	0.634	55%	0.548	S	S	*	.	H	α-helix	trans	-64	-41.1	177.1	-71.4	171.2	0	0	0	111.9	V17 G18 A24 G25	V17-L21 HydrophobicContact CG1-CD1 4.09Å; V17-L21 HydrophobicContact CG1-CG 4.49Å; V17-L21 WeakPolarHBondContact O-CG 3.42Å; V17-L21 PolarHBondContact O-N 2.71Å; G18-L21 PolarHBondContact O-N 2.99Å; L21-A24 PolarHBondContact O-N 2.92Å; L21-G25 PolarHBondContact O-N 2.56Å
22	L	87.4	Confident	77.3	Confident	128 Å²	128	85.1 Å²	85.1	67%	0.67	55%	0.55	S	S	*	*	H	α-helix	trans	-64.5	-43.4	177	-174.8	65.9	0	0	0	111.7	G18 L19 G25 A26	G18-L22 WeakPolarHBondContact O-CB 3.36Å; G18-L22 PolarHBondContact O-N 2.92Å; L19-L22 PolarHBondContact O-N 2.81Å; L22-G25 PolarHBondContact O-N 3.43Å; L22-A26 WeakPolarHBondContact O-CB 3.44Å; L22-A26 PolarHBondContact O-N 3.05Å
23	A	83.5	Confident	76	Confident	60 Å²	60	86.5 Å²	86.5	50%	0.496	56%	0.556	S	S	.	*	H	α-helix	trans	-63.9	-41.2	176.7	0	0	0	0	0	111.9	L19 L20 A26 A27	L19-A23 WeakPolarHBondContact O-CB 3.05Å; L19-A23 PolarHBondContact O-N 2.75Å; L20-A23 PolarHBondContact O-N 3.35Å; A23-A26 PolarHBondContact O-N 2.85Å; A23-A27 WeakPolarHBondContact O-CB 3.22Å; A23-A27 PolarHBondContact O-N 2.72Å
24	A	79.4	Confident	74.4	Confident	60 Å²	60	87.2 Å²	87.2	50%	0.496	56%	0.562	S	S	.	*	H	α-helix	trans	-63.7	-43.3	175.8	0	0	0	0	0	112	L20 L21 A27 A28	L20-A24 WeakPolarHBondContact O-CB 3.47Å; L20-A24 PolarHBondContact O-N 3.26Å; L21-A24 PolarHBondContact O-N 2.92Å; A24-A27 PolarHBondContact O-N 3.39Å; A24-A28 PolarHBondContact O-N 3.44Å
25	G	78.8	Confident	72.8	Confident	35 Å²	35	90.5 Å²	90.5	36%	0.361	57%	0.572	S	S	.	*	H	α-helix	trans	-64.2	-43	175.9	0	0	0	0	0	112.6	L21 L22 A27 A28 C29	L21-G25 PolarHBondContact O-N 2.56Å; L22-G25 PolarHBondContact O-N 3.43Å; G25-A27 PolarHBondContact O-N 3.46Å; G25-A28 PolarHBondContact O-N 2.63Å; G25-C29 PolarHBondContact O-N 3.3Å; G25-C29 PolarHBondContact O-SG 3.44Å; G25-C29 VanDerWaalsContact O-SG 3.35Å
26	A	76	Confident	71	Confident	46 Å²	46	90.2 Å²	90.2	38%	0.38	58%	0.577	S	S	.	*	H	α-helix	trans	-61.2	-44.5	174.6	0	0	0	0	0	111.3	L22 A23 A28 C29 H30	L22-A26 WeakPolarHBondContact O-CB 3.44Å; L22-A26 PolarHBondContact O-N 3.05Å; A23-A26 PolarHBondContact O-N 2.85Å; A26-A28 VanDerWaalsContact C-N 3.34Å; A26-A28 PolarHBondContact O-N 3.5Å; A26-C29 PolarHBondContact O-N 3.03Å; A26-H30 PolarHBondContact O-N 3.41Å; A26-H30 PolarHBondContact O-ND1 3.43Å
27	A	70.2	Confident	69	Low	66 Å²	66	91.1 Å²	91.1	55%	0.545	59%	0.592	S	S	.	*	H	α-helix	trans	-62.2	-39.4	176.9	0	0	0	0	0	112.5	A23 A24 G25 H30 G31	A23-A27 WeakPolarHBondContact O-CB 3.22Å; A23-A27 PolarHBondContact O-N 2.72Å; A24-A27 PolarHBondContact O-N 3.39Å; G25-A27 PolarHBondContact O-N 3.46Å; A27-H30 PolarHBondContact O-N 2.96Å; A27-G31 PolarHBondContact O-N 3.03Å
