X2JCX4_DROME Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession X2JCX4, Species DROME (Drosophila melanogaster, Fruit fly), Gene Dmel\CG45089, Length 54 aa.

						>X2JCX4_DROME|X2JCX4|Dmel\CG45089
MGSGIVVQLARKYGAVIFFPTVAVGSIYADWSHTRQWKRQQLQLAHRAQLKDQR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.2	Low	74	Confident	232 Å²	232	110.3 Å²	110.3	100%	1.143	62%	0.618	S	S	*	*				0	12.6	0	-62.8	178.7	178.6	0	0	113.9
2	G	64.5	Low	74.6	Confident	50 Å²	50	114.1 Å²	114.1	52%	0.515	62%	0.623	S	S	.	*			trans	-92	-30.9	-179.4	0	0	0	0	0	115.5	G4 I5	G2-G4 PolarHBondContact O-N 3.06Å; G2-I5 PolarHBondContact O-N 3.48Å
3	S	68.8	Low	75.1	Confident	97 Å²	97	113.5 Å²	113.5	68%	0.678	61%	0.608	S	S	*	*	H	α-helix	trans	-67.7	-32.5	-174.9	65.3	0	0	0	0	113.5	I5 V6 V7	S3-I5 PolarHBondContact O-N 3.42Å; S3-V6 PolarHBondContact O-N 3.4Å; S3-V7 WeakPolarHBondContact O-CG2 3.44Å; S3-V7 PolarHBondContact O-N 3.17Å; S3-V7 VanDerWaalsContact O-N 3.08Å
4	G	75.3	Confident	74.9	Confident	44 Å²	44	107.1 Å²	107.1	45%	0.454	58%	0.581	S	S	.	*	H	α-helix	trans	-64.1	-39.9	179.5	0	0	0	0	0	113.4	G2 V7 Q8	G2-G4 PolarHBondContact O-N 3.06Å; G4-V7 PolarHBondContact O-N 2.87Å; G4-Q8 WeakPolarHBondContact O-CB 3.42Å; G4-Q8 PolarHBondContact O-N 3.5Å
5	I	77.8	Confident	75	Confident	106 Å²	106	106.1 Å²	106.1	54%	0.544	59%	0.593	S	S	.	*	H	α-helix	trans	-67.8	-42.8	-179.9	-61.9	170.7	0	0	0	110.3	G2 S3 Q8 L9	G2-I5 PolarHBondContact O-N 3.48Å; S3-I5 PolarHBondContact O-N 3.42Å; I5-Q8 PolarHBondContact O-N 3.45Å; I5-L9 HydrophobicContact CG2-CD1 3.81Å; I5-L9 HydrophobicContact CG2-CG 4.48Å; I5-L9 WeakPolarHBondContact O-CB 3.36Å; I5-L9 WeakPolarHBondContact O-CG 3.28Å; I5-L9 PolarHBondContact O-N 3.43Å
6	V	76.4	Confident	75.2	Confident	98 Å²	98	105.6 Å²	105.6	59%	0.594	59%	0.594	S	S	*	*	H	α-helix	trans	-62.4	-45.8	177.3	177.9	0	0	0	0	110.9	S3 Q8 L9 A10	S3-V6 PolarHBondContact O-N 3.4Å; V6-Q8 VanDerWaalsContact C-N 3.35Å; V6-Q8 PolarHBondContact O-N 3.33Å; V6-L9 PolarHBondContact O-N 2.93Å; V6-A10 VanDerWaalsContact O-CB 3.29Å; V6-A10 WeakPolarHBondContact O-CB 3.44Å; V6-A10 PolarHBondContact O-N 3.34Å
7	V	79	Confident	75.5	Confident	87 Å²	87	104.4 Å²	104.4	53%	0.527	58%	0.584	S	S	.	*	H	α-helix	trans	-64.3	-39.7	178.1	173.1	0	0	0	0	111.4	S3 G4 A10 R11	S3-V7 WeakPolarHBondContact O-CG2 3.44Å; S3-V7 PolarHBondContact O-N 3.17Å; S3-V7 VanDerWaalsContact O-N 3.08Å; G4-V7 PolarHBondContact O-N 2.87Å; V7-A10 PolarHBondContact O-N 3.16Å; V7-R11 WeakPolarHBondContact O-CG 3.33Å; V7-R11 PolarHBondContact O-N 3.44Å
