RPRM_HUMAN Loading...

Protein reprimo

May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).

AlphaFold DB , UniProt , Accession Q9NS64, Species HUMAN (Homo sapiens, Human), Gene RPRM, Length 109 aa.

						>RPRM_HUMAN|Q9NS64|RPRM
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	33.7	Very low	48.1	Very low	242 Å²	242	136.4 Å²	136.4	100%	1.192	79%	0.79	S	S	*	*				0	125.2	0	-103.6	68.8	155.2	0	0	108.5
2	N	58.5	Low	48.5	Very low	157 Å²	157	130.3 Å²	130.3	84%	0.84	77%	0.767	S	S	*	*			trans	-53.9	168	161.2	-67	-8.3	0	0	0	110.4
3	P	44.4	Very low	48.6	Very low	117 Å²	117	123.2 Å²	123.2	76%	0.76	74%	0.739	S	S	*	*			cis	-136.1	147.5	25.7	27.8	-3	0	0	0	114.6
4	A	40.9	Very low	48.9	Very low	92 Å²	92	123.9 Å²	123.9	76%	0.76	74%	0.736	S	S	*	*				52.5	114.3	88.1	0	0	0	0	0	116.1
5	L	42	Very low	49	Very low	186 Å²	186	125.7 Å²	125.7	97%	0.974	73%	0.731	S	S	*	*			trans	89.2	112.8	138.8	-141.7	90	0	0	0	119.4
6	G	43.9	Very low	49.4	Very low	72 Å²	72	125.1 Å²	125.1	74%	0.742	72%	0.723	S	S	*	*			trans	156.3	123.6	155.4	0	0	0	0	0	109.8
7	N	52.7	Low	49.9	Very low	126 Å²	126	120.7 Å²	120.7	67%	0.674	71%	0.705	S	S	*	*			cis	-168.7	141.3	7.7	-169.8	17.9	0	0	0	105.1	T9	N7-T9 PolarHBondContact O-N 2.75Å; N7-T9 PolarHBondContact O-OG1 3.17Å
8	Q	50.8	Low	50.3	Low	183 Å²	183	119.6 Å²	119.6	86%	0.855	70%	0.696	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.1	39.8	-170.8	-64.5	178.6	21.6	0	0	114.7
9	T	53.8	Low	51	Low	98 Å²	98	116.9 Å²	116.9	60%	0.601	68%	0.684	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.5	-6.3	-179.5	27.7	0	0	0	0	114.2	N7	N7-T9 PolarHBondContact O-N 2.75Å; N7-T9 PolarHBondContact O-OG1 3.17Å
10	D	52.8	Low	51.6	Low	125 Å²	125	114.4 Å²	114.4	67%	0.668	67%	0.674	S	S	*	*	H	α-helix	trans	-84.4	-21.3	-171.5	-59	-35.8	0	0	0	114.2	G13 L14	D10-G13 PolarHBondContact O-N 3Å; D10-L14 WeakPolarHBondContact O-CB 3.21Å; D10-L14 PolarHBondContact O-N 3.2Å
11	V	55.3	Low	52.1	Low	102 Å²	102	113.6 Å²	113.6	62%	0.618	66%	0.663	S	S	*	*	H	α-helix	trans	-71.4	-40.9	-174.7	-66.3	0	0	0	0	112.4	L14 F15	V11-L14 PolarHBondContact O-N 2.85Å; V11-F15 WeakPolarHBondContact O-CD2 3.12Å; V11-F15 PolarHBondContact O-N 3.27Å
12	A	53.3	Low	53.6	Low	63 Å²	63	104.4 Å²	104.4	52%	0.521	63%	0.626	S	S	.	*	H	α-helix	trans	-68.9	-38.7	177	0	0	0	0	0	111.9	F15 L16	A12-F15 PolarHBondContact O-N 2.7Å; A12-L16 WeakPolarHBondContact O-CG 3.22Å; A12-L16 PolarHBondContact O-N 3.03Å
13	G	50.3	Low	53.7	Low	39 Å²	39	102.3 Å²	102.3	40%	0.402	61%	0.614	S	S	.	*	H	α-helix	trans	-63.4	-40.6	176.3	0	0	0	0	0	112.6	D10 A17	D10-G13 PolarHBondContact O-N 3Å; G13-A17 VanDerWaalsContact O-CB 3.22Å; G13-A17 WeakPolarHBondContact O-CB 3.47Å; G13-A17 PolarHBondContact O-N 3.34Å
14	L	51.8	Low	54.4	Low	132 Å²	132	102.8 Å²	102.8	69%	0.691	61%	0.606	S	S	*	*	H	α-helix	trans	-67.9	-40.6	178.1	-159.5	88.7	0	0	0	112.4	D10 V11 A17 N18	D10-L14 WeakPolarHBondContact O-CB 3.21Å; D10-L14 PolarHBondContact O-N 3.2Å; V11-L14 PolarHBondContact O-N 2.85Å; L14-A17 PolarHBondContact O-N 3.38Å; L14-N18 WeakPolarHBondContact O-CB 3.47Å; L14-N18 PolarHBondContact O-N 3.27Å
15	F	51.3	Low	55.5	Low	151 Å²	151	106.1 Å²	106.1	66%	0.662	60%	0.599	S	S	*	*	H	α-helix	trans	-65.2	-43.3	176	-86.2	-73.6	0	0	0	112	V11 A12 N18 S19	V11-F15 WeakPolarHBondContact O-CD2 3.12Å; V11-F15 PolarHBondContact O-N 3.27Å; A12-F15 PolarHBondContact O-N 2.7Å; F15-N18 PolarHBondContact O-N 3.13Å; F15-S19 WeakPolarHBondContact O-CB 3.18Å; F15-S19 PolarHBondContact O-N 3.36Å; F15-S19 PolarHBondContact O-OG 3.32Å
16	L	55.6	Low	56.5	Low	117 Å²	117	99.9 Å²	99.9	61%	0.613	57%	0.574	S	S	*	*	H	α-helix	trans	-65.7	-40.6	174.5	-72.1	171.3	0	0	0	111.6	A12 S19 S20	A12-L16 WeakPolarHBondContact O-CG 3.22Å; A12-L16 PolarHBondContact O-N 3.03Å; L16-S19 PolarHBondContact O-N 2.78Å; L16-S20 WeakPolarHBondContact O-CB 3.43Å; L16-S20 PolarHBondContact O-N 3.23Å; L16-S20 PolarHBondContact O-OG 2.81Å; L16-S20 VanDerWaalsContact O-OG 3.14Å
17	A	56.9	Low	57.2	Low	50 Å²	50	100.1 Å²	100.1	41%	0.413	56%	0.561	S	S	.	*	H	α-helix	trans	-61.6	-46.1	176.4	0	0	0	0	0	111.5	G13 L14 S19 S20 E21	G13-A17 VanDerWaalsContact O-CB 3.22Å; G13-A17 WeakPolarHBondContact O-CB 3.47Å; G13-A17 PolarHBondContact O-N 3.34Å; L14-A17 PolarHBondContact O-N 3.38Å; A17-S19 VanDerWaalsContact C-N 3.3Å; A17-S19 PolarHBondContact O-N 3.3Å; A17-S20 PolarHBondContact O-N 2.79Å; A17-E21 WeakPolarHBondContact O-CG 3.21Å; A17-E21 PolarHBondContact O-N 3.5Å
18	N	58.2	Low	57.5	Low	101 Å²	101	103.8 Å²	103.8	54%	0.54	57%	0.565	S	S	.	*	H	α-helix	trans	-64.5	-36.7	176.6	-165.2	22.5	0	0	0	111.8	L14 F15 A22	L14-N18 WeakPolarHBondContact O-CB 3.47Å; L14-N18 PolarHBondContact O-N 3.27Å; F15-N18 PolarHBondContact O-N 3.13Å; N18-A22 WeakPolarHBondContact O-CB 3.1Å; N18-A22 PolarHBondContact O-N 3.16Å
19	S	62.1	Low	58	Low	68 Å²	68	99.8 Å²	99.8	48%	0.476	56%	0.556	S	S	.	*	H	α-helix	trans	-67.9	-40.6	175.2	-53.3	0	0	0	0	112	F15 L16 A17 A22 L23	F15-S19 WeakPolarHBondContact O-CB 3.18Å; F15-S19 PolarHBondContact O-N 3.36Å; F15-S19 PolarHBondContact O-OG 3.32Å; L16-S19 PolarHBondContact O-N 2.78Å; A17-S19 VanDerWaalsContact C-N 3.3Å; A17-S19 PolarHBondContact O-N 3.3Å; S19-A22 PolarHBondContact O-N 3.49Å; S19-L23 WeakPolarHBondContact O-CA 3.38Å; S19-L23 WeakPolarHBondContact O-CB 3.17Å; S19-L23 PolarHBondContact O-N 3.15Å