28	A	64.1	Low	67.1	Low	69 Å²	69	94.2 Å²	94.2	57%	0.57	60%	0.601	S	S	*	*	H	α-helix	trans	-64.9	-40.4	176.4	0	0	0	0	0	112.5	A24 G25 A26 G31 A32	A24-A28 PolarHBondContact O-N 3.44Å; G25-A28 PolarHBondContact O-N 2.63Å; A26-A28 VanDerWaalsContact C-N 3.34Å; A26-A28 PolarHBondContact O-N 3.5Å; A28-G31 PolarHBondContact O-N 3.4Å; A28-A32 PolarHBondContact O-N 2.93Å
29	C	60.1	Low	65.3	Low	99 Å²	99	97.8 Å²	97.8	67%	0.669	62%	0.618	S	S	*	*	H	α-helix	trans	-70.9	-30.2	177.6	-67.5	0	0	0	0	113.2	G25 A26	G25-C29 PolarHBondContact O-N 3.3Å; G25-C29 PolarHBondContact O-SG 3.44Å; G25-C29 VanDerWaalsContact O-SG 3.35Å; A26-C29 PolarHBondContact O-N 3.03Å
30	H	58.6	Low	63.4	Low	139 Å²	139	99.6 Å²	99.6	64%	0.644	62%	0.623	S	S	*	*	H	α-helix	trans	-83.8	-29	175.6	-68.8	85.8	0	0	0	112.5	A26 A27 A32 R33 A34	A26-H30 PolarHBondContact O-N 3.41Å; A26-H30 PolarHBondContact O-ND1 3.43Å; A27-H30 PolarHBondContact O-N 2.96Å; H30-A32 VanDerWaalsContact C-N 3.32Å; H30-A32 PolarHBondContact O-N 3.3Å; H30-R33 PolarHBondContact O-N 3.49Å; H30-A34 PolarHBondContact O-N 2.98Å
31	G	53.6	Low	61.7	Low	51 Å²	51	98 Å²	98	53%	0.526	62%	0.621	S	S	.	*	H	α-helix	trans	-67.9	-26.8	177.3	0	0	0	0	0	114	A27 A28 R33	A27-G31 PolarHBondContact O-N 3.03Å; A28-G31 PolarHBondContact O-N 3.4Å; G31-R33 VanDerWaalsContact C-N 3.26Å; G31-R33 PolarHBondContact O-N 3.39Å
32	A	50	Low	60	Low	85 Å²	85	96.8 Å²	96.8	70%	0.702	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.3	-15.8	175.6	0	0	0	0	0	113.8	A28 H30	A28-A32 PolarHBondContact O-N 2.93Å; H30-A32 VanDerWaalsContact C-N 3.32Å; H30-A32 PolarHBondContact O-N 3.3Å
33	R	50.5	Low	58.2	Low	232 Å²	232	94.2 Å²	94.2	88%	0.875	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.3	-8.6	-176.1	-155.6	172.3	-179.4	174.4	0.1	113.7	H30 G31	H30-R33 PolarHBondContact O-N 3.49Å; G31-R33 VanDerWaalsContact C-N 3.26Å; G31-R33 PolarHBondContact O-N 3.39Å
34	A	45.7	Very low	56.5	Low	70 Å²	70	99.9 Å²	99.9	58%	0.579	63%	0.628	S	S	*	*			trans	-102	57.7	175	0	0	0	0	0	110	H30 P36	H30-A34 PolarHBondContact O-N 2.98Å; A34-P36 WeakPolarHBondContact O-CD 3.43Å
35	V	49.3	Very low	55	Low	114 Å²	114	106.5 Å²	106.5	69%	0.691	64%	0.64	S	S	*	*			trans	-65	112.3	151.9	179.3	0	0	0	0	103.6	G37	V35-G37 PolarHBondContact O-N 3.35Å
36	P	49.4	Very low	53.7	Low	110 Å²	110	108.2 Å²	108.2	71%	0.714	64%	0.644	S	S	*	*			trans	-50.7	124.9	172.6	-17.7	30	0	0	0	104.9	A34 E38	A34-P36 WeakPolarHBondContact O-CD 3.43Å; P36-E38 PolarHBondContact O-N 2.85Å
37	G	46	Very low	52.2	Low	76 Å²	76	114.4 Å²	114.4	78%	0.784	67%	0.665	S	S	*	*			trans	-49.4	98.6	-179.9	0	0	0	0	0	107.3	V35	V35-G37 PolarHBondContact O-N 3.35Å