8	Q	79.5	Confident	75.9	Confident	144 Å²	144	106.6 Å²	106.6	67%	0.673	59%	0.587	S	S	*	*	H	α-helix	trans	-68.5	-40.1	178.7	-167.4	174.8	-8.3	0	0	112.2	G4 I5 V6 R11 K12	G4-Q8 WeakPolarHBondContact O-CB 3.42Å; G4-Q8 PolarHBondContact O-N 3.5Å; I5-Q8 PolarHBondContact O-N 3.45Å; V6-Q8 VanDerWaalsContact C-N 3.35Å; V6-Q8 PolarHBondContact O-N 3.33Å; Q8-R11 PolarHBondContact O-N 3.03Å; Q8-K12 WeakPolarHBondContact O-CB 3.34Å; Q8-K12 PolarHBondContact O-N 3.41Å
9	L	79.7	Confident	76.4	Confident	91 Å²	91	109.1 Å²	109.1	48%	0.476	59%	0.592	S	S	.	*	H	α-helix	trans	-64.1	-44.8	172.5	-77.3	163.6	0	0	0	111.4	I5 V6 R11 K12 Y13	I5-L9 HydrophobicContact CG2-CD1 3.81Å; I5-L9 HydrophobicContact CG2-CG 4.48Å; I5-L9 WeakPolarHBondContact O-CB 3.36Å; I5-L9 WeakPolarHBondContact O-CG 3.28Å; I5-L9 PolarHBondContact O-N 3.43Å; V6-L9 PolarHBondContact O-N 2.93Å; L9-R11 VanDerWaalsContact C-N 3.28Å; L9-R11 PolarHBondContact O-N 2.8Å; L9-K12 PolarHBondContact O-N 3.31Å; L9-Y13 HydrophobicContact CD2-CD2 3.88Å; L9-Y13 HydrophobicContact CD2-CE2 3.8Å; L9-Y13 WeakPolarHBondContact O-CB 3.4Å; L9-Y13 PolarHBondContact O-N 3.16Å
10	A	76.7	Confident	77	Confident	45 Å²	45	106.9 Å²	106.9	37%	0.372	58%	0.583	S	S	.	*	H	α-helix	trans	-62.8	-33.7	176.5	0	0	0	0	0	112.2	V6 V7 G14	V6-A10 VanDerWaalsContact O-CB 3.29Å; V6-A10 WeakPolarHBondContact O-CB 3.44Å; V6-A10 PolarHBondContact O-N 3.34Å; V7-A10 PolarHBondContact O-N 3.16Å; A10-G14 WeakPolarHBondContact O-CA 3.49Å; A10-G14 PolarHBondContact O-N 3.31Å
11	R	79.3	Confident	77.6	Confident	219 Å²	219	106.2 Å²	106.2	83%	0.826	58%	0.582	S	S	*	*	H	α-helix	trans	-73.1	-40.4	173.7	-73.4	179.9	70.9	-177.3	2.5	112.6	V7 Q8 L9	V7-R11 WeakPolarHBondContact O-CG 3.33Å; V7-R11 PolarHBondContact O-N 3.44Å; Q8-R11 PolarHBondContact O-N 3.03Å; L9-R11 VanDerWaalsContact C-N 3.28Å; L9-R11 PolarHBondContact O-N 2.8Å
12	K	81.1	Confident	79.2	Confident	156 Å²	156	98.4 Å²	98.4	68%	0.678	55%	0.547	S	S	*	.	H	α-helix	trans	-74.3	-38.3	-177.8	-172.3	172.2	-179.1	179	0	112.7	Q8 L9	Q8-K12 WeakPolarHBondContact O-CB 3.34Å; Q8-K12 PolarHBondContact O-N 3.41Å; L9-K12 PolarHBondContact O-N 3.31Å
13	Y	81.4	Confident	80.5	Confident	107 Å²	107	97.5 Å²	97.5	42%	0.42	54%	0.535	S	S	.	.	H	α-helix	trans	-114.1	7.3	-175.4	-60.8	-71.8	0	0	0	113.2	L9 A15 V16 I17	L9-Y13 HydrophobicContact CD2-CD2 3.88Å; L9-Y13 HydrophobicContact CD2-CE2 3.8Å; L9-Y13 WeakPolarHBondContact O-CB 3.4Å; L9-Y13 PolarHBondContact O-N 3.16Å; Y13-A15 VanDerWaalsContact C-N 3.29Å; Y13-A15 PolarHBondContact O-N 3.49Å; Y13-V16 HydrophobicContact CD1-CG2 4.4Å; Y13-V16 CarbonylContact O-C 3.57Å; Y13-V16 WeakPolarHBondContact O-CA 3.3Å; Y13-V16 WeakPolarHBondContact O-CB 3.42Å; Y13-V16 PolarHBondContact O-N 3.48Å; Y13-I17 WeakPolarHBondContact O-CG1 3.3Å; Y13-I17 PolarHBondContact O-N 3.5Å