20	S	63.4	Low	58.1	Low	67 Å²	67	99 Å²	99	47%	0.469	55%	0.554	S	S	.	*	H	α-helix	trans	-66.2	-45.3	175.5	-70.5	0	0	0	0	110.7	L16 A17 A22 L23 E24	L16-S20 WeakPolarHBondContact O-CB 3.43Å; L16-S20 PolarHBondContact O-N 3.23Å; L16-S20 PolarHBondContact O-OG 2.81Å; L16-S20 VanDerWaalsContact O-OG 3.14Å; A17-S20 PolarHBondContact O-N 2.79Å; S20-A22 VanDerWaalsContact C-N 3.35Å; S20-A22 PolarHBondContact O-N 3.44Å; S20-L23 PolarHBondContact O-N 3.03Å; S20-E24 VanDerWaalsContact O-CB 3.25Å; S20-E24 WeakPolarHBondContact O-CB 3.46Å; S20-E24 VanDerWaalsContact O-CG 3.26Å; S20-E24 WeakPolarHBondContact O-CG 2.82Å; S20-E24 PolarHBondContact O-N 2.87Å
21	E	63.5	Low	58.2	Low	98 Å²	98	96.1 Å²	96.1	46%	0.458	54%	0.541	S	S	.	.	H	α-helix	trans	-64.3	-40	174.9	-70.7	-165.7	153.3	0	0	111.9	A17 R25	A17-E21 WeakPolarHBondContact O-CG 3.21Å; A17-E21 PolarHBondContact O-N 3.5Å; E21-R25 VanDerWaalsContact O-CB 3.3Å; E21-R25 WeakPolarHBondContact O-CB 3.5Å; E21-R25 VanDerWaalsContact O-CG 3.25Å; E21-R25 WeakPolarHBondContact O-CG 2.86Å; E21-R25 PolarHBondContact O-N 3.35Å; E21-R25 IonicContact OE2-NH2 3.95Å
22	A	64.4	Low	58	Low	49 Å²	49	98.7 Å²	98.7	41%	0.405	55%	0.546	S	S	.	.	H	α-helix	trans	-67.5	-40.9	176.1	0	0	0	0	0	111.7	N18 S19 S20 R25 A26	N18-A22 WeakPolarHBondContact O-CB 3.1Å; N18-A22 PolarHBondContact O-N 3.16Å; S19-A22 PolarHBondContact O-N 3.49Å; S20-A22 VanDerWaalsContact C-N 3.35Å; S20-A22 PolarHBondContact O-N 3.44Å; A22-R25 PolarHBondContact O-N 2.55Å; A22-A26 WeakPolarHBondContact O-CB 3.01Å; A22-A26 PolarHBondContact O-N 3.3Å
23	L	59.6	Low	57.8	Low	113 Å²	113	98.7 Å²	98.7	59%	0.592	55%	0.546	S	S	*	.	H	α-helix	trans	-67.9	-42.9	175.6	-176	66.3	0	0	0	110.3	S19 S20 R25 A26 V27	S19-L23 WeakPolarHBondContact O-CA 3.38Å; S19-L23 WeakPolarHBondContact O-CB 3.17Å; S19-L23 PolarHBondContact O-N 3.15Å; S20-L23 PolarHBondContact O-N 3.03Å; L23-R25 PolarHBondContact O-N 3.09Å; L23-A26 PolarHBondContact O-N 3.13Å; L23-V27 HydrophobicContact CD1-CG2 4.13Å; L23-V27 HydrophobicContact CG-CG2 4.13Å; L23-V27 WeakPolarHBondContact O-CA 3.47Å; L23-V27 WeakPolarHBondContact O-CB 3.14Å; L23-V27 WeakPolarHBondContact O-CG2 3.41Å; L23-V27 PolarHBondContact O-N 3.49Å
24	E	60.6	Low	57.7	Low	127 Å²	127	100.1 Å²	100.1	59%	0.593	55%	0.55	S	S	*	.	H	α-helix	trans	-63.9	-40.1	174.7	-77.4	-164.8	131.2	0	0	111.5	S20 R28	S20-E24 VanDerWaalsContact O-CB 3.25Å; S20-E24 WeakPolarHBondContact O-CB 3.46Å; S20-E24 VanDerWaalsContact O-CG 3.26Å; S20-E24 WeakPolarHBondContact O-CG 2.82Å; S20-E24 PolarHBondContact O-N 2.87Å; E24-R28 VanDerWaalsContact O-CB 3.23Å; E24-R28 WeakPolarHBondContact O-CB 3.34Å; E24-R28 VanDerWaalsContact O-CG 3.29Å; E24-R28 WeakPolarHBondContact O-CG 3.19Å; E24-R28 PolarHBondContact O-N 3.42Å
25	R	63.7	Low	57.4	Low	162 Å²	162	99 Å²	99	61%	0.611	55%	0.549	S	S	*	.	H	α-helix	trans	-66	-41.8	172.6	-76.5	178.7	-173	136.1	9.3	111.7	E21 A22 L23 R28 C29	E21-R25 VanDerWaalsContact O-CB 3.3Å; E21-R25 WeakPolarHBondContact O-CB 3.5Å; E21-R25 VanDerWaalsContact O-CG 3.25Å; E21-R25 WeakPolarHBondContact O-CG 2.86Å; E21-R25 PolarHBondContact O-N 3.35Å; E21-R25 IonicContact OE2-NH2 3.95Å; A22-R25 PolarHBondContact O-N 2.55Å; L23-R25 PolarHBondContact O-N 3.09Å; R25-R28 PolarHBondContact O-N 2.65Å; R25-C29 WeakPolarHBondContact O-CB 3.38Å; R25-C29 PolarHBondContact O-N 2.95Å
26	A	62	Low	56.9	Low	54 Å²	54	96.4 Å²	96.4	45%	0.446	55%	0.545	S	S	.	.	H	α-helix	trans	-68.3	-44.3	178.2	0	0	0	0	0	111.9	A22 L23 C29 C30	A22-A26 WeakPolarHBondContact O-CB 3.01Å; A22-A26 PolarHBondContact O-N 3.3Å; L23-A26 PolarHBondContact O-N 3.13Å; A26-C29 PolarHBondContact O-N 3.27Å; A26-C30 PolarHBondContact O-N 3Å; A26-C30 VanDerWaalsContact O-N 3.11Å
27	V	59.3	Low	56.4	Low	77 Å²	77	97 Å²	97	47%	0.467	55%	0.554	S	S	.	*	H	α-helix	trans	-58.7	-49.8	171.4	170.7	0	0	0	0	108.5	L23 C29 C30 T31	L23-V27 HydrophobicContact CD1-CG2 4.13Å; L23-V27 HydrophobicContact CG-CG2 4.13Å; L23-V27 WeakPolarHBondContact O-CA 3.47Å; L23-V27 WeakPolarHBondContact O-CB 3.14Å; L23-V27 WeakPolarHBondContact O-CG2 3.41Å; L23-V27 PolarHBondContact O-N 3.49Å; V27-C29 PolarHBondContact O-N 2.69Å; V27-C30 PolarHBondContact O-N 3.28Å; V27-T31 WeakPolarHBondContact CG1-OG1 3.36Å; V27-T31 WeakPolarHBondContact O-CA 3.21Å; V27-T31 WeakPolarHBondContact O-CB 3.37Å; V27-T31 PolarHBondContact O-N 3.47Å; V27-T31 PolarHBondContact O-OG1 3.38Å
28	R	58	Low	55.9	Low	204 Å²	204	101.1 Å²	101.1	77%	0.77	57%	0.568	S	S	*	*	H	α-helix	trans	-62.5	-40.8	176.9	-80.2	-162.8	-173.8	-158.9	5.6	113.4	E24 R25 C30 Q32	E24-R28 VanDerWaalsContact O-CB 3.23Å; E24-R28 WeakPolarHBondContact O-CB 3.34Å; E24-R28 VanDerWaalsContact O-CG 3.29Å; E24-R28 WeakPolarHBondContact O-CG 3.19Å; E24-R28 PolarHBondContact O-N 3.42Å; R25-R28 PolarHBondContact O-N 2.65Å; R28-C30 VanDerWaalsContact C-N 3.28Å; R28-C30 PolarHBondContact O-N 3.07Å; R28-Q32 PolarHBondContact O-N 2.76Å
29	C	62.5	Low	55.2	Low	98 Å²	98	104.6 Å²	104.6	66%	0.662	59%	0.587	S	S	*	*	H	α-helix	trans	-62.6	-38	-177.2	-160.7	0	0	0	0	111.2	R25 A26 V27	R25-C29 WeakPolarHBondContact O-CB 3.38Å; R25-C29 PolarHBondContact O-N 2.95Å; A26-C29 PolarHBondContact O-N 3.27Å; V27-C29 PolarHBondContact O-N 2.69Å
30	C	54.6	Low	54.1	Low	81 Å²	81	102.9 Å²	102.9	55%	0.547	58%	0.58	S	S	.	*	H	α-helix	trans	-102.2	-18.1	-177.3	-60	0	0	0	0	114.5	A26 V27 R28 A33 S34	A26-C30 PolarHBondContact O-N 3Å; A26-C30 VanDerWaalsContact O-N 3.11Å; V27-C30 PolarHBondContact O-N 3.28Å; R28-C30 VanDerWaalsContact C-N 3.28Å; R28-C30 PolarHBondContact O-N 3.07Å; C30-A33 PolarHBondContact O-N 2.85Å; C30-S34 WeakPolarHBondContact O-CB 3.47Å; C30-S34 PolarHBondContact O-N 2.74Å