38	E	48.8	Very low	50.9	Low	148 Å²	148	117.4 Å²	117.4	69%	0.692	67%	0.672	S	S	*	*			trans	-52.6	133.2	168.9	-99.7	-132.2	143.1	0	0	103.5	P36 E40	P36-E38 PolarHBondContact O-N 2.85Å; E38-E40 PolarHBondContact O-N 2.93Å
39	P	52.5	Low	49.9	Very low	111 Å²	111	119.9 Å²	119.9	72%	0.721	68%	0.68	S	S	*	*			trans	-47.7	117.8	173.4	21.4	-30.8	0	0	0	105.4	P41	P39-P41 WeakPolarHBondContact O-CA 3.39Å; P39-P41 WeakPolarHBondContact O-CD 3.41Å
40	E	48.4	Very low	49	Very low	142 Å²	142	126.3 Å²	126.3	66%	0.664	69%	0.692	S	S	*	*			trans	-42.8	112.6	-174.3	-169.4	-145.9	177.7	0	0	105.6	E38 A42	E38-E40 PolarHBondContact O-N 2.93Å; E40-A42 WeakPolarHBondContact O-CA 3.43Å; E40-A42 PolarHBondContact O-N 3.39Å
41	P	54	Low	48.2	Very low	96 Å²	96	122 Å²	122	62%	0.623	69%	0.685	S	S	*	*			trans	-56.1	114.4	-169.8	16.1	-28.4	0	0	0	104.9	P39 T43	P39-P41 WeakPolarHBondContact O-CA 3.39Å; P39-P41 WeakPolarHBondContact O-CD 3.41Å; P41-T43 WeakPolarHBondContact O-CA 3.49Å; P41-T43 PolarHBondContact O-N 3.03Å
42	A	53.8	Low	47.7	Very low	95 Å²	95	130 Å²	130	79%	0.785	71%	0.706	S	S	*	*			trans	-32.3	110	-162.4	0	0	0	0	0	108	E40 Y44	E40-A42 WeakPolarHBondContact O-CA 3.43Å; E40-A42 PolarHBondContact O-N 3.39Å; A42-Y44 PolarHBondContact O-N 2.94Å
43	T	50.2	Low	47	Very low	74 Å²	74	130.2 Å²	130.2	45%	0.454	72%	0.716	S	S	.	*			trans	-24.2	109.8	-168.6	-59.8	0	0	0	0	107.3	P41 R45	P41-T43 WeakPolarHBondContact O-CA 3.49Å; P41-T43 PolarHBondContact O-N 3.03Å; T43-R45 HydrophobicContact CG2-CG 3.92Å; T43-R45 WeakPolarHBondContact O-CG 3.39Å; T43-R45 PolarHBondContact O-N 3.47Å
44	Y	47.4	Very low	46.5	Very low	180 Å²	180	122.1 Å²	122.1	71%	0.706	71%	0.705	S	S	*	*			trans	-60.3	87.7	178.2	178.3	-96.6	0	0	0	105.9	A42 P46	A42-Y44 PolarHBondContact O-N 2.94Å; Y44-P46 HydrophobicContact CE1-CB 4.01Å; Y44-P46 WeakPolarHBondContact O-CD 3.3Å
45	R	48.5	Very low	46.5	Very low	198 Å²	198	127.7 Å²	127.7	75%	0.747	72%	0.717	S	S	*	*			trans	-81.5	103	168.4	-68.3	-161.4	-179.4	-134.3	-0.5	99.7	T43 Q47	T43-R45 HydrophobicContact CG2-CG 3.92Å; T43-R45 WeakPolarHBondContact O-CG 3.39Å; T43-R45 PolarHBondContact O-N 3.47Å; R45-Q47 VanDerWaalsContact C-N 3.28Å; R45-Q47 PolarHBondContact O-N 3.5Å
46	P	49.9	Very low	46.4	Very low	71 Å²	71	132.8 Å²	132.8	46%	0.461	73%	0.725	S	S	.	*			trans	-49	111.7	167	21.9	-31.8	0	0	0	104.5	Y44 N48	Y44-P46 HydrophobicContact CE1-CB 4.01Å; Y44-P46 WeakPolarHBondContact O-CD 3.3Å; P46-N48 PolarHBondContact O-N 2.96Å
47	Q	45.6	Very low	46.8	Very low	176 Å²	176	132 Å²	132	82%	0.822	72%	0.72	S	S	*	*			trans	-67.2	81.4	171.7	-72.6	-176.6	-3.4	0	0	102.8	R45 V49	R45-Q47 VanDerWaalsContact C-N 3.28Å; R45-Q47 PolarHBondContact O-N 3.5Å; Q47-V49 PolarHBondContact O-N 2.95Å
