RBX2_HUMAN Loading...

RING-box protein 2

Catalytic component of multiple cullin-5-RING E3 ubiquitin-protein ligase complexes (ECS complexes), which mediate the ubiquitination and subsequent proteasomal degradation of target proteins^1,2,3,4,5,6. It is thereby involved in various biological processes, such as cell cycle progression, signal transduction and transcription^7,8,9,10. The functional specificity of the E3 ubiquitin-protein ligase ECS complexes depend on the variable SOCS box-containing substrate recognition component^11,12. Within ECS complexes, RNF7/RBX2 recruits the E2 ubiquitination enzyme to the complex via its RING-type and brings it into close proximity to the substrate¹³. Catalytic subunit of various SOCS-containing ECS complexes, such as the ECS(SOCS7) complex, that regulate reelin signaling by mediating ubiquitination and degradation of DAB1 (By similarity). The ECS(SOCS2) complex mediates the ubiquitination and subsequent proteasomal degradation of phosphorylated EPOR and GHR^14,15. Promotes ubiquitination and degradation of NF1, thereby regulating Ras protein signal transduction (By similarity). As part of the ECS(ASB9) complex, catalyzes ubiquitination and degradation of CKB¹⁶. The ECS(SPSB3) complex catalyzes ubiquitination of nuclear CGAS¹⁷. As part of the ECS(RAB40C) complex, mediates ANKRD28 ubiquitination and degradation, thereby inhibiting protein phosphatase 6 (PP6) complex activity and focal adhesion assembly during cell migration¹⁸. The ECS(ASB7) complex acts a negative regulator of H3K9me3 histone mark by mediating ubiquitination and degradation of SUV39H1¹⁹. As part of some ECS complex, catalyzes 'Lys-11'-linked ubiquitination and degradation of BTRC²⁰. ECS complexes and ARIH2 collaborate in tandem to mediate ubiquitination of target proteins; ARIH2 mediating addition of the first ubiquitin on CRLs targets^21,22. Specifically catalyzes the neddylation of CUL5 via its interaction with UBE2F²³. Does not catalyze neddylation of other cullins (CUL1, CUL2, CUL3, CUL4A or CUL4B)²⁴. May play a role in protecting cells from apoptosis induced by redox agents²⁵. Inactive. (Microbial infection) Following infection by HIV-1 virus, catalytic component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex) hijacked by the HIV-1 Vif protein, which catalyzes ubiquitination and degradation of APOBEC3F and APOBEC3G.

AlphaFold DB , UniProt , Accession Q9UBF6, Species HUMAN (Homo sapiens, Human), Gene RNF7, Length 113 aa.

						>RBX2_HUMAN|Q9UBF6|RNF7
MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54	Low	60	Low	240 Å²	240	151 Å²	151	100%	1.182	85%	0.854	S	S	*	*				0	108	0	-76.7	161.9	170.7	0	0	105.5
2	A	65.6	Low	58.4	Low	95 Å²	95	146.9 Å²	146.9	79%	0.785	85%	0.854	S	S	*	*			trans	-119	109.5	175.5	0	0	0	0	0	105.9
3	D	57.9	Low	57.8	Low	158 Å²	158	148.3 Å²	148.3	85%	0.845	85%	0.854	S	S	*	*			trans	-76.1	119.6	172.8	-62.5	-82.8	0	0	0	107.8
4	V	73.7	Confident	57.3	Low	136 Å²	136	143.6 Å²	143.6	82%	0.824	84%	0.842	S	S	*	*			trans	-111.6	114.6	170.9	169.7	0	0	0	0	106.9
5	E	69.6	Low	56.4	Low	190 Å²	190	141.6 Å²	141.6	89%	0.888	84%	0.839	S	S	*	*			trans	-73.2	128.5	172.2	-68.6	175.3	87.2	0	0	109.5
6	D	61.9	Low	55.8	Low	133 Å²	133	144.8 Å²	144.8	71%	0.711	84%	0.842	S	S	*	*			trans	-80	113.3	-174.9	-171.3	-118.1	0	0	0	110.4
7	G	66	Low	55.2	Low	67 Å²	67	143.9 Å²	143.9	69%	0.691	85%	0.846	S	S	*	*			trans	-91.7	114.4	170.1	0	0	0	0	0	110.4	E9	G7-E9 PolarHBondContact O-N 3.31Å; G7-E9 VanDerWaalsContact O-N 3.12Å
8	E	57.4	Low	54.7	Low	182 Å²	182	140.1 Å²	140.1	85%	0.85	84%	0.842	S	S	*	*			trans	-72	90.8	179.2	38.1	170.2	70	0	0	112.5
9	E	57.2	Low	54.3	Low	191 Å²	191	138.4 Å²	138.4	89%	0.893	84%	0.837	S	S	*	*			trans	-102.4	113.9	164.3	-82.2	-172	75.6	0	0	111	G7	G7-E9 PolarHBondContact O-N 3.31Å; G7-E9 VanDerWaalsContact O-N 3.12Å
10	T	50.1	Low	53.8	Low	141 Å²	141	137.5 Å²	137.5	87%	0.865	84%	0.837	S	S	*	*			trans	-93.4	106.2	178.1	48.9	0	0	0	0	110.7	A12	T10-A12 PolarHBondContact O-N 2.86Å
11	C	46.2	Very low	53.6	Low	128 Å²	128	134.1 Å²	134.1	87%	0.865	83%	0.831	S	S	*	*			trans	-71.3	114.4	170.2	-84.9	0	0	0	0	111
12	A	40.8	Very low	53.3	Low	102 Å²	102	128 Å²	128	84%	0.843	81%	0.811	S	S	*	*			trans	-78	116.4	171.1	0	0	0	0	0	110.6	T10	T10-A12 PolarHBondContact O-N 2.86Å
13	L	51.7	Low	52.4	Low	165 Å²	165	134.1 Å²	134.1	86%	0.864	82%	0.82	S	S	*	*			trans	-112.1	111	168.5	-75.9	169.7	0	0	0	111
14	A	50.8	Low	52.3	Low	82 Å²	82	131.4 Å²	131.4	68%	0.678	81%	0.814	S	S	*	*			trans	46	91.2	143.9	0	0	0	0	0	119.7
15	S	42.8	Very low	51.5	Low	114 Å²	114	129 Å²	129	80%	0.797	82%	0.816	S	S	*	*				10.1	107.8	128.7	-46.6	0	0	0	0	119.1
16	H	47.6	Very low	51.2	Low	193 Å²	193	123 Å²	123	89%	0.894	81%	0.806	S	S	*	*			trans	-119.9	120.2	143.5	-87.2	-85.2	0	0	0	109.5
17	S	45.6	Very low	51.7	Low	130 Å²	130	124.3 Å²	124.3	91%	0.909	81%	0.813	S	S	*	*			trans	-68.9	125	-176.7	-42.1	0	0	0	0	111.9
18	G	46.2	Very low	52.3	Low	75 Å²	75	130.2 Å²	130.2	77%	0.773	82%	0.82	S	S	*	*			trans	-168.4	85.3	177.5	0	0	0	0	0	113.9
19	S	47.6	Very low	53.4	Low	107 Å²	107	129.3 Å²	129.3	75%	0.748	82%	0.817	S	S	*	*			trans	35.9	112	150.2	-148.1	0	0	0	0	121.5
20	S	43.4	Very low	54.9	Low	120 Å²	120	128.6 Å²	128.6	84%	0.839	81%	0.812	S	S	*	*				47.9	86.4	124.5	-31.2	0	0	0	0	118.6
21	G	48.7	Very low	56.7	Low	68 Å²	68	126 Å²	126	70%	0.701	80%	0.799	S	S	*	*			trans	-156.1	101.7	170.3	0	0	0	0	0	112.4
22	S	48.6	Very low	58.7	Low	111 Å²	111	126.5 Å²	126.5	78%	0.776	79%	0.792	S	S	*	*			trans	17.5	119.8	151.7	41.9	0	0	0	0	119.4	S24	S22-S24 PolarHBondContact O-N 2.77Å