31	T	56.2	Low	53	Low	66 Å²	66	109.7 Å²	109.7	41%	0.405	60%	0.602	S	S	.	*	H	α-helix	trans	-70	-37.2	175.7	-53.7	0	0	0	0	110.2	V27 V35	V27-T31 WeakPolarHBondContact CG1-OG1 3.36Å; V27-T31 WeakPolarHBondContact O-CA 3.21Å; V27-T31 WeakPolarHBondContact O-CB 3.37Å; V27-T31 PolarHBondContact O-N 3.47Å; V27-T31 PolarHBondContact O-OG1 3.38Å; T31-V35 WeakPolarHBondContact O-CB 3.44Å; T31-V35 WeakPolarHBondContact O-CG2 3.34Å; T31-V35 PolarHBondContact O-N 2.93Å
32	Q	51.6	Low	51.9	Low	155 Å²	155	109 Å²	109	72%	0.724	61%	0.612	S	S	*	*	H	α-helix	trans	-67.5	-41.1	171.2	-168	166.2	84.4	0	0	110.7	R28 V35 V36	R28-Q32 PolarHBondContact O-N 2.76Å; Q32-V35 PolarHBondContact O-N 2.64Å; Q32-V36 WeakPolarHBondContact O-CG2 3.06Å; Q32-V36 PolarHBondContact O-N 2.72Å
33	A	48.4	Very low	50.7	Low	63 Å²	63	115.7 Å²	115.7	52%	0.521	64%	0.635	S	S	.	*	H	α-helix	trans	-67.8	-36.1	179.4	0	0	0	0	0	114	C30 V35 V36	C30-A33 PolarHBondContact O-N 2.85Å; A33-V35 VanDerWaalsContact C-N 3.32Å; A33-V36 PolarHBondContact O-N 3.48Å
34	S	47.1	Very low	49.8	Very low	69 Å²	69	114.3 Å²	114.3	48%	0.483	65%	0.649	S	S	.	*	H	α-helix	trans	-76.3	-18.5	177	176.2	0	0	0	0	113.1	C30 V36 Q58	C30-S34 WeakPolarHBondContact O-CB 3.47Å; C30-S34 PolarHBondContact O-N 2.74Å; S34-V36 VanDerWaalsContact C-N 3.31Å; S34-Q58 PolarHBondContact OG-NE2 3.16Å
35	V	47.1	Very low	48.9	Very low	110 Å²	110	110.2 Å²	110.2	67%	0.667	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87	-6	171.8	173.9	0	0	0	0	111.1	T31 Q32 A33 T37	T31-V35 WeakPolarHBondContact O-CB 3.44Å; T31-V35 WeakPolarHBondContact O-CG2 3.34Å; T31-V35 PolarHBondContact O-N 2.93Å; Q32-V35 PolarHBondContact O-N 2.64Å; A33-V35 VanDerWaalsContact C-N 3.32Å; V35-T37 PolarHBondContact O-N 2.66Å
36	V	40.9	Very low	48.4	Very low	95 Å²	95	108.2 Å²	108.2	58%	0.576	65%	0.649	S	S	*	*			trans	-99.5	83.3	179.6	176.3	0	0	0	0	110	Q32 A33 S34	Q32-V36 WeakPolarHBondContact O-CG2 3.06Å; Q32-V36 PolarHBondContact O-N 2.72Å; A33-V36 PolarHBondContact O-N 3.48Å; S34-V36 VanDerWaalsContact C-N 3.31Å
37	T	45.4	Very low	48	Very low	131 Å²	131	110.6 Å²	110.6	80%	0.804	65%	0.654	S	S	*	*	S	Bend	trans	-180	102.4	155.7	9.4	0	0	0	0	103.4	V35	V35-T37 PolarHBondContact O-N 2.66Å
38	D	44.8	Very low	47.9	Very low	135 Å²	135	114.4 Å²	114.4	72%	0.722	67%	0.667	S	S	*	*			cis	-168	96.5	43.3	178.4	32.5	0	0	0	105.9	G40	D38-G40 PolarHBondContact O-N 3.46Å
39	D	44.1	Very low	48.2	Very low	174 Å²	174	114 Å²	114	93%	0.93	67%	0.665	S	S	*	*			trans	-79.4	69.5	172.2	-66.8	-50.3	0	0	0	108.6
40	G	38.9	Very low	48	Very low	32 Å²	32	112.2 Å²	112.2	33%	0.33	65%	0.654	S	S	.	*			trans	-149.8	118.8	172.1	0	0	0	0	0	108.9	D38	D38-G40 PolarHBondContact O-N 3.46Å
41	F	39.8	Very low	48.6	Very low	210 Å²	210	113.9 Å²	113.9	92%	0.921	66%	0.656	S	S	*	*	S	Bend	trans	82.7	82	-175.3	-61	-90	0	0	0	114
42	A	41.3	Very low	49.6	Very low	83 Å²	83	118.3 Å²	118.3	69%	0.686	67%	0.667	S	S	*	*				70.2	108.9	86.9	0	0	0	0	0	113.7
43	E	39.3	Very low	50.8	Low	190 Å²	190	115.2 Å²	115.2	89%	0.888	66%	0.655	S	S	*	*			trans	65.7	100.4	147.3	-80.4	160.6	92	0	0	119.9
44	G	39.7	Very low	52.2	Low	84 Å²	84	117.1 Å²	117.1	87%	0.866	65%	0.654	S	S	*	*				74.6	67.6	126.3	0	0	0	0	0	116.2
45	G	43	Very low	53.8	Low	41 Å²	41	122.2 Å²	122.2	42%	0.423	66%	0.662	S	S	.	*	S	Bend	trans	-154.8	177.6	170.4	0	0	0	0	0	110.2	D47	G45-D47 PolarHBondContact O-N 3.29Å
46	P	51.5	Low	55.6	Low	121 Å²	121	121.3 Å²	121.3	79%	0.786	66%	0.657	S	S	*	*	S	Bend	trans	-69.1	59.9	-166.9	28.9	-36.5	0	0	0	116.2
47	D	55.6	Low	57.9	Low	103 Å²	103	120.7 Å²	120.7	55%	0.551	65%	0.653	S	S	*	*	H	α-helix	trans	-87.6	-20.8	-175.8	-52.5	-42.1	0	0	0	112.6	G45 R49 S50 L51	G45-D47 PolarHBondContact O-N 3.29Å; D47-R49 VanDerWaalsContact C-N 3.32Å; D47-R49 PolarHBondContact O-N 3.45Å; D47-S50 PolarHBondContact O-N 3.23Å; D47-L51 PolarHBondContact O-N 3.21Å
48	E	57.1	Low	59.7	Low	158 Å²	158	119 Å²	119	74%	0.738	64%	0.636	S	S	*	*	H	α-helix	trans	-57.5	-46.8	178.9	-55.8	-174.9	156.1	0	0	110.8	S50 Y52	E48-S50 PolarHBondContact O-N 2.8Å; E48-Y52 WeakPolarHBondContact O-CD2 3.18Å; E48-Y52 PolarHBondContact O-N 2.75Å
49	R	64.2	Low	61.8	Low	194 Å²	194	117.6 Å²	117.6	73%	0.732	63%	0.628	S	S	*	*	H	α-helix	trans	-67.7	-36.7	-178.3	-165.2	-179	-174.9	-167.2	1.8	112	D47 Y52 I53	D47-R49 VanDerWaalsContact C-N 3.32Å; D47-R49 PolarHBondContact O-N 3.45Å; R49-Y52 PolarHBondContact O-N 2.77Å; R49-I53 HydrophobicContact CG-CD1 4.07Å; R49-I53 VanDerWaalsContact O-CG1 3.27Å; R49-I53 WeakPolarHBondContact O-CG1 3.45Å; R49-I53 PolarHBondContact O-N 3.34Å
50	S	58	Low	64	Low	61 Å²	61	111.5 Å²	111.5	43%	0.427	60%	0.602	S	S	.	*	H	α-helix	trans	-66.4	-42.2	-177.8	-162.4	0	0	0	0	111.6	D47 E48 Y52 I53 M54	D47-S50 PolarHBondContact O-N 3.23Å; E48-S50 PolarHBondContact O-N 2.8Å; S50-Y52 VanDerWaalsContact C-N 3.35Å; S50-Y52 PolarHBondContact O-N 3.36Å; S50-I53 PolarHBondContact O-N 2.75Å; S50-M54 PolarHBondContact O-N 2.83Å
51	L	67.4	Low	66.6	Low	116 Å²	116	113.4 Å²	113.4	61%	0.607	61%	0.607	S	S	*	*	H	α-helix	trans	-61	-41.1	174.3	-69.9	175.2	0	0	0	112.4	D47 M54 R55	D47-L51 PolarHBondContact O-N 3.21Å; L51-M54 HydrophobicContact CD2-CE 3.95Å; L51-M54 PolarHBondContact O-N 2.91Å; L51-R55 PolarHBondContact O-N 3.41Å; L51-R55 VanDerWaalsContact O-N 3.11Å