48	N	42.8	Very low	47	Very low	129 Å²	129	130.8 Å²	130.8	69%	0.69	71%	0.708	S	S	*	*			trans	-70.1	82.7	166.2	-76.3	3.4	0	0	0	103.4	P46 Y50	P46-N48 PolarHBondContact O-N 2.96Å; N48-Y50 PolarHBondContact O-N 3.43Å
49	V	43.3	Very low	47.3	Very low	121 Å²	121	128.8 Å²	128.8	73%	0.733	71%	0.708	S	S	*	*			trans	-45.4	110.9	159.6	-175.8	0	0	0	0	103.9	Q47 G51	Q47-V49 PolarHBondContact O-N 2.95Å; V49-G51 PolarHBondContact O-N 3.4Å
50	Y	41.4	Very low	47.4	Very low	235 Å²	235	127.9 Å²	127.9	92%	0.922	70%	0.697	S	S	*	*			trans	-65.5	74.8	166.8	-107.6	-93.6	0	0	0	106.5	N48	N48-Y50 PolarHBondContact O-N 3.43Å
51	G	40.2	Very low	47.5	Very low	48 Å²	48	127.1 Å²	127.1	50%	0.495	70%	0.696	S	S	.	*			trans	-108.5	107.5	174.7	0	0	0	0	0	106.4	V49 G53	V49-G51 PolarHBondContact O-N 3.4Å; G51-G53 PolarHBondContact O-N 2.89Å
52	F	43.8	Very low	47.5	Very low	218 Å²	218	127.2 Å²	127.2	96%	0.956	69%	0.691	S	S	*	*	T	Hydrogen-bonded Turn	trans	-36.7	110.7	170.3	-79	-104.3	0	0	0	111.4
53	G	35	Very low	47.3	Very low	90 Å²	90	131.2 Å²	131.2	93%	0.928	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	69.9	45.6	157	0	0	0	0	0	119.3	G51	G51-G53 PolarHBondContact O-N 2.89Å
54	G	40.7	Very low	47.7	Very low	63 Å²	63	131.8 Å²	131.8	65%	0.649	69%	0.689	S	S	*	*			trans	-141	123.6	173.5	0	0	0	0	0	114.6
55	F	45.6	Very low	48.3	Very low	187 Å²	187	129.4 Å²	129.4	82%	0.82	68%	0.683	S	S	*	*			trans	-73.7	121.2	176.9	-162.3	-97.3	0	0	0	110.4	P57	F55-P57 HydrophobicContact CD1-CB 4.45Å; F55-P57 HydrophobicContact CD1-CG 4.13Å; F55-P57 HydrophobicContact CE1-CB 3.89Å; F55-P57 HydrophobicContact CE1-CG 3.91Å
56	Y	46.3	Very low	48.7	Very low	221 Å²	221	125.3 Å²	125.3	87%	0.867	68%	0.682	S	S	*	*			trans	-120.4	105.4	159.1	-88.5	-85.7	0	0	0	107.9	G58	Y56-G58 PolarHBondContact O-N 2.97Å
57	P	59.4	Low	49.2	Very low	92 Å²	92	123 Å²	123	60%	0.597	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-66.1	120.4	169.9	25.4	-22	0	0	0	106.6	F55	F55-P57 HydrophobicContact CD1-CB 4.45Å; F55-P57 HydrophobicContact CD1-CG 4.13Å; F55-P57 HydrophobicContact CE1-CB 3.89Å; F55-P57 HydrophobicContact CE1-CG 3.91Å
58	G	48.8	Very low	49.6	Very low	51 Å²	51	121.1 Å²	121.1	53%	0.526	67%	0.674	S	S	.	*	P	Polyproline II helix	trans	-55	161.4	177.6	0	0	0	0	0	111.9	Y56 N60	Y56-G58 PolarHBondContact O-N 2.97Å; G58-N60 PolarHBondContact O-N 3.26Å
59	P	55.3	Low	50.1	Low	107 Å²	107	122.3 Å²	122.3	70%	0.695	68%	0.68	S	S	*	*	P	Polyproline II helix	trans	-53.8	132.2	-178	21	-31	0	0	0	110.9	I61	P59-I61 PolarHBondContact O-N 2.98Å
60	N	55.3	Low	50.6	Low	92 Å²	92	119.4 Å²	119.4	49%	0.492	67%	0.674	S	S	.	*			trans	-70.5	103.3	-177.1	-136.4	-78.4	0	0	0	109.9	G58 N62 F77	G58-N60 PolarHBondContact O-N 3.26Å; N60-N62 PolarHBondContact O-N 3.41Å; N60-F77 WeakPolarHBondContact ND2-CE2 3.5Å; N60-F77 WeakPolarHBondContact ND2-CZ 3.37Å; N60-F77 WeakPolarHBondContact OD1-CE2 3.38Å; N60-F77 WeakPolarHBondContact OD1-CZ 3.31Å