23	K	46.4	Very low	61.2	Low	223 Å²	223	130.9 Å²	130.9	97%	0.97	79%	0.792	S	S	*	*			trans	-47.5	97	161.7	-64.3	170.1	175.8	173.9	0	111.8
24	S	56.8	Low	63.1	Low	102 Å²	102	130.6 Å²	130.6	71%	0.713	78%	0.784	S	S	*	*			trans	-121.1	125.7	158.8	52.8	0	0	0	0	106.8	S22 G26	S22-S24 PolarHBondContact O-N 2.77Å; S24-G26 VanDerWaalsContact C-N 3.33Å; S24-G26 PolarHBondContact O-N 3.33Å
25	G	56.9	Low	65.2	Low	85 Å²	85	135 Å²	135	88%	0.876	78%	0.783	S	S	*	*			trans	-52.8	93.6	-177.9	0	0	0	0	0	111.2	D27	G25-D27 PolarHBondContact O-N 3.1Å; G25-D27 VanDerWaalsContact O-N 3.15Å
26	G	63.3	Low	67.5	Low	65 Å²	65	135.5 Å²	135.5	67%	0.67	78%	0.777	S	S	*	*			trans	-81.4	90.4	174.7	0	0	0	0	0	107.4	S24 K28	S24-G26 VanDerWaalsContact C-N 3.33Å; S24-G26 PolarHBondContact O-N 3.33Å; G26-K28 PolarHBondContact O-N 3.47Å
27	D	72.5	Confident	69.7	Low	160 Å²	160	129.5 Å²	129.5	86%	0.856	76%	0.761	S	S	*	*			trans	-48.8	116.4	161.6	-86.5	-43.4	0	0	0	107.3	G25 M29	G25-D27 PolarHBondContact O-N 3.1Å; G25-D27 VanDerWaalsContact O-N 3.15Å; D27-M29 PolarHBondContact O-N 3.33Å
28	K	78.9	Confident	72	Confident	191 Å²	191	130.1 Å²	130.1	83%	0.83	76%	0.759	S	S	*	*			trans	-55.8	115.1	179.8	-68.5	179.5	179	177.4	0	107.6	G26 F30	G26-K28 PolarHBondContact O-N 3.47Å; K28-F30 PolarHBondContact O-N 2.95Å
29	M	80.5	Confident	74.3	Confident	163 Å²	163	131 Å²	131	80%	0.803	76%	0.758	S	S	*	*	S	Bend	trans	-55.9	-29.2	-170.9	-176.9	156.3	86.4	0	0	113.6	D27	D27-M29 PolarHBondContact O-N 3.33Å
30	F	87.8	Confident	76.3	Confident	176 Å²	176	134.9 Å²	134.9	77%	0.772	77%	0.767	S	S	*	*			trans	-132.7	131.6	173.5	-60.9	-71.5	0	0	0	110.1	K28	K28-F30 PolarHBondContact O-N 2.95Å
31	S	87.4	Confident	78.4	Confident	85 Å²	85	138.8 Å²	138.8	59%	0.594	76%	0.763	S	S	*	*			trans	-113.4	120.1	167.8	63	0	0	0	0	108.5	K33	S31-K33 PolarHBondContact O-N 3.34Å; S31-K33 VanDerWaalsContact O-N 3.16Å
32	L	89.1	Confident	79.7	Confident	139 Å²	139	140.5 Å²	140.5	73%	0.728	77%	0.765	S	S	*	*			trans	-65.4	113.1	168.5	-174.1	66.9	0	0	0	107.8	W35	L32-W35 HydrophobicContact CD1-CB 4.25Å; L32-W35 HydrophobicContact CD2-CB 4.09Å; L32-W35 HydrophobicContact CG-CB 4.42Å
33	K	91.8	Very high	80.8	Confident	194 Å²	194	142.9 Å²	142.9	84%	0.843	76%	0.757	S	S	*	*			trans	-88.6	-38.1	-178.9	-70.2	-174.8	176.2	-179.7	0	112.6	S31	S31-K33 PolarHBondContact O-N 3.34Å; S31-K33 VanDerWaalsContact O-N 3.16Å
34	K	92.9	Very high	82.1	Confident	160 Å²	160	140.3 Å²	140.3	70%	0.696	75%	0.754	S	S	*	*			trans	-158.9	135.1	-179.6	-171.9	173.3	-174.1	174.9	0	108.2	N36	K34-N36 VanDerWaalsContact CE-OD1 3.32Å; K34-N36 WeakPolarHBondContact CE-OD1 3.39Å
35	W	93.7	Very high	82.8	Confident	175 Å²	175	137.3 Å²	137.3	66%	0.663	73%	0.731	S	S	*	*			trans	-123.9	130.9	171.2	-173.8	31.6	0	0	0	108.3	L32 A37	L32-W35 HydrophobicContact CD1-CB 4.25Å; L32-W35 HydrophobicContact CD2-CB 4.09Å; L32-W35 HydrophobicContact CG-CB 4.42Å; W35-A37 HydrophobicContact CD2-CB 4.24Å; W35-A37 HydrophobicContact CH2-CB 4.25Å; W35-A37 HydrophobicContact CZ2-CB 3.81Å
36	N	92	Very high	83.5	Confident	123 Å²	123	140.7 Å²	140.7	66%	0.658	72%	0.724	S	S	*	*			trans	-116	91.5	169.6	-54	-77.5	0	0	0	106.3	K34	K34-N36 VanDerWaalsContact CE-OD1 3.32Å; K34-N36 WeakPolarHBondContact CE-OD1 3.39Å
37	A	93.1	Very high	83.9	Confident	67 Å²	67	140 Å²	140	55%	0.554	71%	0.708	S	S	*	*			trans	-73.5	135.2	176.9	0	0	0	0	0	109.8	W35	W35-A37 HydrophobicContact CD2-CB 4.24Å; W35-A37 HydrophobicContact CH2-CB 4.25Å; W35-A37 HydrophobicContact CZ2-CB 3.81Å
38	V	94.1	Very high	84.5	Confident	144 Å²	144	136.7 Å²	136.7	87%	0.873	69%	0.691	S	S	*	*			trans	-112.4	124.4	168.1	179.8	0	0	0	0	106.6
39	A	94	Very high	85.2	Confident	92 Å²	92	130.6 Å²	130.6	76%	0.76	67%	0.67	S	S	*	*			trans	-122.7	149.4	176.6	0	0	0	0	0	109.8
40	M	89.7	Confident	85.8	Confident	189 Å²	189	122.9 Å²	122.9	93%	0.931	63%	0.631	S	S	*	*			trans	-102.6	139.3	163.2	-61.9	-177	-64.3	0	0	107
41	W	87.7	Confident	86.1	Confident	202 Å²	202	115.7 Å²	115.7	77%	0.765	61%	0.605	S	S	*	*			trans	-108.1	148.7	171.8	65.2	-86.6	0	0	0	108.9	W43	W41-W43 HydrophobicContact CZ3-CD2 4.33Å; W41-W43 AromaticContact CZ3-CE2 3.93Å; W41-W43 HydrophobicContact CZ3-CZ2 4.17Å
42	S	76.2	Confident	86.4	Confident	104 Å²	104	114.3 Å²	114.3	73%	0.727	59%	0.59	S	S	*	*			trans	-133.2	164.7	166.2	61.4	0	0	0	0	107.9
43	W	71.3	Confident	86.7	Confident	161 Å²	161	108.6 Å²	108.6	61%	0.61	56%	0.562	S	S	*	*			trans	-65.3	136.9	166.5	-64.1	110.4	0	0	0	109.2	W41 V45	W41-W43 HydrophobicContact CZ3-CD2 4.33Å; W41-W43 AromaticContact CZ3-CE2 3.93Å; W41-W43 HydrophobicContact CZ3-CZ2 4.17Å; W43-V45 HydrophobicContact CB-CG2 3.96Å; W43-V45 PolarHBondContact O-N 3.32Å
44	D	74.4	Confident	86.8	Confident	169 Å²	169	108.8 Å²	108.8	90%	0.904	56%	0.557	S	S	*	*			trans	-79.4	75	171.9	-174.3	24.5	0	0	0	108.9
45	V	72.7	Confident	86.9	Confident	40 Å²	40	102.1 Å²	102.1	24%	0.242	53%	0.53	C	S	.	.			trans	-135	128.1	-178.8	-177.1	0	0	0	0	108	W43 C47 S83	W43-V45 HydrophobicContact CB-CG2 3.96Å; W43-V45 PolarHBondContact O-N 3.32Å; V45-C47 WeakPolarHBondContact CG1-O 3.39Å; V45-C47 PolarHBondContact O-N 2.96Å; V45-S83 WeakPolarHBondContact CG1-OG 3.39Å
46	E	70.6	Confident	86.9	Confident	156 Å²	156	99 Å²	99	73%	0.729	52%	0.523	S	S	*	.	S	Bend	trans	-65.4	-27.1	179.3	-67	-175.7	165.1	0	0	112.5	H82	E46-H82 IonicContact OE2-CD2 2.77Å; E46-H82 IonicContact OE2-NE2 3.35Å; E46-H82 PolarHBondContact OE2-NE2 3.27Å
47	C	72.6	Confident	86.9	Confident	50 Å²	50	93.6 Å²	93.6	34%	0.338	49%	0.494	S	S	.	.			trans	-144.1	106.7	-174	-74.3	0	0	0	0	112.4	V45 T49 S83	V45-C47 WeakPolarHBondContact CG1-O 3.39Å; V45-C47 PolarHBondContact O-N 2.96Å; C47-T49 PolarHBondContact O-N 3.46Å; C47-S83 PolarHBondContact O-OG 3.04Å