52	Y	75.6	Confident	69	Low	160 Å²	160	109 Å²	109	63%	0.627	59%	0.59	S	S	*	*	H	α-helix	trans	-63.9	-42.4	174.6	-77.5	-68.4	0	0	0	112.1	E48 R49 S50 M54 R55 V56	E48-Y52 WeakPolarHBondContact O-CD2 3.18Å; E48-Y52 PolarHBondContact O-N 2.75Å; R49-Y52 PolarHBondContact O-N 2.77Å; S50-Y52 VanDerWaalsContact C-N 3.35Å; S50-Y52 PolarHBondContact O-N 3.36Å; Y52-M54 PolarHBondContact O-N 3.48Å; Y52-R55 PolarHBondContact O-N 3.5Å; Y52-V56 VanDerWaalsContact O-CG2 3.29Å; Y52-V56 WeakPolarHBondContact O-CG2 3.42Å; Y52-V56 PolarHBondContact O-N 2.9Å
53	I	78.2	Confident	71.6	Confident	90 Å²	90	108 Å²	108	46%	0.462	58%	0.578	S	S	.	*	H	α-helix	trans	-60	-48	178.4	-68.4	162.2	0	0	0	110.2	R49 S50 R55 V56 V57	R49-I53 HydrophobicContact CG-CD1 4.07Å; R49-I53 VanDerWaalsContact O-CG1 3.27Å; R49-I53 WeakPolarHBondContact O-CG1 3.45Å; R49-I53 PolarHBondContact O-N 3.34Å; S50-I53 PolarHBondContact O-N 2.75Å; I53-R55 VanDerWaalsContact C-N 3.33Å; I53-R55 PolarHBondContact O-N 2.9Å; I53-V56 PolarHBondContact O-N 3.49Å; I53-V57 HydrophobicContact CG2-CG2 4.32Å; I53-V57 VanDerWaalsContact O-CG2 3.27Å; I53-V57 WeakPolarHBondContact O-CG2 3.02Å; I53-V57 PolarHBondContact O-N 3.42Å
54	M	76.9	Confident	74.3	Confident	103 Å²	103	103 Å²	103	51%	0.507	56%	0.56	S	S	.	*	H	α-helix	trans	-60.8	-41.4	178.5	-70	-166.5	-76.5	0	0	112.4	S50 L51 Y52 V57 Q58	S50-M54 PolarHBondContact O-N 2.83Å; L51-M54 HydrophobicContact CD2-CE 3.95Å; L51-M54 PolarHBondContact O-N 2.91Å; Y52-M54 PolarHBondContact O-N 3.48Å; M54-V57 PolarHBondContact O-N 2.86Å; M54-Q58 WeakPolarHBondContact O-CG 3.36Å; M54-Q58 PolarHBondContact O-N 3.41Å
55	R	81.4	Confident	76.9	Confident	175 Å²	175	103.4 Å²	103.4	66%	0.66	54%	0.541	S	S	*	.	H	α-helix	trans	-63.7	-43.5	176.1	-168.9	-176.8	-69.9	-143.3	-0	111.8	L51 Y52 I53 V57 Q58 I59	L51-R55 PolarHBondContact O-N 3.41Å; L51-R55 VanDerWaalsContact O-N 3.11Å; Y52-R55 PolarHBondContact O-N 3.5Å; I53-R55 VanDerWaalsContact C-N 3.33Å; I53-R55 PolarHBondContact O-N 2.9Å; R55-V57 VanDerWaalsContact C-N 3.34Å; R55-Q58 PolarHBondContact O-N 2.78Å; R55-I59 HydrophobicContact CG-CD1 3.87Å; R55-I59 WeakPolarHBondContact O-CB 3.45Å; R55-I59 WeakPolarHBondContact O-CD1 3.23Å; R55-I59 WeakPolarHBondContact O-CG1 3.13Å; R55-I59 PolarHBondContact O-N 3.07Å
56	V	85.1	Confident	79.3	Confident	91 Å²	91	104.8 Å²	104.8	55%	0.552	55%	0.545	S	S	*	.	H	α-helix	trans	-64.1	-40.8	177.3	171.6	0	0	0	0	110.9	Y52 I53 I59 A60	Y52-V56 VanDerWaalsContact O-CG2 3.29Å; Y52-V56 WeakPolarHBondContact O-CG2 3.42Å; Y52-V56 PolarHBondContact O-N 2.9Å; I53-V56 PolarHBondContact O-N 3.49Å; V56-I59 PolarHBondContact O-N 2.97Å; V56-A60 WeakPolarHBondContact O-CB 3.05Å; V56-A60 PolarHBondContact O-N 3.21Å
57	V	89.5	Confident	81.2	Confident	83 Å²	83	103 Å²	103	50%	0.503	53%	0.528	S	S	.	.	H	α-helix	trans	-61.7	-46.4	176.4	171.8	0	0	0	0	110.8	I53 M54 R55 A60 V61	I53-V57 HydrophobicContact CG2-CG2 4.32Å; I53-V57 VanDerWaalsContact O-CG2 3.27Å; I53-V57 WeakPolarHBondContact O-CG2 3.02Å; I53-V57 PolarHBondContact O-N 3.42Å; M54-V57 PolarHBondContact O-N 2.86Å; R55-V57 VanDerWaalsContact C-N 3.34Å; V57-A60 PolarHBondContact O-N 3.48Å; V57-V61 WeakPolarHBondContact O-CG2 3.18Å; V57-V61 PolarHBondContact O-N 2.89Å
58	Q	83.2	Confident	83.1	Confident	95 Å²	95	101.8 Å²	101.8	44%	0.444	53%	0.525	S	S	.	.	H	α-helix	trans	-62.1	-45.9	176.4	-71.6	-174.4	21.6	0	0	112.1	S34 M54 R55 A60 V61 M62	S34-Q58 PolarHBondContact OG-NE2 3.16Å; M54-Q58 WeakPolarHBondContact O-CG 3.36Å; M54-Q58 PolarHBondContact O-N 3.41Å; R55-Q58 PolarHBondContact O-N 2.78Å; Q58-A60 VanDerWaalsContact C-N 3.31Å; Q58-A60 PolarHBondContact O-N 3.5Å; Q58-V61 PolarHBondContact O-N 3.43Å; Q58-M62 WeakPolarHBondContact O-CG 2.94Å; Q58-M62 PolarHBondContact O-N 3.27Å
59	I	88.4	Confident	84.8	Confident	106 Å²	106	98.4 Å²	98.4	54%	0.544	52%	0.515	S	S	.	.	H	α-helix	trans	-60.3	-43.5	176.2	-67.4	164	0	0	0	110.3	R55 V56 V61 M62 C63	R55-I59 HydrophobicContact CG-CD1 3.87Å; R55-I59 WeakPolarHBondContact O-CB 3.45Å; R55-I59 WeakPolarHBondContact O-CD1 3.23Å; R55-I59 WeakPolarHBondContact O-CG1 3.13Å; R55-I59 PolarHBondContact O-N 3.07Å; V56-I59 PolarHBondContact O-N 2.97Å; I59-V61 PolarHBondContact O-N 2.84Å; I59-M62 PolarHBondContact O-N 3.32Å; I59-C63 WeakPolarHBondContact O-CB 3.27Å; I59-C63 PolarHBondContact O-N 3.47Å
60	A	89.6	Confident	86.1	Confident	46 Å²	46	92.1 Å²	92.1	38%	0.38	50%	0.498	S	S	.	.	H	α-helix	trans	-61.1	-44.4	178.8	0	0	0	0	0	111	V56 V57 Q58 C63 V64	V56-A60 WeakPolarHBondContact O-CB 3.05Å; V56-A60 PolarHBondContact O-N 3.21Å; V57-A60 PolarHBondContact O-N 3.48Å; Q58-A60 VanDerWaalsContact C-N 3.31Å; Q58-A60 PolarHBondContact O-N 3.5Å; A60-C63 PolarHBondContact O-N 2.99Å; A60-V64 WeakPolarHBondContact O-CB 3.06Å; A60-V64 WeakPolarHBondContact O-CG2 3.23Å; A60-V64 PolarHBondContact O-N 3.28Å
61	V	93.7	Very high	87.7	Confident	72 Å²	72	94.4 Å²	94.4	44%	0.436	50%	0.5	S	S	.	.	H	α-helix	trans	-61.9	-49	175.8	173.5	0	0	0	0	110.9	V57 Q58 I59 C63 V64 L65	V57-V61 WeakPolarHBondContact O-CG2 3.18Å; V57-V61 PolarHBondContact O-N 2.89Å; Q58-V61 PolarHBondContact O-N 3.43Å; I59-V61 PolarHBondContact O-N 2.84Å; V61-C63 VanDerWaalsContact C-N 3.28Å; V61-C63 PolarHBondContact O-N 2.96Å; V61-V64 PolarHBondContact O-N 2.95Å; V61-L65 HydrophobicContact CG1-CD1 3.93Å; V61-L65 HydrophobicContact CG1-CG 4.32Å; V61-L65 WeakPolarHBondContact O-CB 3.48Å; V61-L65 VanDerWaalsContact O-CG 3.22Å; V61-L65 WeakPolarHBondContact O-CG 3.47Å; V61-L65 PolarHBondContact O-N 3.43Å