61	I	50.3	Low	51.1	Low	126 Å²	126	113.1 Å²	113.1	65%	0.646	66%	0.66	S	S	*	*			trans	-86.9	100.6	176.1	-57.3	172.4	0	0	0	108.4	P59	P59-I61 PolarHBondContact O-N 2.98Å
62	N	54.2	Low	51.8	Low	97 Å²	97	114.7 Å²	114.7	52%	0.519	66%	0.66	S	S	.	*			trans	-86.6	115.8	173.4	-74.6	-37.9	0	0	0	110.3	N60 V64	N60-N62 PolarHBondContact O-N 3.41Å; N62-V64 PolarHBondContact O-N 3.39Å
63	W	48.7	Very low	52.2	Low	180 Å²	180	107.3 Å²	107.3	68%	0.682	63%	0.634	S	S	*	*			trans	-87.2	95	172.4	-69.8	93.4	0	0	0	110.3	F65 V75	W63-F65 HydrophobicContact CB-CE2 3.9Å; W63-F65 HydrophobicContact CB-CZ 4.44Å; W63-F65 PolarHBondContact O-N 3.27Å; W63-V75 WeakPolarHBondContact O-CG2 3.38Å
64	V	59	Low	53.2	Low	85 Å²	85	112.2 Å²	112.2	52%	0.515	63%	0.633	S	S	.	*			trans	-85.9	109.1	178.8	-179.4	0	0	0	0	109.6	N62 T72	N62-V64 PolarHBondContact O-N 3.39Å; V64-T72 HydrophobicContact CG1-CG2 3.16Å
65	F	60.5	Low	53.7	Low	131 Å²	131	112 Å²	112	58%	0.575	62%	0.619	S	S	*	*	P	Polyproline II helix	trans	-93.1	127	172.9	-68.2	-79.6	0	0	0	110.3	W63 G67 P73	W63-F65 HydrophobicContact CB-CE2 3.9Å; W63-F65 HydrophobicContact CB-CZ 4.44Å; W63-F65 PolarHBondContact O-N 3.27Å; F65-G67 PolarHBondContact O-N 3.4Å; F65-G67 VanDerWaalsContact O-N 3.17Å; F65-P73 HydrophobicContact CB-CG 4.5Å; F65-P73 WeakPolarHBondContact O-CD 3.4Å
66	P	57.3	Low	53.8	Low	112 Å²	112	105.1 Å²	105.1	73%	0.727	60%	0.601	S	S	*	*	P	Polyproline II helix	trans	-63.6	119.5	172	-17.6	30.2	0	0	0	109.8
67	G	58.9	Low	54.1	Low	21 Å²	21	102.9 Å²	102.9	22%	0.216	60%	0.596	C	S	.	*	P	Polyproline II helix	trans	-72	169.2	172.9	0	0	0	0	0	112.1	F65 N69 G70 V71	F65-G67 PolarHBondContact O-N 3.4Å; F65-G67 VanDerWaalsContact O-N 3.17Å; G67-N69 PolarHBondContact O-N 2.85Å; G67-G70 PolarHBondContact O-N 2.9Å; G67-V71 WeakPolarHBondContact CA-O 3.5Å; G67-V71 PolarHBondContact N-O 2.93Å
68	P	55.4	Low	53.4	Low	138 Å²	138	101.8 Å²	101.8	90%	0.896	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.1	-13.9	-174	-25.6	34	0	0	0	116.3
69	N	51.9	Low	52.9	Low	153 Å²	153	102.5 Å²	102.5	82%	0.818	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-126.8	22.4	179.6	-63.6	-41	0	0	0	112.8	G67 V71	G67-N69 PolarHBondContact O-N 2.85Å; N69-V71 PolarHBondContact O-N 3.33Å
70	G	54.8	Low	52	Low	60 Å²	60	104.4 Å²	104.4	62%	0.619	61%	0.61	S	S	*	*	S	Bend	trans	75.9	4	-175.5	0	0	0	0	0	114.7	G67 T72	G67-G70 PolarHBondContact O-N 2.9Å; G70-T72 PolarHBondContact O-N 3Å
71	V	50.8	Low	51.4	Low	103 Å²	103	106.2 Å²	106.2	62%	0.624	63%	0.627	S	S	*	*			trans	-76.9	112.8	171.5	-178.4	0	0	0	0	108.2	G67 N69	G67-V71 WeakPolarHBondContact CA-O 3.5Å; G67-V71 PolarHBondContact N-O 2.93Å; N69-V71 PolarHBondContact O-N 3.33Å