48	D	84.6	Confident	86.7	Confident	90 Å²	90	97 Å²	97	48%	0.481	50%	0.5	S	S	.	.	S	Bend	trans	-75.8	0.3	173.8	-62.2	-20.5	0	0	0	113.4	Q56 V57	D48-Q56 CarbonylContact O-C 3.51Å; D48-Q56 VanDerWaalsContact O-CA 3.23Å; D48-Q56 WeakPolarHBondContact O-CA 3.45Å; D48-V57 PolarHBondContact O-N 2.94Å
49	T	92.1	Very high	86.6	Confident	64 Å²	64	94 Å²	94	39%	0.393	48%	0.479	S	S	.	.	B	Isolated β-bridge	trans	-116.7	128.3	-178.8	-55.6	0	0	0	0	110.6	C47 A51	C47-T49 PolarHBondContact O-N 3.46Å; T49-A51 PolarHBondContact O-N 2.95Å; T49-A51 VanDerWaalsContact O-N 3.11Å
50	C	94.4	Very high	86.6	Confident	0 Å²	0	90.2 Å²	90.2	0%	0	45%	0.448	C	S	.	.			trans	-66.3	112.9	174.3	177.6	0	0	0	0	109.5	I52 C53 R54 V55 V57 H85	C50-I52 PolarHBondContact O-N 2.94Å; C50-C53 PolarHBondContact O-N 3.42Å; C50-R54 VanDerWaalsContact O-CA 3.28Å; C50-R54 WeakPolarHBondContact O-CA 3.36Å; C50-R54 PolarHBondContact O-N 2.84Å; C50-V55 PolarHBondContact N-O 2.97Å; C50-V57 HydrophobicContact CB-CG2 4.12Å; C50-H85 WeakPolarHBondContact CB-ND1 3.32Å
51	A	93.7	Very high	86.8	Confident	26 Å²	26	81.2 Å²	81.2	22%	0.215	40%	0.404	C	S	.	.	T	Hydrogen-bonded Turn	trans	-62.4	-19	-175.9	0	0	0	0	0	114.1	T49 R54 F84 L101	T49-A51 PolarHBondContact O-N 2.95Å; T49-A51 VanDerWaalsContact O-N 3.11Å; A51-R54 PolarHBondContact O-NE 3.02Å; A51-F84 HydrophobicContact CB-CE1 4Å; A51-L101 HydrophobicContact CB-CD2 3.97Å; A51-L101 HydrophobicContact CB-CG 4.37Å
52	I	94.5	Very high	87.2	Confident	55 Å²	55	76.4 Å²	76.4	28%	0.282	39%	0.393	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.6	-49.3	-179	-58.6	166.3	0	0	0	111.2	C50 F84 C88 M89 W92 P100	C50-I52 PolarHBondContact O-N 2.94Å; I52-F84 HydrophobicContact CD1-CD1 4Å; I52-F84 HydrophobicContact CD1-CG 4.47Å; I52-F84 HydrophobicContact CG1-CD1 4.18Å; I52-C88 HydrophobicContact CB-CB 3.92Å; I52-C88 HydrophobicContact CD1-CB 3.86Å; I52-C88 HydrophobicContact CG1-CB 4.49Å; I52-C88 HydrophobicContact CG2-CB 3.88Å; I52-M89 HydrophobicContact CD1-CE 4.1Å; I52-W92 HydrophobicContact CD1-CB 3.95Å; I52-W92 HydrophobicContact CD1-CG 4.26Å; I52-W92 HydrophobicContact CG1-CE3 4.38Å; I52-P100 HydrophobicContact CD1-CG 4.18Å; I52-P100 HydrophobicContact CG1-CG 4.05Å
53	C	95.2	Very high	88	Confident	19 Å²	19	78.1 Å²	78.1	13%	0.128	38%	0.383	C	S	.	.	T	Hydrogen-bonded Turn	trans	-106.7	-5.1	-176.6	70.4	0	0	0	0	114.6	C50 V55 L62 H85 C88	C50-C53 PolarHBondContact O-N 3.42Å; C53-V55 PolarHBondContact O-N 3.16Å; C53-L62 WeakPolarHBondContact O-CD1 3.46Å; C53-H85 PolarHBondContact SG-ND1 3.38Å; C53-C88 VanDerWaalsContact SG-SG 3.67Å
54	R	94.5	Very high	89.2	Confident	198 Å²	198	70.9 Å²	70.9	75%	0.747	36%	0.357	S	S	*	.			trans	60.6	21.7	179.4	-51	-64.7	-178.7	155.5	-0.1	115.1	C50 A51	C50-R54 VanDerWaalsContact O-CA 3.28Å; C50-R54 WeakPolarHBondContact O-CA 3.36Å; C50-R54 PolarHBondContact O-N 2.84Å; A51-R54 PolarHBondContact O-NE 3.02Å
55	V	94.7	Very high	90.1	Very high	21 Å²	21	66.9 Å²	66.9	13%	0.127	33%	0.333	C	S	.	.	S	Bend	trans	-103	152.3	173.4	177.3	0	0	0	0	109.1	C50 C53 V57 D59 L62	C50-V55 PolarHBondContact N-O 2.97Å; C53-V55 PolarHBondContact O-N 3.16Å; V55-V57 PolarHBondContact O-N 2.71Å; V55-D59 HydrophobicContact CG1-CB 3.84Å; V55-L62 HydrophobicContact CG2-CD1 4.38Å; V55-L62 HydrophobicContact CG2-CD2 3.81Å; V55-L62 HydrophobicContact CG2-CG 3.64Å
56	Q	93.3	Very high	91.1	Very high	110 Å²	110	69.3 Å²	69.3	51%	0.514	36%	0.357	S	S	.	.	B	Isolated β-bridge	trans	-57.9	137.6	175.6	-62.5	-163.7	-83.5	0	0	110.5	D48 M58 D59 H85	D48-Q56 CarbonylContact O-C 3.51Å; D48-Q56 VanDerWaalsContact O-CA 3.23Å; D48-Q56 WeakPolarHBondContact O-CA 3.45Å; Q56-M58 PolarHBondContact O-N 2.93Å; Q56-D59 PolarHBondContact O-N 2.87Å; Q56-H85 PolarHBondContact O-CE1 3.32Å; Q56-H85 PolarHBondContact O-NE2 3.4Å
57	V	91.7	Very high	92.3	Very high	9 Å²	9	66.6 Å²	66.6	6%	0.055	34%	0.344	C	S	.	.	T	Hydrogen-bonded Turn	trans	-64.1	-21.8	-176.3	179.2	0	0	0	0	111.9	D48 C50 V55 V75 H85	D48-V57 PolarHBondContact O-N 2.94Å; C50-V57 HydrophobicContact CB-CG2 4.12Å; V55-V57 PolarHBondContact O-N 2.71Å; V57-V75 HydrophobicContact CG1-CB 4.03Å; V57-V75 HydrophobicContact CG1-CG1 3.31Å; V57-V75 HydrophobicContact CG1-CG2 3.49Å; V57-V75 VanDerWaalsContact CG1-CG2 3.49Å; V57-V75 WeakPolarHBondContact O-CG2 3.14Å; V57-H85 WeakPolarHBondContact CA-NE2 3.3Å; V57-H85 PolarHBondContact O-NE2 3.33Å
58	M	88.6	Confident	93.1	Very high	139 Å²	139	70 Å²	70	69%	0.685	36%	0.359	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.2	-16	176.6	-60.1	-58.7	-69.3	0	0	113.6	Q56	Q56-M58 PolarHBondContact O-N 2.93Å
59	D	91.9	Very high	93.5	Very high	79 Å²	79	70.1 Å²	70.1	42%	0.422	36%	0.355	S	S	.	.	S	Bend	trans	-97.6	167.2	177.3	-69.3	-36.3	0	0	0	110.7	V55 Q56 H85	V55-D59 HydrophobicContact CG1-CB 3.84Å; Q56-D59 PolarHBondContact O-N 2.87Å; D59-H85 PolarHBondContact O-NE2 2.97Å
60	A	93.8	Very high	93.4	Very high	13 Å²	13	71 Å²	71	11%	0.107	36%	0.355	C	S	.	.	P	Polyproline II helix	trans	-68.7	142.2	169.6	0	0	0	0	0	111.3	C64 Q65 Q70 C73	A60-C64 HydrophobicContact CB-CB 4.21Å; A60-Q65 HydrophobicContact CB-CG 3.94Å; A60-Q65 WeakPolarHBondContact O-CG 3.26Å; A60-Q65 PolarHBondContact O-NE2 3.48Å; A60-Q70 HydrophobicContact CB-CB 3.58Å; A60-Q70 HydrophobicContact CB-CG 3.64Å; A60-C73 HydrophobicContact CB-CB 3.97Å
61	C	95.5	Very high	93.2	Very high	1 Å²	1	79.1 Å²	79.1	1%	0.007	39%	0.393	C	S	.	.	P	Polyproline II helix	trans	-65.1	158.9	175.2	79.3	0	0	0	0	112.1	R63 C64 Q65 C73 H85	C61-R63 PolarHBondContact O-N 3.21Å; C61-C64 PolarHBondContact O-N 3.1Å; C61-Q65 WeakPolarHBondContact O-CG 3.48Å; C61-Q65 PolarHBondContact O-N 3.46Å; C61-C73 PolarHBondContact N-SG 3.48Å; C61-H85 HydrophobicContact CB-CB 4.08Å; C61-H85 WeakPolarHBondContact CB-ND1 3.23Å