62	M	90.8	Very high	88.9	Confident	118 Å²	118	90.3 Å²	90.3	58%	0.581	49%	0.486	S	S	*	.	H	α-helix	trans	-61.7	-37.9	178.6	-66.3	-65.3	143.4	0	0	112.2	Q58 I59 S66	Q58-M62 WeakPolarHBondContact O-CG 2.94Å; Q58-M62 PolarHBondContact O-N 3.27Å; I59-M62 PolarHBondContact O-N 3.32Å; M62-S66 WeakPolarHBondContact O-CB 3.34Å; M62-S66 PolarHBondContact O-N 2.78Å; M62-S66 PolarHBondContact O-OG 2.93Å
63	C	94.5	Very high	89.5	Confident	62 Å²	62	87.8 Å²	87.8	42%	0.419	48%	0.482	S	S	.	.	H	α-helix	trans	-66.3	-48.2	175.5	-174.9	0	0	0	0	111.3	I59 A60 V61 L65 S66 L67	I59-C63 WeakPolarHBondContact O-CB 3.27Å; I59-C63 PolarHBondContact O-N 3.47Å; A60-C63 PolarHBondContact O-N 2.99Å; V61-C63 VanDerWaalsContact C-N 3.28Å; V61-C63 PolarHBondContact O-N 2.96Å; C63-L65 VanDerWaalsContact C-N 3.33Å; C63-L65 PolarHBondContact O-N 3.29Å; C63-S66 PolarHBondContact O-N 3.47Å; C63-S66 VanDerWaalsContact O-N 3.16Å; C63-L67 WeakPolarHBondContact O-CB 3.47Å; C63-L67 VanDerWaalsContact O-CG 3.26Å; C63-L67 WeakPolarHBondContact O-CG 3.25Å; C63-L67 PolarHBondContact O-N 3.35Å
64	V	96.8	Very high	89.8	Confident	85 Å²	85	89.4 Å²	89.4	52%	0.515	49%	0.486	S	S	.	.	H	α-helix	trans	-61.7	-41.8	177.7	170.6	0	0	0	0	111.2	A60 V61 L67 T68	A60-V64 WeakPolarHBondContact O-CB 3.06Å; A60-V64 WeakPolarHBondContact O-CG2 3.23Å; A60-V64 PolarHBondContact O-N 3.28Å; V61-V64 PolarHBondContact O-N 2.95Å; V64-L67 PolarHBondContact O-N 3.36Å; V64-T68 HydrophobicContact CG1-CG2 4.47Å; V64-T68 WeakPolarHBondContact O-CB 3.46Å; V64-T68 WeakPolarHBondContact O-CG2 3.26Å; V64-T68 PolarHBondContact O-N 2.77Å; V64-T68 PolarHBondContact O-OG1 2.96Å
65	L	94.2	Very high	90.1	Very high	91 Å²	91	91.3 Å²	91.3	48%	0.476	49%	0.491	S	S	.	.	H	α-helix	trans	-61.4	-46.3	173.8	-68.7	174.9	0	0	0	111.1	V61 C63 L67 T68 V69	V61-L65 HydrophobicContact CG1-CD1 3.93Å; V61-L65 HydrophobicContact CG1-CG 4.32Å; V61-L65 WeakPolarHBondContact O-CB 3.48Å; V61-L65 VanDerWaalsContact O-CG 3.22Å; V61-L65 WeakPolarHBondContact O-CG 3.47Å; V61-L65 PolarHBondContact O-N 3.43Å; C63-L65 VanDerWaalsContact C-N 3.33Å; C63-L65 PolarHBondContact O-N 3.29Å; L65-L67 PolarHBondContact O-N 2.77Å; L65-T68 WeakPolarHBondContact CA-OG1 3.42Å; L65-T68 PolarHBondContact O-N 3.14Å; L65-T68 PolarHBondContact O-OG1 3.5Å; L65-V69 WeakPolarHBondContact O-CB 3.13Å; L65-V69 VanDerWaalsContact O-CG2 3.25Å; L65-V69 WeakPolarHBondContact O-CG2 3.24Å; L65-V69 PolarHBondContact O-N 2.81Å
66	S	93.8	Very high	90.2	Very high	71 Å²	71	88.3 Å²	88.3	50%	0.497	49%	0.488	S	S	.	.	H	α-helix	trans	-63.2	-44.1	177.7	-58.3	0	0	0	0	111.9	M62 C63 V69 V70	M62-S66 WeakPolarHBondContact O-CB 3.34Å; M62-S66 PolarHBondContact O-N 2.78Å; M62-S66 PolarHBondContact O-OG 2.93Å; C63-S66 PolarHBondContact O-N 3.47Å; C63-S66 VanDerWaalsContact O-N 3.16Å; S66-V69 PolarHBondContact O-N 2.91Å; S66-V70 VanDerWaalsContact O-CB 3.24Å; S66-V70 WeakPolarHBondContact O-CB 3.37Å; S66-V70 WeakPolarHBondContact O-CG2 3.22Å; S66-V70 PolarHBondContact O-N 3.4Å
67	L	91.7	Very high	90.1	Very high	82 Å²	82	84.9 Å²	84.9	43%	0.429	47%	0.471	S	S	.	.	H	α-helix	trans	-63.6	-42.4	177.9	-71	175.8	0	0	0	112	C63 V64 L65 V70 F71	C63-L67 WeakPolarHBondContact O-CB 3.47Å; C63-L67 VanDerWaalsContact O-CG 3.26Å; C63-L67 WeakPolarHBondContact O-CG 3.25Å; C63-L67 PolarHBondContact O-N 3.35Å; V64-L67 PolarHBondContact O-N 3.36Å; L65-L67 PolarHBondContact O-N 2.77Å; L67-V70 PolarHBondContact O-N 2.68Å; L67-F71 HydrophobicContact CB-CD2 4.37Å; L67-F71 HydrophobicContact CB-CE2 4.16Å; L67-F71 VanDerWaalsContact O-CB 3.27Å; L67-F71 WeakPolarHBondContact O-CB 3.41Å; L67-F71 WeakPolarHBondContact O-CD2 3.41Å; L67-F71 WeakPolarHBondContact O-CG 3.2Å; L67-F71 PolarHBondContact O-N 3.25Å
68	T	94.2	Very high	89.7	Confident	78 Å²	78	83.9 Å²	83.9	48%	0.479	47%	0.467	S	S	.	.	H	α-helix	trans	-68.1	-39.2	177.6	50.4	0	0	0	0	112.3	V64 L65 F71 G72	V64-T68 HydrophobicContact CG1-CG2 4.47Å; V64-T68 WeakPolarHBondContact O-CB 3.46Å; V64-T68 WeakPolarHBondContact O-CG2 3.26Å; V64-T68 PolarHBondContact O-N 2.77Å; V64-T68 PolarHBondContact O-OG1 2.96Å; L65-T68 WeakPolarHBondContact CA-OG1 3.42Å; L65-T68 PolarHBondContact O-N 3.14Å; L65-T68 PolarHBondContact O-OG1 3.5Å; T68-F71 PolarHBondContact O-N 2.84Å; T68-G72 PolarHBondContact O-N 2.89Å
69	V	94.4	Very high	89.3	Confident	87 Å²	87	84.7 Å²	84.7	53%	0.527	47%	0.474	S	S	.	.	H	α-helix	trans	-63	-49	173.2	170.4	0	0	0	0	110.2	L65 S66 F71 G72 I73	L65-V69 WeakPolarHBondContact O-CB 3.13Å; L65-V69 VanDerWaalsContact O-CG2 3.25Å; L65-V69 WeakPolarHBondContact O-CG2 3.24Å; L65-V69 PolarHBondContact O-N 2.81Å; S66-V69 PolarHBondContact O-N 2.91Å; V69-F71 PolarHBondContact O-N 3.36Å; V69-G72 PolarHBondContact O-N 3.38Å; V69-I73 HydrophobicContact CG1-CD1 3.64Å; V69-I73 HydrophobicContact CG1-CG1 4.4Å; V69-I73 WeakPolarHBondContact O-CB 3.17Å; V69-I73 VanDerWaalsContact O-CG1 3.23Å; V69-I73 WeakPolarHBondContact O-CG1 3.48Å; V69-I73 PolarHBondContact O-N 3.23Å
70	V	91	Very high	88.3	Confident	62 Å²	62	84.6 Å²	84.6	38%	0.376	47%	0.474	S	S	.	.	H	α-helix	trans	-59.5	-47.1	177.3	168.1	0	0	0	0	110.7	S66 L67 I73 F74	S66-V70 VanDerWaalsContact O-CB 3.24Å; S66-V70 WeakPolarHBondContact O-CB 3.37Å; S66-V70 WeakPolarHBondContact O-CG2 3.22Å; S66-V70 PolarHBondContact O-N 3.4Å; L67-V70 PolarHBondContact O-N 2.68Å; V70-I73 PolarHBondContact O-N 2.9Å; V70-F74 HydrophobicContact CB-CE2 4.49Å; V70-F74 HydrophobicContact CG1-CD2 3.42Å; V70-F74 VanDerWaalsContact CG1-CD2 3.42Å; V70-F74 HydrophobicContact CG1-CE2 3.1Å; V70-F74 HydrophobicContact CG1-CZ 4.13Å; V70-F74 WeakPolarHBondContact O-CB 3.39Å; V70-F74 WeakPolarHBondContact O-CD2 3.44Å; V70-F74 WeakPolarHBondContact O-CG 3.39Å; V70-F74 PolarHBondContact O-N 3.39Å