72	T	55.4	Low	51.2	Low	81 Å²	81	103.7 Å²	103.7	50%	0.497	63%	0.632	S	S	.	*			trans	-71.6	120.5	169.6	48.1	0	0	0	0	108.2	V64 G70 Q74	V64-T72 HydrophobicContact CG1-CG2 3.16Å; G70-T72 PolarHBondContact O-N 3Å; T72-Q74 PolarHBondContact O-N 3.49Å
73	P	52.6	Low	50.5	Low	64 Å²	64	102.3 Å²	102.3	42%	0.416	63%	0.631	S	S	.	*			trans	-63.5	127.8	172.3	26.5	-24.8	0	0	0	106.5	F65 V75	F65-P73 HydrophobicContact CB-CG 4.5Å; F65-P73 WeakPolarHBondContact O-CD 3.4Å; P73-V75 PolarHBondContact O-N 3.31Å
74	Q	55.6	Low	49.9	Very low	192 Å²	192	99.5 Å²	99.5	90%	0.897	64%	0.638	S	S	*	*			trans	-61.1	88.5	170.2	-177.1	-179.3	-8.3	0	0	107.9	T72 G76	T72-Q74 PolarHBondContact O-N 3.49Å; Q74-G76 PolarHBondContact O-N 2.93Å
75	V	52.3	Low	49	Very low	58 Å²	58	100.1 Å²	100.1	35%	0.352	65%	0.646	S	S	.	*			trans	-74.9	71.4	164.6	-78.2	0	0	0	0	107.5	W63 P73	W63-V75 WeakPolarHBondContact O-CG2 3.38Å; P73-V75 PolarHBondContact O-N 3.31Å
76	G	47.9	Very low	47.9	Very low	44 Å²	44	98.7 Å²	98.7	45%	0.454	65%	0.653	S	S	.	*			trans	-63.1	167	152.7	0	0	0	0	0	108.7	Q74 G78	Q74-G76 PolarHBondContact O-N 2.93Å; G76-G78 PolarHBondContact O-N 2.96Å
77	F	52.1	Low	47.2	Very low	173 Å²	173	98.6 Å²	98.6	76%	0.759	65%	0.65	S	S	*	*	S	Bend	trans	-62.1	40.3	171.4	-71.3	-83.2	0	0	0	114.4	N60	N60-F77 WeakPolarHBondContact ND2-CE2 3.5Å; N60-F77 WeakPolarHBondContact ND2-CZ 3.37Å; N60-F77 WeakPolarHBondContact OD1-CE2 3.38Å; N60-F77 WeakPolarHBondContact OD1-CZ 3.31Å
78	G	44.4	Very low	46.2	Very low	70 Å²	70	103.2 Å²	103.2	72%	0.722	66%	0.664	S	S	*	*			trans	-99.1	95.3	179.3	0	0	0	0	0	109.8	G76	G76-G78 PolarHBondContact O-N 2.96Å
79	G	39.1	Very low	45.4	Very low	65 Å²	65	103.7 Å²	103.7	67%	0.67	67%	0.667	S	S	*	*			trans	68.2	86.7	146.7	0	0	0	0	0	115.9	P81	G79-P81 VanDerWaalsContact O-CD 3.28Å; G79-P81 WeakPolarHBondContact O-CD 3.37Å
80	M	34.5	Very low	44.6	Very low	147 Å²	147	99.6 Å²	99.6	72%	0.724	66%	0.661	S	S	*	*			trans	-54.1	119	156.3	-157.3	162.2	89.8	0	0	108.3	G82 S83	M80-G82 PolarHBondContact O-N 3.47Å; M80-G82 VanDerWaalsContact O-N 3.16Å; M80-S83 PolarHBondContact O-N 3.46Å
81	P	43	Very low	44	Very low	130 Å²	130	99.3 Å²	99.3	84%	0.844	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.2	119.4	177.1	-19	31.1	0	0	0	108.7	G79	G79-P81 VanDerWaalsContact O-CD 3.28Å; G79-P81 WeakPolarHBondContact O-CD 3.37Å
82	G	47	Very low	43.2	Very low	73 Å²	73	98 Å²	98	75%	0.753	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	111.4	-5.1	-176.8	0	0	0	0	0	115.2	M80 S84	M80-G82 PolarHBondContact O-N 3.47Å; M80-G82 VanDerWaalsContact O-N 3.16Å; G82-S84 PolarHBondContact O-N 3.01Å