62	L	94.2	Very high	93	Very high	101 Å²	101	82.7 Å²	82.7	53%	0.529	41%	0.408	S	S	.	.	H	α-helix	trans	-50.8	-35.4	-178.9	-67.4	171.3	0	0	0	114	C53 V55 A66	C53-L62 WeakPolarHBondContact O-CD1 3.46Å; V55-L62 HydrophobicContact CG2-CD1 4.38Å; V55-L62 HydrophobicContact CG2-CD2 3.81Å; V55-L62 HydrophobicContact CG2-CG 3.64Å; L62-A66 WeakPolarHBondContact O-CB 3.16Å; L62-A66 PolarHBondContact O-N 2.91Å; L62-A66 VanDerWaalsContact O-N 3.09Å
63	R	94.4	Very high	92.9	Very high	139 Å²	139	80.8 Å²	80.8	53%	0.525	40%	0.4	S	S	.	.	H	α-helix	trans	-69.3	-47.4	178.4	-173.8	-173.1	-56.4	-88.8	-6.2	111.8	C61 Q65 A66 E67	C61-R63 PolarHBondContact O-N 3.21Å; R63-Q65 VanDerWaalsContact C-N 3.31Å; R63-A66 PolarHBondContact O-N 3.31Å; R63-E67 PolarHBondContact O-N 2.84Å
64	C	95	Very high	92.9	Very high	9 Å²	9	81.7 Å²	81.7	6%	0.061	41%	0.405	C	S	.	.	H	α-helix	trans	-67.8	-33.9	179	-69.6	0	0	0	0	111.8	A60 C61 N68 K69 C73	A60-C64 HydrophobicContact CB-CB 4.21Å; C61-C64 PolarHBondContact O-N 3.1Å; C64-N68 PolarHBondContact O-N 2.93Å; C64-N68 VanDerWaalsContact O-N 3.15Å; C64-K69 WeakPolarHBondContact CB-O 3.24Å; C64-K69 PolarHBondContact O-N 3.11Å; C64-C73 HydrophobicContact CB-CB 3.82Å
65	Q	93.8	Very high	92.8	Very high	85 Å²	85	73.1 Å²	73.1	40%	0.397	37%	0.374	S	S	.	.	H	α-helix	trans	-62	-45.2	171	-68.5	-177.5	11	0	0	111.5	A60 C61 R63 N68	A60-Q65 HydrophobicContact CB-CG 3.94Å; A60-Q65 WeakPolarHBondContact O-CG 3.26Å; A60-Q65 PolarHBondContact O-NE2 3.48Å; C61-Q65 WeakPolarHBondContact O-CG 3.48Å; C61-Q65 PolarHBondContact O-N 3.46Å; R63-Q65 VanDerWaalsContact C-N 3.31Å; Q65-N68 PolarHBondContact O-N 3.44Å
66	A	94.9	Very high	92.8	Very high	91 Å²	91	72.2 Å²	72.2	75%	0.752	37%	0.369	S	S	*	.	H	α-helix	trans	-68.2	-34.8	179.7	0	0	0	0	0	113.4	L62 R63 N68	L62-A66 WeakPolarHBondContact O-CB 3.16Å; L62-A66 PolarHBondContact O-N 2.91Å; L62-A66 VanDerWaalsContact O-N 3.09Å; R63-A66 PolarHBondContact O-N 3.31Å; A66-N68 VanDerWaalsContact C-N 3.33Å
67	E	94.2	Very high	92.8	Very high	100 Å²	100	69.2 Å²	69.2	47%	0.467	35%	0.353	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.7	-1.2	178.9	-70.2	-178.2	-151.5	0	0	114	R63 K69	R63-E67 PolarHBondContact O-N 2.84Å; E67-K69 VanDerWaalsContact C-N 3.28Å; E67-K69 HydrophobicContact CB-CD 4.31Å; E67-K69 HydrophobicContact CB-CG 4.28Å; E67-K69 PolarHBondContact O-N 3.09Å; E67-K69 IonicContact OE2-NZ 3.61Å; E67-K69 PolarHBondContact OE2-NZ 3.06Å
68	N	91.1	Very high	92.9	Very high	120 Å²	120	68.8 Å²	68.8	64%	0.642	35%	0.35	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.4	41.4	-172.8	-152.2	48.7	0	0	0	113.5	C64 Q65 A66 Q70	C64-N68 PolarHBondContact O-N 2.93Å; C64-N68 VanDerWaalsContact O-N 3.15Å; Q65-N68 PolarHBondContact O-N 3.44Å; A66-N68 VanDerWaalsContact C-N 3.33Å; N68-Q70 PolarHBondContact O-OE1 3.16Å; N68-Q70 PolarHBondContact OD1-NE2 3.3Å; N68-Q70 VanDerWaalsContact OD1-NE2 3.08Å; N68-Q70 PolarHBondContact OD1-OE1 2.88Å
69	K	91.6	Very high	93.2	Very high	93 Å²	93	68.1 Å²	68.1	40%	0.404	35%	0.346	S	S	.	.			trans	-121.4	45.1	176.8	-64.6	178.8	-171.9	156.1	0	110.8	C64 E67 E71 D72	C64-K69 WeakPolarHBondContact CB-O 3.24Å; C64-K69 PolarHBondContact O-N 3.11Å; E67-K69 VanDerWaalsContact C-N 3.28Å; E67-K69 HydrophobicContact CB-CD 4.31Å; E67-K69 HydrophobicContact CB-CG 4.28Å; E67-K69 PolarHBondContact O-N 3.09Å; E67-K69 IonicContact OE2-NZ 3.61Å; E67-K69 PolarHBondContact OE2-NZ 3.06Å; K69-E71 PolarHBondContact O-N 3.06Å; K69-D72 PolarHBondContact O-N 3.43Å
70	Q	90.9	Very high	93.3	Very high	82 Å²	82	65.7 Å²	65.7	38%	0.383	33%	0.334	S	S	.	.	G	3₁₀ helix	trans	-63.7	-32.6	-177.5	-60.6	87.5	-18.9	0	0	111.2	A60 N68 D72 C73	A60-Q70 HydrophobicContact CB-CB 3.58Å; A60-Q70 HydrophobicContact CB-CG 3.64Å; N68-Q70 PolarHBondContact O-OE1 3.16Å; N68-Q70 PolarHBondContact OD1-NE2 3.3Å; N68-Q70 VanDerWaalsContact OD1-NE2 3.08Å; N68-Q70 PolarHBondContact OD1-OE1 2.88Å; Q70-D72 VanDerWaalsContact C-N 3.29Å; Q70-D72 PolarHBondContact O-N 3.39Å; Q70-C73 WeakPolarHBondContact O-CB 3.26Å; Q70-C73 PolarHBondContact O-N 3.37Å
71	E	88.9	Confident	93.1	Very high	171 Å²	171	70 Å²	70	80%	0.799	36%	0.355	S	S	*	.	G	3₁₀ helix	trans	-64.6	-27	178.2	62.8	-164.1	144.7	0	0	114.2	K69 C73	K69-E71 PolarHBondContact O-N 3.06Å; E71-C73 VanDerWaalsContact C-N 3.34Å
72	D	90.5	Very high	92.9	Very high	101 Å²	101	70.9 Å²	70.9	54%	0.54	36%	0.36	S	S	.	.	G	3₁₀ helix	trans	-85.8	-8.6	178.3	-66.2	-37.4	0	0	0	112.9	K69 Q70 V74	K69-D72 PolarHBondContact O-N 3.43Å; Q70-D72 VanDerWaalsContact C-N 3.29Å; Q70-D72 PolarHBondContact O-N 3.39Å; D72-V74 VanDerWaalsContact C-N 3.35Å; D72-V74 PolarHBondContact O-N 2.88Å
73	C	93.4	Very high	92.9	Very high	16 Å²	16	66.3 Å²	66.3	11%	0.108	34%	0.336	C	S	.	.			trans	-83.3	77.6	-172.1	-168.8	0	0	0	0	111.9	A60 C61 C64 Q70 E71	A60-C73 HydrophobicContact CB-CB 3.97Å; C61-C73 PolarHBondContact N-SG 3.48Å; C64-C73 HydrophobicContact CB-CB 3.82Å; Q70-C73 WeakPolarHBondContact O-CB 3.26Å; Q70-C73 PolarHBondContact O-N 3.37Å; E71-C73 VanDerWaalsContact C-N 3.34Å
74	V	93.9	Very high	92.9	Very high	37 Å²	37	59.7 Å²	59.7	22%	0.224	31%	0.311	C	S	.	.			trans	-81.5	156.4	179.3	-64.7	0	0	0	0	113.6	D72 N86 I111 G112	D72-V74 VanDerWaalsContact C-N 3.35Å; D72-V74 PolarHBondContact O-N 2.88Å; V74-N86 HydrophobicContact CG2-CB 3.58Å; V74-N86 VanDerWaalsContact O-CB 3.3Å; V74-N86 WeakPolarHBondContact O-CB 3.42Å; V74-N86 PolarHBondContact O-N 3.2Å; V74-I111 HydrophobicContact CB-CG2 4.47Å; V74-I111 HydrophobicContact CG2-CG2 3.89Å; V74-G112 WeakPolarHBondContact CB-O 3.46Å; V74-G112 VanDerWaalsContact CG1-O 3.3Å; V74-G112 WeakPolarHBondContact CG1-O 3.32Å