71	F	90.7	Very high	87	Confident	110 Å²	110	87.5 Å²	87.5	48%	0.482	48%	0.483	S	S	.	.	H	α-helix	trans	-65	-38.5	175	-69.5	-39.9	0	0	0	112.6	L67 T68 V69 F74 F75	L67-F71 HydrophobicContact CB-CD2 4.37Å; L67-F71 HydrophobicContact CB-CE2 4.16Å; L67-F71 VanDerWaalsContact O-CB 3.27Å; L67-F71 WeakPolarHBondContact O-CB 3.41Å; L67-F71 WeakPolarHBondContact O-CD2 3.41Å; L67-F71 WeakPolarHBondContact O-CG 3.2Å; L67-F71 PolarHBondContact O-N 3.25Å; T68-F71 PolarHBondContact O-N 2.84Å; V69-F71 PolarHBondContact O-N 3.36Å; F71-F74 CarbonylContact O-C 3.51Å; F71-F74 PolarHBondContact O-N 3.29Å; F71-F75 HydrophobicContact CB-CD2 4.21Å; F71-F75 HydrophobicContact CB-CE2 3.94Å; F71-F75 WeakPolarHBondContact O-CB 3.42Å; F71-F75 WeakPolarHBondContact O-CD2 3.27Å; F71-F75 WeakPolarHBondContact O-CG 3.36Å; F71-F75 PolarHBondContact O-N 2.93Å
72	G	92.5	Very high	85.9	Confident	29 Å²	29	90.1 Å²	90.1	30%	0.299	49%	0.493	S	S	.	.	H	α-helix	trans	-61.8	-46	174.1	0	0	0	0	0	111.6	T68 V69 F74 F75 L76	T68-G72 PolarHBondContact O-N 2.89Å; V69-G72 PolarHBondContact O-N 3.38Å; G72-F74 VanDerWaalsContact C-N 3.31Å; G72-F74 PolarHBondContact O-N 3.37Å; G72-F75 PolarHBondContact O-N 3.01Å; G72-L76 VanDerWaalsContact O-CB 3.23Å; G72-L76 WeakPolarHBondContact O-CB 3.22Å; G72-L76 WeakPolarHBondContact O-CD1 3.2Å; G72-L76 WeakPolarHBondContact O-CG 3.44Å; G72-L76 PolarHBondContact O-N 3.35Å
73	I	88.2	Confident	85.1	Confident	107 Å²	107	92 Å²	92	55%	0.549	50%	0.498	S	S	.	.	H	α-helix	trans	-65	-35.2	174.5	-64.2	162.7	0	0	0	110.8	V69 V70 G77	V69-I73 HydrophobicContact CG1-CD1 3.64Å; V69-I73 HydrophobicContact CG1-CG1 4.4Å; V69-I73 WeakPolarHBondContact O-CB 3.17Å; V69-I73 VanDerWaalsContact O-CG1 3.23Å; V69-I73 WeakPolarHBondContact O-CG1 3.48Å; V69-I73 PolarHBondContact O-N 3.23Å; V70-I73 PolarHBondContact O-N 2.9Å; I73-G77 WeakPolarHBondContact O-CA 3.29Å; I73-G77 PolarHBondContact O-N 2.73Å
74	F	86.1	Confident	83.6	Confident	124 Å²	124	91 Å²	91	54%	0.544	49%	0.492	S	S	.	.	H	α-helix	trans	-75.3	-32.2	174.4	-75.2	-52.8	0	0	0	113.1	V70 F71 G72 G77 C78	V70-F74 HydrophobicContact CB-CE2 4.49Å; V70-F74 HydrophobicContact CG1-CD2 3.42Å; V70-F74 VanDerWaalsContact CG1-CD2 3.42Å; V70-F74 HydrophobicContact CG1-CE2 3.1Å; V70-F74 HydrophobicContact CG1-CZ 4.13Å; V70-F74 WeakPolarHBondContact O-CB 3.39Å; V70-F74 WeakPolarHBondContact O-CD2 3.44Å; V70-F74 WeakPolarHBondContact O-CG 3.39Å; V70-F74 PolarHBondContact O-N 3.39Å; F71-F74 CarbonylContact O-C 3.51Å; F71-F74 PolarHBondContact O-N 3.29Å; G72-F74 VanDerWaalsContact C-N 3.31Å; G72-F74 PolarHBondContact O-N 3.37Å; F74-G77 CarbonylContact O-C 3.38Å; F74-C78 WeakPolarHBondContact O-CA 3.44Å; F74-C78 WeakPolarHBondContact O-CB 3.2Å; F74-C78 PolarHBondContact O-N 3.49Å; F74-C78 PolarHBondContact O-SG 3.45Å
75	F	83.3	Confident	81.9	Confident	143 Å²	143	93.4 Å²	93.4	63%	0.627	50%	0.497	S	S	*	.	H	α-helix	trans	-74.7	-46.1	175.9	-74	-57.3	0	0	0	110.4	F71 G72 G77 N79	F71-F75 HydrophobicContact CB-CD2 4.21Å; F71-F75 HydrophobicContact CB-CE2 3.94Å; F71-F75 WeakPolarHBondContact O-CB 3.42Å; F71-F75 WeakPolarHBondContact O-CD2 3.27Å; F71-F75 WeakPolarHBondContact O-CG 3.36Å; F71-F75 PolarHBondContact O-N 2.93Å; G72-F75 PolarHBondContact O-N 3.01Å; F75-G77 VanDerWaalsContact C-N 3.26Å; F75-G77 PolarHBondContact O-N 2.72Å; F75-N79 WeakPolarHBondContact O-CB 3.22Å; F75-N79 PolarHBondContact O-N 2.85Å; F75-N79 PolarHBondContact O-ND2 3.36Å
76	L	83.7	Confident	80.4	Confident	113 Å²	113	91.5 Å²	91.5	59%	0.592	50%	0.499	S	S	*	.	H	α-helix	trans	-58.8	-46.3	169.5	-66.1	169.4	0	0	0	109.2	G72 N79 L80	G72-L76 VanDerWaalsContact O-CB 3.23Å; G72-L76 WeakPolarHBondContact O-CB 3.22Å; G72-L76 WeakPolarHBondContact O-CD1 3.2Å; G72-L76 WeakPolarHBondContact O-CG 3.44Å; G72-L76 PolarHBondContact O-N 3.35Å; L76-N79 PolarHBondContact O-N 3.26Å; L76-L80 WeakPolarHBondContact O-CB 3.34Å; L76-L80 WeakPolarHBondContact O-CG 3.27Å; L76-L80 PolarHBondContact O-N 3.2Å
77	G	82.5	Confident	78.5	Confident	18 Å²	18	94.1 Å²	94.1	19%	0.186	51%	0.505	C	S	.	.	H	α-helix	trans	-53.4	-61.9	174.8	0	0	0	0	0	111	I73 F74 F75 N79 L80 L81	I73-G77 WeakPolarHBondContact O-CA 3.29Å; I73-G77 PolarHBondContact O-N 2.73Å; F74-G77 CarbonylContact O-C 3.38Å; F75-G77 VanDerWaalsContact C-N 3.26Å; F75-G77 PolarHBondContact O-N 2.72Å; G77-N79 VanDerWaalsContact C-N 3.31Å; G77-N79 PolarHBondContact O-N 3.41Å; G77-L80 CarbonylContact O-C 3.54Å; G77-L80 VanDerWaalsContact O-C 3.28Å; G77-L80 WeakPolarHBondContact O-CA 3.09Å; G77-L80 WeakPolarHBondContact O-CB 3.48Å; G77-L80 PolarHBondContact O-N 2.99Å; G77-L81 WeakPolarHBondContact O-CA 3.26Å; G77-L81 WeakPolarHBondContact O-CB 3.41Å; G77-L81 WeakPolarHBondContact O-CG 3.48Å; G77-L81 PolarHBondContact O-N 3.03Å
78	C	80.4	Confident	76.8	Confident	62 Å²	62	95.9 Å²	95.9	42%	0.419	51%	0.514	S	S	.	.	H	α-helix	trans	-53	-44.5	177.2	-73	0	0	0	0	112.4	F74 L80 L81 I82	F74-C78 WeakPolarHBondContact O-CA 3.44Å; F74-C78 WeakPolarHBondContact O-CB 3.2Å; F74-C78 PolarHBondContact O-N 3.49Å; F74-C78 PolarHBondContact O-SG 3.45Å; C78-L80 VanDerWaalsContact C-N 3.34Å; C78-L80 PolarHBondContact O-N 3.48Å; C78-L81 PolarHBondContact O-N 3.43Å; C78-I82 WeakPolarHBondContact O-CB 3.21Å; C78-I82 WeakPolarHBondContact O-CD1 3.16Å; C78-I82 WeakPolarHBondContact O-CG1 3.43Å; C78-I82 PolarHBondContact O-N 3.23Å