83	S	39.7	Very low	42.3	Very low	69 Å²	69	96.8 Å²	96.8	48%	0.483	66%	0.664	S	S	.	*			trans	-84.4	87.9	168	-65.8	0	0	0	0	110.1	M80 S85	M80-S83 PolarHBondContact O-N 3.46Å; S83-S85 PolarHBondContact O-N 3.47Å
84	S	35.8	Very low	41.6	Very low	121 Å²	121	98.5 Å²	98.5	85%	0.846	68%	0.683	S	S	*	*			trans	-67.6	63.9	173	-46.1	0	0	0	0	111.9	G82	G82-S84 PolarHBondContact O-N 3.01Å
85	S	39.1	Very low	41	Very low	98 Å²	98	92.6 Å²	92.6	69%	0.685	66%	0.663	S	S	*	*			trans	-176.9	66.5	173.3	44.2	0	0	0	0	110.9	S83	S83-S85 PolarHBondContact O-N 3.47Å
86	S	38.9	Very low	40.7	Very low	101 Å²	101	95.9 Å²	95.9	71%	0.706	69%	0.686	S	S	*	*				165.4	120.7	127.8	49.3	0	0	0	0	109.3
87	V	43	Very low	41	Very low	110 Å²	110	101.4 Å²	101.4	67%	0.667	70%	0.704	S	S	*	*				57.8	81.3	61.5	-179.5	0	0	0	0	106.1
88	F	36.4	Very low	40.7	Very low	118 Å²	118	97.9 Å²	97.9	52%	0.518	70%	0.697	S	S	.	*			cis	-171.5	154.9	19.7	-63.3	-108.7	0	0	0	108.8	G90 A91	F88-G90 PolarHBondContact O-N 3.43Å; F88-A91 HydrophobicContact CB-CB 3.73Å; F88-A91 HydrophobicContact CD2-CB 2.95Å; F88-A91 HydrophobicContact CE2-CB 3.52Å; F88-A91 HydrophobicContact CG-CB 3.59Å
89	P	39.2	Very low	40.4	Very low	147 Å²	147	100.7 Å²	100.7	96%	0.955	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.4	95.5	140	28.9	-17.1	0	0	0	106.8
90	G	35.4	Very low	40.3	Very low	67 Å²	67	101.1 Å²	101.1	69%	0.691	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	117	23.6	179.9	0	0	0	0	0	117.7	F88 G92	F88-G90 PolarHBondContact O-N 3.43Å; G90-G92 WeakPolarHBondContact O-CA 3.23Å; G90-G92 PolarHBondContact O-N 3.35Å
91	A	41.9	Very low	40.3	Very low	55 Å²	55	98.4 Å²	98.4	46%	0.455	72%	0.716	S	S	.	*			trans	-74	109.2	169.4	0	0	0	0	0	107.5	F88	F88-A91 HydrophobicContact CB-CB 3.73Å; F88-A91 HydrophobicContact CD2-CB 2.95Å; F88-A91 HydrophobicContact CE2-CB 3.52Å; F88-A91 HydrophobicContact CG-CB 3.59Å
92	G	34.2	Very low	40	Very low	75 Å²	75	95.8 Å²	95.8	77%	0.773	71%	0.713	S	S	*	*			cis	59.9	35.6	20	0	0	0	0	0	110.9	G90	G90-G92 WeakPolarHBondContact O-CA 3.23Å; G90-G92 PolarHBondContact O-N 3.35Å
93	G	35.7	Very low	39.9	Very low	55 Å²	55	99.7 Å²	99.7	57%	0.567	72%	0.722	S	S	*	*			trans	-166.3	66.8	-176.4	0	0	0	0	0	110.3	S95	G93-S95 PolarHBondContact O-N 3.06Å
94	A	38.7	Very low	40.1	Very low	101 Å²	101	104 Å²	104	84%	0.835	74%	0.738	S	S	*	*			trans	-49.6	105.9	161.2	0	0	0	0	0	107.6	P96	A94-P96 WeakPolarHBondContact O-CD 3.4Å
95	S	42.5	Very low	40.2	Very low	68 Å²	68	101.9 Å²	101.9	48%	0.476	74%	0.735	S	S	.	*			trans	-64	122.7	167.3	-165.9	0	0	0	0	105.6	G93 L97 T98	G93-S95 PolarHBondContact O-N 3.06Å; S95-L97 PolarHBondContact O-N 3.39Å; S95-T98 PolarHBondContact O-N 3.22Å
96	P	46	Very low	40.4	Very low	126 Å²	126	104 Å²	104	82%	0.818	74%	0.737	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.3	7.1	-171.9	26.4	-33.4	0	0	0	113.7	A94	A94-P96 WeakPolarHBondContact O-CD 3.4Å