14	G	71.9	Confident	81.7	Confident	23 Å²	23	97.6 Å²	97.6	24%	0.237	53%	0.531	C	S	.	.	H	α-helix	trans	-48.9	-47.8	-177.1	0	0	0	0	0	113.3	A10 V16 I17 F18	A10-G14 WeakPolarHBondContact O-CA 3.49Å; A10-G14 PolarHBondContact O-N 3.31Å; G14-V16 VanDerWaalsContact C-N 3.32Å; G14-V16 PolarHBondContact O-N 2.95Å; G14-I17 VanDerWaalsContact O-CG1 3.29Å; G14-I17 WeakPolarHBondContact O-CG1 3.49Å; G14-I17 PolarHBondContact O-N 2.98Å; G14-F18 WeakPolarHBondContact O-CB 3.41Å; G14-F18 PolarHBondContact O-N 3.37Å
15	A	75.8	Confident	82.5	Confident	92 Å²	92	97.3 Å²	97.3	76%	0.76	53%	0.529	S	S	*	.	H	α-helix	trans	-63.1	-37.1	176.4	0	0	0	0	0	112.9	Y13	Y13-A15 VanDerWaalsContact C-N 3.29Å; Y13-A15 PolarHBondContact O-N 3.49Å
16	V	78.9	Confident	83.1	Confident	99 Å²	99	95.6 Å²	95.6	60%	0.6	53%	0.526	S	S	*	.	H	α-helix	trans	-71.6	-37	-180	-173	0	0	0	0	111.5	Y13 G14 P20	Y13-V16 HydrophobicContact CD1-CG2 4.4Å; Y13-V16 CarbonylContact O-C 3.57Å; Y13-V16 WeakPolarHBondContact O-CA 3.3Å; Y13-V16 WeakPolarHBondContact O-CB 3.42Å; Y13-V16 PolarHBondContact O-N 3.48Å; G14-V16 VanDerWaalsContact C-N 3.32Å; G14-V16 PolarHBondContact O-N 2.95Å; V16-P20 WeakPolarHBondContact O-CD 3.34Å; V16-P20 VanDerWaalsContact O-CG 3.31Å; V16-P20 WeakPolarHBondContact O-CG 3.47Å
17	I	79.6	Confident	83.8	Confident	84 Å²	84	96.6 Å²	96.6	43%	0.431	53%	0.527	S	S	.	.	H	α-helix	trans	-85.1	-23	179.6	65.9	175.5	0	0	0	112.5	Y13 G14 P20 T21	Y13-I17 WeakPolarHBondContact O-CG1 3.3Å; Y13-I17 PolarHBondContact O-N 3.5Å; G14-I17 VanDerWaalsContact O-CG1 3.29Å; G14-I17 WeakPolarHBondContact O-CG1 3.49Å; G14-I17 PolarHBondContact O-N 2.98Å; I17-P20 WeakPolarHBondContact O-CD 3.37Å; I17-T21 WeakPolarHBondContact O-CB 3.47Å; I17-T21 PolarHBondContact O-N 3.4Å; I17-T21 PolarHBondContact O-OG1 2.96Å
18	F	83	Confident	84.4	Confident	144 Å²	144	99.7 Å²	99.7	63%	0.632	53%	0.53	S	S	*	.	H	α-helix	trans	-61.1	-54.9	-176.6	-177.9	-97.7	0	0	0	111.3	G14 T21 V22	G14-F18 WeakPolarHBondContact O-CB 3.41Å; G14-F18 PolarHBondContact O-N 3.37Å; F18-T21 PolarHBondContact O-N 2.86Å; F18-V22 HydrophobicContact CD1-CG2 4.26Å; F18-V22 HydrophobicContact CD2-CG2 4.21Å; F18-V22 HydrophobicContact CE1-CG2 3.97Å; F18-V22 HydrophobicContact CE2-CG2 3.92Å; F18-V22 HydrophobicContact CG-CG2 4.38Å; F18-V22 HydrophobicContact CZ-CG2 3.79Å; F18-V22 WeakPolarHBondContact O-CB 3.26Å; F18-V22 VanDerWaalsContact O-CG2 3.3Å; F18-V22 WeakPolarHBondContact O-CG2 3.3Å; F18-V22 PolarHBondContact O-N 2.91Å
19	F	85.4	Confident	84.8	Confident	155 Å²	155	95.1 Å²	95.1	68%	0.68	52%	0.517	S	S	*	.	H	α-helix	trans	-61.6	-49.2	-176.8	175.6	-94.8	0	0	0	112.9	T21 V22 A23	F19-T21 VanDerWaalsContact C-N 3.34Å; F19-T21 PolarHBondContact O-N 3.25Å; F19-V22 PolarHBondContact O-N 3.22Å; F19-A23 WeakPolarHBondContact O-CB 3.33Å; F19-A23 PolarHBondContact O-N 3.01Å