79	N	74.8	Confident	75	Confident	112 Å²	112	96.1 Å²	96.1	60%	0.599	51%	0.512	S	S	*	.	H	α-helix	trans	-63	-41.7	174	-77.4	-72.7	0	0	0	111.8	F75 L76 G77 K83	F75-N79 WeakPolarHBondContact O-CB 3.22Å; F75-N79 PolarHBondContact O-N 2.85Å; F75-N79 PolarHBondContact O-ND2 3.36Å; L76-N79 PolarHBondContact O-N 3.26Å; G77-N79 VanDerWaalsContact C-N 3.31Å; G77-N79 PolarHBondContact O-N 3.41Å; N79-K83 WeakPolarHBondContact O-CB 3.1Å; N79-K83 PolarHBondContact O-N 2.85Å
80	L	68.3	Low	73	Confident	104 Å²	104	96.9 Å²	96.9	55%	0.545	51%	0.509	S	S	.	.	H	α-helix	trans	-74.9	-27.3	177.4	-68.3	174.2	0	0	0	112.6	L76 G77 C78 K83 S84	L76-L80 WeakPolarHBondContact O-CB 3.34Å; L76-L80 WeakPolarHBondContact O-CG 3.27Å; L76-L80 PolarHBondContact O-N 3.2Å; G77-L80 CarbonylContact O-C 3.54Å; G77-L80 VanDerWaalsContact O-C 3.28Å; G77-L80 WeakPolarHBondContact O-CA 3.09Å; G77-L80 WeakPolarHBondContact O-CB 3.48Å; G77-L80 PolarHBondContact O-N 2.99Å; C78-L80 VanDerWaalsContact C-N 3.34Å; C78-L80 PolarHBondContact O-N 3.48Å; L80-K83 CarbonylContact O-C 3.28Å; L80-K83 PolarHBondContact O-N 3.47Å; L80-S84 WeakPolarHBondContact O-CA 3.48Å; L80-S84 WeakPolarHBondContact O-CB 3.25Å; L80-S84 PolarHBondContact O-N 3.11Å; L80-S84 PolarHBondContact O-OG 3.2Å
81	L	62.5	Low	70.9	Confident	107 Å²	107	100 Å²	100	56%	0.56	52%	0.522	S	S	*	.	H	α-helix	trans	-77.4	-45.7	179.6	-74.7	176.2	0	0	0	107.5	G77 C78 K83 S84 E85	G77-L81 WeakPolarHBondContact O-CA 3.26Å; G77-L81 WeakPolarHBondContact O-CB 3.41Å; G77-L81 WeakPolarHBondContact O-CG 3.48Å; G77-L81 PolarHBondContact O-N 3.03Å; C78-L81 PolarHBondContact O-N 3.43Å; L81-K83 VanDerWaalsContact C-N 3.28Å; L81-K83 PolarHBondContact O-N 3.34Å; L81-S84 WeakPolarHBondContact CA-OG 3.13Å; L81-S84 PolarHBondContact O-N 3.49Å; L81-S84 PolarHBondContact O-OG 3.33Å; L81-E85 WeakPolarHBondContact O-CB 3.17Å; L81-E85 PolarHBondContact O-N 2.55Å
82	I	70.5	Confident	69	Low	127 Å²	127	100.4 Å²	100.4	65%	0.651	53%	0.534	S	S	*	.	H	α-helix	trans	-62.4	-37.9	169.8	-64.5	162.7	0	0	0	110.3	C78	C78-I82 WeakPolarHBondContact O-CB 3.21Å; C78-I82 WeakPolarHBondContact O-CD1 3.16Å; C78-I82 WeakPolarHBondContact O-CG1 3.43Å; C78-I82 PolarHBondContact O-N 3.23Å
83	K	72.7	Confident	67	Low	159 Å²	159	105.4 Å²	105.4	69%	0.691	55%	0.547	S	S	*	.	H	α-helix	trans	-74.3	-31	176.2	-165.4	178.6	179.1	79.3	0	113.6	N79 L80 L81	N79-K83 WeakPolarHBondContact O-CB 3.1Å; N79-K83 PolarHBondContact O-N 2.85Å; L80-K83 CarbonylContact O-C 3.28Å; L80-K83 PolarHBondContact O-N 3.47Å; L81-K83 VanDerWaalsContact C-N 3.28Å; L81-K83 PolarHBondContact O-N 3.34Å
84	S	63.1	Low	65.1	Low	40 Å²	40	103 Å²	103	28%	0.28	54%	0.535	S	S	.	.	H	α-helix	trans	-93.1	-22.2	-176.6	61.1	0	0	0	0	113.7	L80 L81 G86 M87 I88	L80-S84 WeakPolarHBondContact O-CA 3.48Å; L80-S84 WeakPolarHBondContact O-CB 3.25Å; L80-S84 PolarHBondContact O-N 3.11Å; L80-S84 PolarHBondContact O-OG 3.2Å; L81-S84 WeakPolarHBondContact CA-OG 3.13Å; L81-S84 PolarHBondContact O-N 3.49Å; L81-S84 PolarHBondContact O-OG 3.33Å; S84-G86 PolarHBondContact O-N 3.41Å; S84-M87 WeakPolarHBondContact O-CA 3.49Å; S84-M87 WeakPolarHBondContact O-CB 3.23Å; S84-M87 PolarHBondContact O-N 3.42Å; S84-I88 PolarHBondContact O-N 3.11Å; S84-I88 VanDerWaalsContact O-N 3.15Å
85	E	61.6	Low	63.4	Low	136 Å²	136	108.7 Å²	108.7	64%	0.636	55%	0.553	S	S	*	*	H	α-helix	trans	-55	-34.4	168	-175.9	175.8	-179.6	0	0	110.4	L81 M87 N89	L81-E85 WeakPolarHBondContact O-CB 3.17Å; L81-E85 PolarHBondContact O-N 2.55Å; E85-M87 VanDerWaalsContact C-N 3.28Å; E85-M87 PolarHBondContact O-N 2.76Å; E85-N89 WeakPolarHBondContact O-CB 3.29Å; E85-N89 PolarHBondContact O-N 2.78Å
86	G	61.9	Low	61.8	Low	50 Å²	50	112.5 Å²	112.5	52%	0.515	56%	0.563	S	S	.	*	H	α-helix	trans	-59.1	-33.7	169.8	0	0	0	0	0	114.2	S84 F90	S84-G86 PolarHBondContact O-N 3.41Å; G86-F90 PolarHBondContact O-N 3.41Å
87	M	54.7	Low	59.8	Low	127 Å²	127	112 Å²	112	63%	0.626	57%	0.567	S	S	*	*	H	α-helix	trans	-86.8	-36.6	-174.2	-162.5	174.9	73.5	0	0	113.4	S84 E85 N89 F90 L91	S84-M87 WeakPolarHBondContact O-CA 3.49Å; S84-M87 WeakPolarHBondContact O-CB 3.23Å; S84-M87 PolarHBondContact O-N 3.42Å; E85-M87 VanDerWaalsContact C-N 3.28Å; E85-M87 PolarHBondContact O-N 2.76Å; M87-N89 VanDerWaalsContact C-N 3.29Å; M87-N89 PolarHBondContact O-N 3.27Å; M87-F90 PolarHBondContact O-N 2.79Å; M87-F90 VanDerWaalsContact O-N 3.16Å; M87-L91 PolarHBondContact O-N 2.7Å
88	I	56.8	Low	57.9	Low	119 Å²	119	115.2 Å²	115.2	61%	0.61	59%	0.587	S	S	*	*	H	α-helix	trans	-69	-33.8	176	-49.7	168.8	0	0	0	110.1	S84 F90 L91 V92	S84-I88 PolarHBondContact O-N 3.11Å; S84-I88 VanDerWaalsContact O-N 3.15Å; I88-F90 VanDerWaalsContact C-N 3.3Å; I88-F90 PolarHBondContact O-N 2.78Å; I88-L91 PolarHBondContact O-N 3.32Å; I88-V92 PolarHBondContact O-N 3.44Å
89	N	55.5	Low	56.2	Low	83 Å²	83	121.8 Å²	121.8	44%	0.444	61%	0.608	S	S	.	*	H	α-helix	trans	-69.5	-28.8	172.9	-161	-5	0	0	0	112.1	E85 M87 K93	E85-N89 WeakPolarHBondContact O-CB 3.29Å; E85-N89 PolarHBondContact O-N 2.78Å; M87-N89 VanDerWaalsContact C-N 3.29Å; M87-N89 PolarHBondContact O-N 3.27Å; N89-K93 WeakPolarHBondContact O-CG 3.19Å; N89-K93 PolarHBondContact O-N 3.5Å; N89-K93 PolarHBondContact OD1-NZ 3.23Å