97	L	54.2	Low	40.6	Very low	160 Å²	160	108.5 Å²	108.5	84%	0.838	75%	0.747	S	S	*	*	T	Hydrogen-bonded Turn	trans	-115.6	4.9	-180	-60.1	173.6	0	0	0	112.8	S95	S95-L97 PolarHBondContact O-N 3.39Å
98	T	46.6	Very low	40.3	Very low	99 Å²	99	107 Å²	107	61%	0.607	75%	0.754	S	S	*	*	S	Bend	trans	-116	113.4	177.5	-46	0	0	0	0	110.4	S95 G100	S95-T98 PolarHBondContact O-N 3.22Å; T98-G100 PolarHBondContact O-N 3.29Å
99	P	38.2	Very low	40.4	Very low	130 Å²	130	106.5 Å²	106.5	84%	0.844	77%	0.771	S	S	*	*			trans	-70.6	99.2	176.3	-7.6	22.9	0	0	0	109.9
100	G	36.2	Very low	40.7	Very low	73 Å²	73	105.5 Å²	105.5	75%	0.753	76%	0.762	S	S	*	*	S	Bend	trans	79.2	121.2	161.4	0	0	0	0	0	117.2	T98	T98-G100 PolarHBondContact O-N 3.29Å
101	G	34.5	Very low	40.9	Very low	90 Å²	90	111.7 Å²	111.7	93%	0.928	77%	0.77	S	S	*	*			trans	127.3	97.2	156.6	0	0	0	0	0	115.5
102	G	36.9	Very low	40.7	Very low	76 Å²	76	118 Å²	118	78%	0.784	79%	0.788	S	S	*	*			trans	-156.9	109.3	169.3	0	0	0	0	0	110.4
103	V	44.4	Very low	41.1	Very low	154 Å²	154	123.4 Å²	123.4	93%	0.933	81%	0.809	S	S	*	*			trans	-84.1	150	-167.9	-89.3	0	0	0	0	114.1
104	I	43.8	Very low	41.4	Very low	161 Å²	161	126.8 Å²	126.8	83%	0.826	82%	0.821	S	S	*	*			trans	-86.7	147.1	-171.9	-64.5	156.1	0	0	0	111.5	I106	I104-I106 HydrophobicContact CG2-CG1 4.38Å
105	G	38.4	Very low	41.6	Very low	75 Å²	75	128.2 Å²	128.2	77%	0.773	82%	0.82	S	S	*	*			trans	-178.7	72.9	171.8	0	0	0	0	0	116.5
106	I	43.2	Very low	41.5	Very low	142 Å²	142	131.5 Å²	131.5	73%	0.728	84%	0.839	S	S	*	*			trans	-54.4	136	173.8	-21.3	172.8	0	0	0	113.2	I104	I104-I106 HydrophobicContact CG2-CG1 4.38Å
107	H	43.3	Very low	41.2	Very low	197 Å²	197	131.8 Å²	131.8	91%	0.912	84%	0.84	S	S	*	*			trans	-158.9	111.6	146.7	-75.9	102.4	0	0	0	112.6
108	G	36.9	Very low	40.4	Very low	79 Å²	79	130.1 Å²	130.1	81%	0.814	84%	0.84	S	S	*	*			trans	76.9	92.7	139.1	0	0	0	0	0	120.2
109	A	39	Very low	40	Very low	106 Å²	106	132.1 Å²	132.1	88%	0.876	86%	0.856	S	S	*	*			trans	-150	91.7	147.3	0	0	0	0	0	111.1
110	T	44	Very low	40.2	Very low	127 Å²	127	132.3 Å²	132.3	78%	0.779	86%	0.857	S	S	*	*			trans	-73.6	145.8	164.7	47.7	0	0	0	0	112.3
111	K	39.9	Very low	40.5	Very low	197 Å²	197	136.8 Å²	136.8	86%	0.857	87%	0.865	S	S	*	*			trans	134.6	107.3	145.4	-77.1	-177.2	178.5	-179.2	0	111.6
112	K	37.2	Very low	41	Very low	188 Å²	188	140.8 Å²	140.8	82%	0.817	86%	0.859	S	S	*	*				86.8	141.6	68.5	-171.4	167.9	-168.9	-171.5	0	111.1
113	P	44.4	Very low	41.3	Very low	187 Å²	187	146.6 Å²	146.6	100%	1.214	87%	0.866	S	S	*	*			cis	-75.8	0	27.9	30.6	-35.8	0	0	0	117.2

Retrieved 113 of 113 residues in 285.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).