75	V	93.5	Very high	92.9	Very high	19 Å²	19	59.2 Å²	59.2	12%	0.115	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	141.2	175	-177	0	0	0	0	110.4	V57 W77 G112	V57-V75 HydrophobicContact CG1-CB 4.03Å; V57-V75 HydrophobicContact CG1-CG1 3.31Å; V57-V75 HydrophobicContact CG1-CG2 3.49Å; V57-V75 VanDerWaalsContact CG1-CG2 3.49Å; V57-V75 WeakPolarHBondContact O-CG2 3.14Å; V75-W77 HydrophobicContact CB-CH2 3.66Å; V75-W77 HydrophobicContact CB-CZ2 4.07Å; V75-W77 HydrophobicContact CB-CZ3 3.91Å; V75-W77 HydrophobicContact CG1-CD2 4.04Å; V75-W77 HydrophobicContact CG1-CE3 4.05Å; V75-W77 HydrophobicContact CG1-CH2 3.61Å; V75-W77 HydrophobicContact CG1-CZ2 3.53Å; V75-W77 HydrophobicContact CG1-CZ3 3.88Å; V75-W77 WeakPolarHBondContact O-CZ3 3.3Å; V75-G112 PolarHBondContact O-N 3.16Å
76	V	94.4	Very high	93	Very high	1 Å²	1	57.4 Å²	57.4	1%	0.006	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	138.9	171.9	65.7	0	0	0	0	110	S83 F84 N86 M89 W106 V108 I111	V76-S83 WeakPolarHBondContact O-CA 3.43Å; V76-F84 HydrophobicContact CG1-CB 4.4Å; V76-F84 WeakPolarHBondContact CG1-O 3.46Å; V76-F84 PolarHBondContact N-O 3.11Å; V76-F84 PolarHBondContact O-N 2.82Å; V76-N86 HydrophobicContact CB-CB 4.26Å; V76-N86 HydrophobicContact CG1-CB 4.34Å; V76-M89 HydrophobicContact CG1-CB 3.85Å; V76-M89 HydrophobicContact CG1-CG 4.24Å; V76-W106 HydrophobicContact CG1-CZ2 4.04Å; V76-W106 HydrophobicContact CG2-CZ2 4.09Å; V76-V108 HydrophobicContact CG2-CB 4.48Å; V76-V108 HydrophobicContact CG2-CG1 3.71Å; V76-V108 HydrophobicContact CG2-CG2 4.09Å; V76-I111 HydrophobicContact CG2-CG1 3.99Å
77	W	93	Very high	93	Very high	47 Å²	47	54.5 Å²	54.5	18%	0.178	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	134.9	174.1	-62.4	-101.8	0	0	0	109.6	V75 Q109 R110	V75-W77 HydrophobicContact CB-CH2 3.66Å; V75-W77 HydrophobicContact CB-CZ2 4.07Å; V75-W77 HydrophobicContact CB-CZ3 3.91Å; V75-W77 HydrophobicContact CG1-CD2 4.04Å; V75-W77 HydrophobicContact CG1-CE3 4.05Å; V75-W77 HydrophobicContact CG1-CH2 3.61Å; V75-W77 HydrophobicContact CG1-CZ2 3.53Å; V75-W77 HydrophobicContact CG1-CZ3 3.88Å; V75-W77 WeakPolarHBondContact O-CZ3 3.3Å; W77-Q109 PolarHBondContact O-N 2.76Å; W77-R110 HydrophobicContact CB-CG 3.71Å; W77-R110 HydrophobicContact CD2-CG 3.96Å; W77-R110 VanDerWaalsContact CD2-NE 3.34Å; W77-R110 HydrophobicContact CE3-CG 3.65Å; W77-R110 HydrophobicContact CG-CG 4.01Å; W77-R110 HydrophobicContact CZ3-CG 4.48Å; W77-R110 PolarHBondContact N-O 3.05Å; W77-R110 PolarHBondContact O-N 2.99Å
78	G	93.8	Very high	93.1	Very high	0 Å²	0	50.3 Å²	50.3	0%	0	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.8	163.4	171.9	0	0	0	0	0	111.9	C80 N81 H82 W106 V107 Q109	G78-C80 PolarHBondContact O-N 3.47Å; G78-C80 VanDerWaalsContact O-N 3.11Å; G78-N81 WeakPolarHBondContact O-CA 3.21Å; G78-N81 PolarHBondContact O-N 2.83Å; G78-H82 PolarHBondContact N-O 2.97Å; G78-W106 VanDerWaalsContact CA-CH2 3.46Å; G78-V107 CarbonylContact C-O 3.51Å; G78-V107 WeakPolarHBondContact CA-O 3.23Å; G78-Q109 PolarHBondContact O-OE1 3.15Å
79	E	94.5	Very high	93.3	Very high	126 Å²	126	44.8 Å²	44.8	59%	0.589	23%	0.227	S	C	*	.	T	Hydrogen-bonded Turn	trans	-60	-19.7	173.1	-68.3	-172.8	161.7	0	0	113.1	N81 V107 Q109	E79-N81 PolarHBondContact O-N 3.01Å; E79-V107 HydrophobicContact CG-CB 4.02Å; E79-V107 HydrophobicContact CG-CG1 3.98Å; E79-V107 PolarHBondContact N-O 2.96Å; E79-Q109 HydrophobicContact CG-CB 4.15Å
80	C	93	Very high	93.5	Very high	27 Å²	27	43.1 Å²	43.1	18%	0.182	23%	0.227	C	C	.	.	T	Hydrogen-bonded Turn	trans	-78.7	11.5	170.7	61.6	0	0	0	0	113.9	G78 H82 C99	G78-C80 PolarHBondContact O-N 3.47Å; G78-C80 VanDerWaalsContact O-N 3.11Å; C80-H82 PolarHBondContact O-N 3.25Å; C80-H82 PolarHBondContact O-ND1 2.8Å; C80-H82 PolarHBondContact SG-ND1 3.44Å; C80-H82 VanDerWaalsContact SG-ND1 3.37Å; C80-C99 VanDerWaalsContact SG-SG 3.67Å
81	N	90.4	Very high	93.7	Very high	104 Å²	104	42.5 Å²	42.5	56%	0.556	23%	0.225	S	C	*	.	S	Bend	trans	59.6	7.3	-177	-67.3	-52.8	0	0	0	116.5	G78 E79	G78-N81 WeakPolarHBondContact O-CA 3.21Å; G78-N81 PolarHBondContact O-N 2.83Å; E79-N81 PolarHBondContact O-N 3.01Å
82	H	92.2	Very high	94	Very high	20 Å²	20	38.6 Å²	38.6	9%	0.093	20%	0.203	C	C	.	.			trans	-81	136.7	173.4	-65.2	116	0	0	0	112.2	E46 G78 C80 F84 C99 L101	E46-H82 IonicContact OE2-CD2 2.77Å; E46-H82 IonicContact OE2-NE2 3.35Å; E46-H82 PolarHBondContact OE2-NE2 3.27Å; G78-H82 PolarHBondContact N-O 2.97Å; C80-H82 PolarHBondContact O-N 3.25Å; C80-H82 PolarHBondContact O-ND1 2.8Å; C80-H82 PolarHBondContact SG-ND1 3.44Å; C80-H82 VanDerWaalsContact SG-ND1 3.37Å; H82-F84 HydrophobicContact CB-CE2 3.58Å; H82-F84 HydrophobicContact CB-CZ 4Å; H82-C99 PolarHBondContact ND1-SG 3.36Å; H82-L101 HydrophobicContact CB-CD1 4.08Å; H82-L101 WeakPolarHBondContact CD2-CD1 3.46Å
83	S	93.3	Very high	94.2	Very high	4 Å²	4	35.9 Å²	35.9	3%	0.028	19%	0.19	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-107	140	-179.8	54.1	0	0	0	0	113.1	V45 C47 V76	V45-S83 WeakPolarHBondContact CG1-OG 3.39Å; C47-S83 PolarHBondContact O-OG 3.04Å; V76-S83 WeakPolarHBondContact O-CA 3.43Å