90	F	51.8	Low	54.6	Low	103 Å²	103	124.8 Å²	124.8	45%	0.452	62%	0.618	S	S	.	*	H	α-helix	trans	-72.9	-39.7	174.2	-157.5	-113.4	0	0	0	111.6	G86 M87 I88 V92 K93 D94	G86-F90 PolarHBondContact O-N 3.41Å; M87-F90 PolarHBondContact O-N 2.79Å; M87-F90 VanDerWaalsContact O-N 3.16Å; I88-F90 VanDerWaalsContact C-N 3.3Å; I88-F90 PolarHBondContact O-N 2.78Å; F90-V92 VanDerWaalsContact C-N 3.35Å; F90-V92 PolarHBondContact O-N 2.84Å; F90-K93 CarbonylContact O-C 3.54Å; F90-K93 WeakPolarHBondContact O-CA 3.3Å; F90-K93 PolarHBondContact O-N 3.35Å; F90-D94 VanDerWaalsContact CD1-CG 3.41Å; F90-D94 WeakPolarHBondContact CD1-OD2 3.2Å; F90-D94 WeakPolarHBondContact CE1-OD1 3.02Å; F90-D94 WeakPolarHBondContact CE1-OD2 3.44Å; F90-D94 WeakPolarHBondContact CZ-OD1 3.32Å; F90-D94 VanDerWaalsContact O-CB 3.22Å; F90-D94 WeakPolarHBondContact O-CB 3.25Å; F90-D94 PolarHBondContact O-N 2.78Å
91	L	48	Very low	53.4	Low	126 Å²	126	125.9 Å²	125.9	66%	0.66	63%	0.629	S	S	*	*	H	α-helix	trans	-68.9	-25.9	176.7	-77.4	170.5	0	0	0	114.7	M87 I88	M87-L91 PolarHBondContact O-N 2.7Å; I88-L91 PolarHBondContact O-N 3.32Å
92	V	50.1	Low	52.3	Low	119 Å²	119	127.7 Å²	127.7	72%	0.721	64%	0.635	S	S	*	*	H	α-helix	trans	-75.2	-27.8	168.3	158.3	0	0	0	0	111.8	I88 F90	I88-V92 PolarHBondContact O-N 3.44Å; F90-V92 VanDerWaalsContact C-N 3.35Å; F90-V92 PolarHBondContact O-N 2.84Å
93	K	51.2	Low	51.2	Low	135 Å²	135	126.9 Å²	126.9	59%	0.587	65%	0.647	S	S	*	*	H	α-helix	trans	-93.2	-13.6	178.3	-70.6	-167.9	175.2	90.9	0	114.7	N89 F90 R95	N89-K93 WeakPolarHBondContact O-CG 3.19Å; N89-K93 PolarHBondContact O-N 3.5Å; N89-K93 PolarHBondContact OD1-NZ 3.23Å; F90-K93 CarbonylContact O-C 3.54Å; F90-K93 WeakPolarHBondContact O-CA 3.3Å; F90-K93 PolarHBondContact O-N 3.35Å; K93-R95 CarbonylContact O-C 3.36Å; K93-R95 PolarHBondContact O-N 3.32Å
94	D	47.8	Very low	50	Low	56 Å²	56	123.6 Å²	123.6	30%	0.299	64%	0.64	S	S	.	*			trans	-80.4	20.8	-177.4	-98.4	-14	0	0	0	114.9	F90 R96	F90-D94 VanDerWaalsContact CD1-CG 3.41Å; F90-D94 WeakPolarHBondContact CD1-OD2 3.2Å; F90-D94 WeakPolarHBondContact CE1-OD1 3.02Å; F90-D94 WeakPolarHBondContact CE1-OD2 3.44Å; F90-D94 WeakPolarHBondContact CZ-OD1 3.32Å; F90-D94 VanDerWaalsContact O-CB 3.22Å; F90-D94 WeakPolarHBondContact O-CB 3.25Å; F90-D94 PolarHBondContact O-N 2.78Å; D94-R96 PolarHBondContact O-N 3.29Å
95	R	50.6	Low	49.2	Very low	244 Å²	244	127.1 Å²	127.1	92%	0.921	66%	0.66	S	S	*	*	S	Bend	trans	-65.1	73.1	134.6	-72.6	-104.3	-165.7	159.5	4.4	108.5	K93	K93-R95 CarbonylContact O-C 3.36Å; K93-R95 PolarHBondContact O-N 3.32Å
96	R	49	Very low	48.2	Very low	222 Å²	222	127.6 Å²	127.6	84%	0.838	67%	0.672	S	S	*	*	S	Bend	trans	114	96.7	165.4	-156.6	176.8	-167.4	156.8	2.4	114.3	D94 S98	D94-R96 PolarHBondContact O-N 3.29Å; R96-S98 PolarHBondContact O-N 3.49Å
97	P	43	Very low	47.1	Very low	102 Å²	102	127.4 Å²	127.4	66%	0.662	67%	0.669	S	S	*	*			trans	-72	108.3	-177	29.6	-32.6	0	0	0	110.5
98	S	42.5	Very low	46.7	Very low	86 Å²	86	127.5 Å²	127.5	60%	0.601	68%	0.679	S	S	*	*			trans	-91.9	136.6	167.6	-171.3	0	0	0	0	109.3	R96 E100	R96-S98 PolarHBondContact O-N 3.49Å; S98-E100 PolarHBondContact O-N 3.38Å
99	K	44.9	Very low	45.8	Very low	200 Å²	200	136.5 Å²	136.5	87%	0.87	71%	0.708	S	S	*	*			trans	-65.2	105.3	-173.6	-58.9	156.5	78.9	88.5	0	110.4
100	E	40.2	Very low	45.3	Very low	175 Å²	175	139.2 Å²	139.2	82%	0.818	72%	0.721	S	S	*	*			trans	-151.4	102.4	153.4	16.6	-139.2	148	0	0	110.3	S98	S98-E100 PolarHBondContact O-N 3.38Å
101	V	42.5	Very low	45	Very low	127 Å²	127	141.1 Å²	141.1	77%	0.77	74%	0.735	S	S	*	*			trans	-66.4	126.6	178.8	86.4	0	0	0	0	107.6	A103	V101-A103 PolarHBondContact O-N 3.25Å
102	E	40.1	Very low	44.8	Very low	146 Å²	146	141.9 Å²	141.9	68%	0.682	74%	0.739	S	S	*	*				47.4	75.9	129.8	-159.7	177.1	-179.3	0	0	115.1	V104	E102-V104 HydrophobicContact CG-CB 3.93Å; E102-V104 HydrophobicContact CG-CG2 3.51Å; E102-V104 PolarHBondContact O-N 2.72Å; E102-V104 WeakPolarHBondContact OE1-CG2 3.11Å
103	A	48	Very low	44.5	Very low	110 Å²	110	143.2 Å²	143.2	91%	0.909	74%	0.74	S	S	*	*			trans	-65.7	71	148	0	0	0	0	0	108.1	V101 V105	V101-A103 PolarHBondContact O-N 3.25Å; A103-V105 PolarHBondContact O-N 3.43Å; A103-V105 VanDerWaalsContact O-N 3.13Å
104	V	46.1	Very low	44.1	Very low	90 Å²	90	143.8 Å²	143.8	55%	0.545	75%	0.75	S	S	.	*			trans	-57.5	112.3	161	132.6	0	0	0	0	105.8	E102 V106	E102-V104 HydrophobicContact CG-CB 3.93Å; E102-V104 HydrophobicContact CG-CG2 3.51Å; E102-V104 PolarHBondContact O-N 2.72Å; E102-V104 WeakPolarHBondContact OE1-CG2 3.11Å; V104-V106 PolarHBondContact O-N 3.31Å; V104-V106 VanDerWaalsContact O-N 3.13Å
105	V	47.3	Very low	43.8	Very low	114 Å²	114	149.6 Å²	149.6	69%	0.691	78%	0.78	S	S	*	*			trans	27.9	83.4	139.3	-177	0	0	0	0	112.4	A103 G107	A103-V105 PolarHBondContact O-N 3.43Å; A103-V105 VanDerWaalsContact O-N 3.13Å; V105-G107 PolarHBondContact O-N 2.98Å; V105-G107 VanDerWaalsContact O-N 3.09Å
106	V	40.6	Very low	43.3	Very low	146 Å²	146	142.9 Å²	142.9	89%	0.885	77%	0.77	S	S	*	*			trans	-64.8	109.2	162.3	177.6	0	0	0	0	106	V104	V104-V106 PolarHBondContact O-N 3.31Å; V104-V106 VanDerWaalsContact O-N 3.13Å
107	G	38.2	Very low	42.9	Very low	45 Å²	45	136.8 Å²	136.8	46%	0.464	77%	0.765	S	S	.	*			trans	-62.2	160.4	-179.6	0	0	0	0	0	112.8	V105	V105-G107 PolarHBondContact O-N 2.98Å; V105-G107 VanDerWaalsContact O-N 3.09Å
108	P	46.5	Very low	42.9	Very low	129 Å²	129	139.7 Å²	139.7	84%	0.838	77%	0.773	S	S	*	*			trans	-68.7	141.1	174.7	32.3	-31.7	0	0	0	109.3
109	Y	37.9	Very low	42.9	Very low	308 Å²	308	144.5 Å²	144.5	100%	1.208	79%	0.789	S	S	*	*			trans	-42.9	0	179.5	-63.2	-88.9	0	0	0	115.7

Retrieved 109 of 109 residues in 224 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).