84	F	95.1	Very high	94.4	Very high	0 Å²	0	43.1 Å²	43.1	0%	0	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-144.2	165.3	176.5	-55.5	-89.9	0	0	0	110.1	A51 I52 V76 H82 N86 M89 P100 L101 W106	A51-F84 HydrophobicContact CB-CE1 4Å; I52-F84 HydrophobicContact CD1-CD1 4Å; I52-F84 HydrophobicContact CD1-CG 4.47Å; I52-F84 HydrophobicContact CG1-CD1 4.18Å; V76-F84 HydrophobicContact CG1-CB 4.4Å; V76-F84 WeakPolarHBondContact CG1-O 3.46Å; V76-F84 PolarHBondContact N-O 3.11Å; V76-F84 PolarHBondContact O-N 2.82Å; H82-F84 HydrophobicContact CB-CE2 3.58Å; H82-F84 HydrophobicContact CB-CZ 4Å; F84-N86 PolarHBondContact O-N 3.15Å; F84-M89 HydrophobicContact CB-CB 4.24Å; F84-M89 HydrophobicContact CB-CE 3.96Å; F84-M89 HydrophobicContact CD1-CE 3.94Å; F84-M89 HydrophobicContact CD2-CE 3.07Å; F84-M89 HydrophobicContact CE1-CE 4.2Å; F84-M89 HydrophobicContact CE2-CE 3.39Å; F84-M89 HydrophobicContact CG-CE 3.37Å; F84-M89 HydrophobicContact CZ-CE 3.96Å; F84-P100 HydrophobicContact CE1-CB 4.26Å; F84-P100 HydrophobicContact CE1-CG 3.91Å; F84-P100 HydrophobicContact CZ-CB 4.37Å; F84-P100 HydrophobicContact CZ-CG 4.01Å; F84-L101 HydrophobicContact CE1-CD1 4.28Å; F84-L101 HydrophobicContact CE1-CG 4.4Å; F84-L101 HydrophobicContact CZ-CD1 3.88Å; F84-L101 HydrophobicContact CZ-CG 4.04Å; F84-W106 AromaticContact CD2-CH2 3.62Å; F84-W106 HydrophobicContact CD2-CH2 3.62Å; F84-W106 AromaticContact CD2-CZ3 3.83Å; F84-W106 HydrophobicContact CD2-CZ3 3.83Å; F84-W106 AromaticContact CE2-CH2 3.92Å; F84-W106 HydrophobicContact CE2-CH2 3.92Å; F84-W106 AromaticContact CE2-CZ3 3.61Å; F84-W106 HydrophobicContact CE2-CZ3 3.61Å
85	H	95.4	Very high	94.4	Very high	0 Å²	0	50 Å²	50	0%	0	25%	0.25	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-66.1	133.9	163.6	-57.8	119.5	0	0	0	109.7	C50 C53 Q56 V57 D59 C61 C87 C88 M89	C50-H85 WeakPolarHBondContact CB-ND1 3.32Å; C53-H85 PolarHBondContact SG-ND1 3.38Å; Q56-H85 PolarHBondContact O-CE1 3.32Å; Q56-H85 PolarHBondContact O-NE2 3.4Å; V57-H85 WeakPolarHBondContact CA-NE2 3.3Å; V57-H85 PolarHBondContact O-NE2 3.33Å; D59-H85 PolarHBondContact O-NE2 2.97Å; C61-H85 HydrophobicContact CB-CB 4.08Å; C61-H85 WeakPolarHBondContact CB-ND1 3.23Å; H85-C87 PolarHBondContact O-N 3.25Å; H85-C88 HydrophobicContact CB-CB 4.06Å; H85-C88 WeakPolarHBondContact O-CB 3.46Å; H85-C88 PolarHBondContact O-N 3Å; H85-M89 PolarHBondContact O-N 2.9Å
86	N	95.4	Very high	94.4	Very high	46 Å²	46	52.6 Å²	52.6	25%	0.246	26%	0.263	C	S	.	.	H	α-helix	trans	-56.3	-39.5	177	-179.6	72.2	0	0	0	111.5	V74 V76 F84 C88 M89 S90	V74-N86 HydrophobicContact CG2-CB 3.58Å; V74-N86 VanDerWaalsContact O-CB 3.3Å; V74-N86 WeakPolarHBondContact O-CB 3.42Å; V74-N86 PolarHBondContact O-N 3.2Å; V76-N86 HydrophobicContact CB-CB 4.26Å; V76-N86 HydrophobicContact CG1-CB 4.34Å; F84-N86 PolarHBondContact O-N 3.15Å; N86-C88 VanDerWaalsContact C-N 3.34Å; N86-C88 PolarHBondContact O-N 3Å; N86-M89 PolarHBondContact O-N 3.18Å; N86-S90 WeakPolarHBondContact O-CB 3.12Å; N86-S90 PolarHBondContact O-N 3.02Å; N86-S90 PolarHBondContact O-OG 2.84Å
87	C	95.3	Very high	94.4	Very high	31 Å²	31	56.5 Å²	56.5	21%	0.209	28%	0.284	C	S	.	.	H	α-helix	trans	-62.5	-39.1	176.1	-54.9	0	0	0	0	112.6	H85 L91	H85-C87 PolarHBondContact O-N 3.25Å; C87-L91 WeakPolarHBondContact O-CG 3.46Å
88	C	96	Very high	94.6	Very high	12 Å²	12	59.8 Å²	59.8	8%	0.081	30%	0.296	C	S	.	.	H	α-helix	trans	-71	-48.1	177.7	-66.3	0	0	0	0	111.2	I52 C53 H85 N86 L91 W92	I52-C88 HydrophobicContact CB-CB 3.92Å; I52-C88 HydrophobicContact CD1-CB 3.86Å; I52-C88 HydrophobicContact CG1-CB 4.49Å; I52-C88 HydrophobicContact CG2-CB 3.88Å; C53-C88 VanDerWaalsContact SG-SG 3.67Å; H85-C88 HydrophobicContact CB-CB 4.06Å; H85-C88 WeakPolarHBondContact O-CB 3.46Å; H85-C88 PolarHBondContact O-N 3Å; N86-C88 VanDerWaalsContact C-N 3.34Å; N86-C88 PolarHBondContact O-N 3Å; C88-L91 PolarHBondContact O-N 3.49Å; C88-W92 PolarHBondContact O-N 3.48Å; C88-W92 VanDerWaalsContact O-N 3.09Å
89	M	95.9	Very high	94.7	Very high	4 Å²	4	59.9 Å²	59.9	2%	0.02	30%	0.297	C	S	.	.	H	α-helix	trans	-67.1	-39.4	-178.3	-174.2	54.2	69.9	0	0	112.2	I52 V76 F84 H85 N86 L91 W92 V93 P100 W106	I52-M89 HydrophobicContact CD1-CE 4.1Å; V76-M89 HydrophobicContact CG1-CB 3.85Å; V76-M89 HydrophobicContact CG1-CG 4.24Å; F84-M89 HydrophobicContact CB-CB 4.24Å; F84-M89 HydrophobicContact CB-CE 3.96Å; F84-M89 HydrophobicContact CD1-CE 3.94Å; F84-M89 HydrophobicContact CD2-CE 3.07Å; F84-M89 HydrophobicContact CE1-CE 4.2Å; F84-M89 HydrophobicContact CE2-CE 3.39Å; F84-M89 HydrophobicContact CG-CE 3.37Å; F84-M89 HydrophobicContact CZ-CE 3.96Å; H85-M89 PolarHBondContact O-N 2.9Å; N86-M89 PolarHBondContact O-N 3.18Å; M89-L91 PolarHBondContact O-N 2.86Å; M89-W92 PolarHBondContact O-N 3.23Å; M89-W92 VanDerWaalsContact O-N 3.1Å; M89-W92 HydrophobicContact SD-CB 4.29Å; M89-W92 HydrophobicContact SD-CG 4.47Å; M89-V93 HydrophobicContact CG-CG2 4.1Å; M89-V93 WeakPolarHBondContact O-CG2 3.41Å; M89-V93 PolarHBondContact O-N 3.21Å; M89-V93 HydrophobicContact SD-CG2 3.74Å; M89-P100 HydrophobicContact CE-CG 4.22Å; M89-W106 HydrophobicContact CE-CD2 4.04Å; M89-W106 HydrophobicContact CE-CE3 3.94Å; M89-W106 HydrophobicContact CE-CH2 3.84Å; M89-W106 HydrophobicContact CE-CZ2 3.95Å; M89-W106 HydrophobicContact CE-CZ3 3.84Å; M89-W106 HydrophobicContact CG-CD2 4.17Å; M89-W106 VanDerWaalsContact CG-CE2 3.44Å; M89-W106 HydrophobicContact CG-CH2 4.37Å; M89-W106 HydrophobicContact CG-CZ2 3.57Å; M89-W106 HydrophobicContact SD-CD2 3.81Å; M89-W106 HydrophobicContact SD-CE3 4.29Å; M89-W106 HydrophobicContact SD-CG 4.14Å; M89-W106 HydrophobicContact SD-CZ2 4.14Å
90	S	94.4	Very high	94.7	Very high	57 Å²	57	55.8 Å²	55.8	40%	0.399	28%	0.281	S	S	.	.	H	α-helix	trans	-61.2	-28.1	177.6	-64.6	0	0	0	0	113.1	N86 K94	N86-S90 WeakPolarHBondContact O-CB 3.12Å; N86-S90 PolarHBondContact O-N 3.02Å; N86-S90 PolarHBondContact O-OG 2.84Å; S90-K94 WeakPolarHBondContact O-CG 3.42Å
91	L	94.8	Very high	94.6	Very high	69 Å²	69	57.6 Å²	57.6	36%	0.361	29%	0.289	S	S	.	.	H	α-helix	trans	-83.4	-37.6	173.9	-69.1	173.1	0	0	0	112.1	C87 C88 M89 K94	C87-L91 WeakPolarHBondContact O-CG 3.46Å; C88-L91 PolarHBondContact O-N 3.49Å; M89-L91 PolarHBondContact O-N 2.86Å; L91-K94 PolarHBondContact O-N 3Å
92	W	95.8	Very high	94.8	Very high	89 Å²	89	54.8 Å²	54.8	34%	0.337	28%	0.277	S	S	.	.	H	α-helix	trans	-62.9	-49	178.7	-178.7	-90	0	0	0	112.4	I52 C88 M89 K94 Q95 N96 R98 P100	I52-W92 HydrophobicContact CD1-CB 3.95Å; I52-W92 HydrophobicContact CD1-CG 4.26Å; I52-W92 HydrophobicContact CG1-CE3 4.38Å; C88-W92 PolarHBondContact O-N 3.48Å; C88-W92 VanDerWaalsContact O-N 3.09Å; M89-W92 PolarHBondContact O-N 3.23Å; M89-W92 VanDerWaalsContact O-N 3.1Å; M89-W92 HydrophobicContact SD-CB 4.29Å; M89-W92 HydrophobicContact SD-CG 4.47Å; W92-K94 PolarHBondContact O-N 3.22Å; W92-K94 VanDerWaalsContact O-N 3.1Å; W92-Q95 PolarHBondContact O-N 3.44Å; W92-N96 VanDerWaalsContact CD1-O 3.32Å; W92-N96 PolarHBondContact NE1-O 2.77Å; W92-N96 PolarHBondContact O-N 3.31Å; W92-R98 PolarHBondContact NE1-O 3.22Å; W92-P100 HydrophobicContact CD2-CG 4.06Å; W92-P100 HydrophobicContact CG-CG 4.32Å; W92-P100 HydrophobicContact CZ2-CB 4.16Å; W92-P100 HydrophobicContact CZ2-CG 4.04Å
93	V	96	Very high	94.9	Very high	44 Å²	44	61 Å²	61	27%	0.267	31%	0.306	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.6	-26.5	-178.5	164.6	0	0	0	0	112.8	M89 Q95 N96 N97 W106	M89-V93 HydrophobicContact CG-CG2 4.1Å; M89-V93 WeakPolarHBondContact O-CG2 3.41Å; M89-V93 PolarHBondContact O-N 3.21Å; M89-V93 HydrophobicContact SD-CG2 3.74Å; V93-Q95 PolarHBondContact O-N 3.33Å; V93-N96 WeakPolarHBondContact CA-O 3.44Å; V93-N97 VanDerWaalsContact CG1-OD1 3.26Å; V93-N97 WeakPolarHBondContact CG1-OD1 3.37Å; V93-W106 HydrophobicContact CG2-CB 4.37Å; V93-W106 VanDerWaalsContact CG2-CD1 3.46Å; V93-W106 HydrophobicContact CG2-CG 3.99Å
94	K	95.7	Very high	95	Very high	168 Å²	168	66.2 Å²	66.2	73%	0.73	33%	0.33	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.8	-27.2	175.1	-68	177.5	-178.2	-177.9	0	113.3	S90 L91 W92	S90-K94 WeakPolarHBondContact O-CG 3.42Å; L91-K94 PolarHBondContact O-N 3Å; W92-K94 PolarHBondContact O-N 3.22Å; W92-K94 VanDerWaalsContact O-N 3.1Å
95	Q	94.6	Very high	95.1	Very high	182 Å²	182	71 Å²	71	85%	0.85	36%	0.355	S	S	*	.	T	Hydrogen-bonded Turn	trans	-103.9	-37.5	179.4	-64.7	-178.3	7.8	0	0	112	W92 V93	W92-Q95 PolarHBondContact O-N 3.44Å; V93-Q95 PolarHBondContact O-N 3.33Å
96	N	94.4	Very high	95.1	Very high	73 Å²	73	71.8 Å²	71.8	39%	0.39	36%	0.358	S	S	.	.			trans	-146.1	113.2	-178.4	-170.6	-11.1	0	0	0	110.2	W92 V93 R98	W92-N96 VanDerWaalsContact CD1-O 3.32Å; W92-N96 PolarHBondContact NE1-O 2.77Å; W92-N96 PolarHBondContact O-N 3.31Å; V93-N96 WeakPolarHBondContact CA-O 3.44Å; N96-R98 PolarHBondContact O-N 2.94Å; N96-R98 WeakPolarHBondContact OD1-CB 3.43Å; N96-R98 WeakPolarHBondContact OD1-CG 3.42Å; N96-R98 PolarHBondContact OD1-N 3.29Å
97	N	94.6	Very high	95.1	Very high	84 Å²	84	72.7 Å²	72.7	45%	0.449	37%	0.365	S	S	.	.			trans	-79.4	34.5	-179.6	-164.4	53.5	0	0	0	113.1	V93 W106	V93-N97 VanDerWaalsContact CG1-OD1 3.26Å; V93-N97 WeakPolarHBondContact CG1-OD1 3.37Å; N97-W106 PolarHBondContact O-N 3.38Å
98	R	96.7	Very high	95.1	Very high	116 Å²	116	74.6 Å²	74.6	44%	0.438	38%	0.376	S	S	.	.	B	Isolated β-bridge	trans	-122.1	146.5	179.5	-64	-179.5	-178	-66.6	-10.2	110.5	W92 N96 Q103 Q104 D105	W92-R98 PolarHBondContact NE1-O 3.22Å; N96-R98 PolarHBondContact O-N 2.94Å; N96-R98 WeakPolarHBondContact OD1-CB 3.43Å; N96-R98 WeakPolarHBondContact OD1-CG 3.42Å; N96-R98 PolarHBondContact OD1-N 3.29Å; R98-Q103 WeakPolarHBondContact CD-O 3.28Å; R98-Q103 PolarHBondContact NH1-O 3.4Å; R98-Q104 CarbonylContact C-O 3.52Å; R98-Q104 VanDerWaalsContact CA-O 3.24Å; R98-Q104 WeakPolarHBondContact CA-O 3.48Å; R98-D105 IonicContact CZ-OD1 3.39Å; R98-D105 IonicContact NH1-OD1 3.84Å; R98-D105 PolarHBondContact NH1-OD1 3.17Å; R98-D105 IonicContact NH2-OD1 2.88Å
99	C	95.2	Very high	95	Very high	2 Å²	2	78.8 Å²	78.8	1%	0.014	39%	0.394	C	S	.	.			trans	-60.3	129.5	174.1	-177.3	0	0	0	0	110.7	C80 H82 L101 C102 Q103 Q104 W106	C80-C99 VanDerWaalsContact SG-SG 3.67Å; H82-C99 PolarHBondContact ND1-SG 3.36Å; C99-L101 PolarHBondContact O-N 3.08Å; C99-L101 VanDerWaalsContact O-N 3.16Å; C99-C102 VanDerWaalsContact CB-SG 3.52Å; C99-Q103 VanDerWaalsContact O-CA 3.26Å; C99-Q103 WeakPolarHBondContact O-CA 3.45Å; C99-Q103 PolarHBondContact O-N 3.48Å; C99-Q104 PolarHBondContact N-O 3.09Å; C99-W106 HydrophobicContact CB-CE3 4.06Å
100	P	93.9	Very high	94.8	Very high	39 Å²	39	85.2 Å²	85.2	25%	0.253	42%	0.418	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.4	-23.1	176.9	-23.4	30.2	0	0	0	115.2	I52 F84 M89 W92	I52-P100 HydrophobicContact CD1-CG 4.18Å; I52-P100 HydrophobicContact CG1-CG 4.05Å; F84-P100 HydrophobicContact CE1-CB 4.26Å; F84-P100 HydrophobicContact CE1-CG 3.91Å; F84-P100 HydrophobicContact CZ-CB 4.37Å; F84-P100 HydrophobicContact CZ-CG 4.01Å; M89-P100 HydrophobicContact CE-CG 4.22Å; W92-P100 HydrophobicContact CD2-CG 4.06Å; W92-P100 HydrophobicContact CG-CG 4.32Å; W92-P100 HydrophobicContact CZ2-CB 4.16Å; W92-P100 HydrophobicContact CZ2-CG 4.04Å
101	L	92.8	Very high	94.7	Very high	66 Å²	66	87 Å²	87	35%	0.346	42%	0.423	S	S	.	.	T	Hydrogen-bonded Turn	trans	-94.8	-56	-175.2	-66.8	172.9	0	0	0	112.1	A51 H82 F84 C99	A51-L101 HydrophobicContact CB-CD2 3.97Å; A51-L101 HydrophobicContact CB-CG 4.37Å; H82-L101 HydrophobicContact CB-CD1 4.08Å; H82-L101 WeakPolarHBondContact CD2-CD1 3.46Å; F84-L101 HydrophobicContact CE1-CD1 4.28Å; F84-L101 HydrophobicContact CE1-CG 4.4Å; F84-L101 HydrophobicContact CZ-CD1 3.88Å; F84-L101 HydrophobicContact CZ-CG 4.04Å; C99-L101 PolarHBondContact O-N 3.08Å; C99-L101 VanDerWaalsContact O-N 3.16Å
102	C	94	Very high	94.1	Very high	45 Å²	45	84.7 Å²	84.7	30%	0.304	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-98.7	-6.1	-177.4	63.1	0	0	0	0	115.7	C99 Q104	C99-C102 VanDerWaalsContact CB-SG 3.52Å; C102-Q104 HydrophobicContact CB-CG 4.39Å; C102-Q104 PolarHBondContact O-N 2.91Å; C102-Q104 PolarHBondContact SG-OE1 3.02Å; C102-Q104 VanDerWaalsContact SG-OE1 3.42Å
103	Q	94.7	Very high	92.8	Very high	149 Å²	149	93.1 Å²	93.1	70%	0.696	46%	0.455	S	S	*	.			trans	61	7.1	-178	-53	179.1	41.9	0	0	116	R98 C99	R98-Q103 WeakPolarHBondContact CD-O 3.28Å; R98-Q103 PolarHBondContact NH1-O 3.4Å; C99-Q103 VanDerWaalsContact O-CA 3.26Å; C99-Q103 WeakPolarHBondContact O-CA 3.45Å; C99-Q103 PolarHBondContact O-N 3.48Å
104	Q	94.5	Very high	92.6	Very high	114 Å²	114	95.6 Å²	95.6	53%	0.533	46%	0.464	S	S	.	.	S	Bend	trans	-69.6	157.2	169.8	-66.2	172.8	-29.2	0	0	110.9	R98 C99 C102 W106	R98-Q104 CarbonylContact C-O 3.52Å; R98-Q104 VanDerWaalsContact CA-O 3.24Å; R98-Q104 WeakPolarHBondContact CA-O 3.48Å; C99-Q104 PolarHBondContact N-O 3.09Å; C102-Q104 HydrophobicContact CB-CG 4.39Å; C102-Q104 PolarHBondContact O-N 2.91Å; C102-Q104 PolarHBondContact SG-OE1 3.02Å; C102-Q104 VanDerWaalsContact SG-OE1 3.42Å; Q104-W106 PolarHBondContact O-N 2.76Å
105	D	96.2	Very high	92.5	Very high	101 Å²	101	91.8 Å²	91.8	54%	0.54	45%	0.45	S	S	.	.	B	Isolated β-bridge	trans	-59.1	130	176.7	-63.4	-27.5	0	0	0	109.9	R98 V107	R98-D105 IonicContact CZ-OD1 3.39Å; R98-D105 IonicContact NH1-OD1 3.84Å; R98-D105 PolarHBondContact NH1-OD1 3.17Å; R98-D105 IonicContact NH2-OD1 2.88Å; D105-V107 PolarHBondContact O-N 3.12Å
106	W	96.3	Very high	92.3	Very high	17 Å²	17	86.8 Å²	86.8	6%	0.064	43%	0.428	C	S	.	.	P	Polyproline II helix	trans	-78	116.1	-174.6	178.4	-98.9	0	0	0	110.5	V76 G78 F84 M89 V93 N97 C99 Q104	V76-W106 HydrophobicContact CG1-CZ2 4.04Å; V76-W106 HydrophobicContact CG2-CZ2 4.09Å; G78-W106 VanDerWaalsContact CA-CH2 3.46Å; F84-W106 AromaticContact CD2-CH2 3.62Å; F84-W106 HydrophobicContact CD2-CH2 3.62Å; F84-W106 AromaticContact CD2-CZ3 3.83Å; F84-W106 HydrophobicContact CD2-CZ3 3.83Å; F84-W106 AromaticContact CE2-CH2 3.92Å; F84-W106 HydrophobicContact CE2-CH2 3.92Å; F84-W106 AromaticContact CE2-CZ3 3.61Å; F84-W106 HydrophobicContact CE2-CZ3 3.61Å; M89-W106 HydrophobicContact CE-CD2 4.04Å; M89-W106 HydrophobicContact CE-CE3 3.94Å; M89-W106 HydrophobicContact CE-CH2 3.84Å; M89-W106 HydrophobicContact CE-CZ2 3.95Å; M89-W106 HydrophobicContact CE-CZ3 3.84Å; M89-W106 HydrophobicContact CG-CD2 4.17Å; M89-W106 VanDerWaalsContact CG-CE2 3.44Å; M89-W106 HydrophobicContact CG-CH2 4.37Å; M89-W106 HydrophobicContact CG-CZ2 3.57Å; M89-W106 HydrophobicContact SD-CD2 3.81Å; M89-W106 HydrophobicContact SD-CE3 4.29Å; M89-W106 HydrophobicContact SD-CG 4.14Å; M89-W106 HydrophobicContact SD-CZ2 4.14Å; V93-W106 HydrophobicContact CG2-CB 4.37Å; V93-W106 VanDerWaalsContact CG2-CD1 3.46Å; V93-W106 HydrophobicContact CG2-CG 3.99Å; N97-W106 PolarHBondContact O-N 3.38Å; C99-W106 HydrophobicContact CB-CE3 4.06Å; Q104-W106 PolarHBondContact O-N 2.76Å
107	V	95.9	Very high	92.2	Very high	64 Å²	64	87.6 Å²	87.6	39%	0.388	43%	0.43	S	S	.	.			trans	-125.8	128.5	173.8	-175.9	0	0	0	0	108.2	G78 E79 D105 Q109	G78-V107 CarbonylContact C-O 3.51Å; G78-V107 WeakPolarHBondContact CA-O 3.23Å; E79-V107 HydrophobicContact CG-CB 4.02Å; E79-V107 HydrophobicContact CG-CG1 3.98Å; E79-V107 PolarHBondContact N-O 2.96Å; D105-V107 PolarHBondContact O-N 3.12Å; V107-Q109 PolarHBondContact O-N 3.05Å
108	V	95.1	Very high	92.1	Very high	72 Å²	72	87.8 Å²	87.8	44%	0.436	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.9	122	-178.6	176.6	0	0	0	0	109.6	V76 I111	V76-V108 HydrophobicContact CG2-CB 4.48Å; V76-V108 HydrophobicContact CG2-CG1 3.71Å; V76-V108 HydrophobicContact CG2-CG2 4.09Å; V108-I111 HydrophobicContact CG1-CD1 4.3Å; V108-I111 HydrophobicContact CG1-CG1 3.89Å
109	Q	93.2	Very high	91.8	Very high	100 Å²	100	85.9 Å²	85.9	47%	0.467	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.6	-46.1	174.8	-176.1	-177.6	-2.7	0	0	111.6	W77 G78 E79 V107	W77-Q109 PolarHBondContact O-N 2.76Å; G78-Q109 PolarHBondContact O-OE1 3.15Å; E79-Q109 HydrophobicContact CG-CB 4.15Å; V107-Q109 PolarHBondContact O-N 3.05Å
110	R	92.2	Very high	91.5	Very high	138 Å²	138	91.9 Å²	91.9	52%	0.521	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.7	152.9	-179.3	57.5	175.3	-167.8	-159.1	1.1	111.7	W77	W77-R110 HydrophobicContact CB-CG 3.71Å; W77-R110 HydrophobicContact CD2-CG 3.96Å; W77-R110 VanDerWaalsContact CD2-NE 3.34Å; W77-R110 HydrophobicContact CE3-CG 3.65Å; W77-R110 HydrophobicContact CG-CG 4.01Å; W77-R110 HydrophobicContact CZ3-CG 4.48Å; W77-R110 PolarHBondContact N-O 3.05Å; W77-R110 PolarHBondContact O-N 2.99Å
111	I	92.6	Very high	91.3	Very high	95 Å²	95	96 Å²	96	49%	0.487	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	131.4	174.2	-59.1	169.9	0	0	0	107.6	V74 V76 V108	V74-I111 HydrophobicContact CB-CG2 4.47Å; V74-I111 HydrophobicContact CG2-CG2 3.89Å; V76-I111 HydrophobicContact CG2-CG1 3.99Å; V108-I111 HydrophobicContact CG1-CD1 4.3Å; V108-I111 HydrophobicContact CG1-CG1 3.89Å
112	G	82.2	Confident	91.2	Very high	21 Å²	21	98.5 Å²	98.5	22%	0.216	48%	0.484	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.1	110.1	-170.8	0	0	0	0	0	109.9	V74 V75	V74-G112 WeakPolarHBondContact CB-O 3.46Å; V74-G112 VanDerWaalsContact CG1-O 3.3Å; V74-G112 WeakPolarHBondContact CG1-O 3.32Å; V75-G112 PolarHBondContact O-N 3.16Å
113	K	67.7	Low	91	Very high	266 Å²	266	103.4 Å²	103.4	100%	1.157	50%	0.501	S	S	*	.			trans	-98.1	0	165.4	-72.9	-175.1	177.7	178.3	0	109.3

Retrieved 113 of 113 residues in 253.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).