20	P	89.3	Confident	85.2	Confident	64 Å²	64	96 Å²	96	42%	0.416	52%	0.522	S	S	.	.	H	α-helix	trans	-61.7	-39.1	176.5	-24.1	34.6	0	0	0	113.3	V16 I17 A23 V24	V16-P20 WeakPolarHBondContact O-CD 3.34Å; V16-P20 VanDerWaalsContact O-CG 3.31Å; V16-P20 WeakPolarHBondContact O-CG 3.47Å; I17-P20 WeakPolarHBondContact O-CD 3.37Å; P20-A23 PolarHBondContact O-N 3.42Å; P20-V24 WeakPolarHBondContact O-CB 3.37Å; P20-V24 VanDerWaalsContact O-CG2 3.25Å; P20-V24 WeakPolarHBondContact O-CG2 3.39Å; P20-V24 PolarHBondContact O-N 2.9Å
21	T	89.5	Confident	85.7	Confident	94 Å²	94	100.4 Å²	100.4	58%	0.577	53%	0.529	S	S	*	.	H	α-helix	trans	-67	-46.1	-179.9	-56.2	0	0	0	0	111.2	I17 F18 F19 G25	I17-T21 WeakPolarHBondContact O-CB 3.47Å; I17-T21 PolarHBondContact O-N 3.4Å; I17-T21 PolarHBondContact O-OG1 2.96Å; F18-T21 PolarHBondContact O-N 2.86Å; F19-T21 VanDerWaalsContact C-N 3.34Å; F19-T21 PolarHBondContact O-N 3.25Å; T21-G25 PolarHBondContact O-N 3.01Å
22	V	90.4	Very high	86	Confident	67 Å²	67	91.8 Å²	91.8	41%	0.406	50%	0.503	S	S	.	.	H	α-helix	trans	-63.8	-44.3	176.2	174.6	0	0	0	0	110.1	F18 F19 G25 S26	F18-V22 HydrophobicContact CD1-CG2 4.26Å; F18-V22 HydrophobicContact CD2-CG2 4.21Å; F18-V22 HydrophobicContact CE1-CG2 3.97Å; F18-V22 HydrophobicContact CE2-CG2 3.92Å; F18-V22 HydrophobicContact CG-CG2 4.38Å; F18-V22 HydrophobicContact CZ-CG2 3.79Å; F18-V22 WeakPolarHBondContact O-CB 3.26Å; F18-V22 VanDerWaalsContact O-CG2 3.3Å; F18-V22 WeakPolarHBondContact O-CG2 3.3Å; F18-V22 PolarHBondContact O-N 2.91Å; F19-V22 PolarHBondContact O-N 3.22Å; V22-G25 PolarHBondContact O-N 2.99Å; V22-S26 WeakPolarHBondContact O-CB 3.43Å; V22-S26 PolarHBondContact O-N 3.35Å; V22-S26 PolarHBondContact O-OG 2.94Å; V22-S26 VanDerWaalsContact O-OG 3.08Å
23	A	92.6	Very high	86	Confident	31 Å²	31	90.4 Å²	90.4	26%	0.256	50%	0.499	S	S	.	.	H	α-helix	trans	-60.6	-48.5	178.7	0	0	0	0	0	112.4	F19 P20 G25 S26 I27	F19-A23 WeakPolarHBondContact O-CB 3.33Å; F19-A23 PolarHBondContact O-N 3.01Å; P20-A23 PolarHBondContact O-N 3.42Å; A23-G25 VanDerWaalsContact C-N 3.33Å; A23-G25 PolarHBondContact O-N 3.49Å; A23-S26 PolarHBondContact O-N 3.26Å; A23-I27 VanDerWaalsContact O-CG1 3.26Å; A23-I27 WeakPolarHBondContact O-CG1 3.38Å; A23-I27 PolarHBondContact O-N 3.18Å
24	V	92.3	Very high	86.1	Confident	99 Å²	99	88 Å²	88	60%	0.6	50%	0.495	S	S	*	.	H	α-helix	trans	-61.8	-42.4	175.8	171	0	0	0	0	110.8	P20 I27 Y28	P20-V24 WeakPolarHBondContact O-CB 3.37Å; P20-V24 VanDerWaalsContact O-CG2 3.25Å; P20-V24 WeakPolarHBondContact O-CG2 3.39Å; P20-V24 PolarHBondContact O-N 2.9Å; V24-I27 PolarHBondContact O-N 3.04Å; V24-Y28 WeakPolarHBondContact O-CB 3.46Å; V24-Y28 PolarHBondContact O-N 3.35Å
25	G	92.4	Very high	86.6	Confident	39 Å²	39	92.7 Å²	92.7	40%	0.402	51%	0.505	S	S	.	.	H	α-helix	trans	-60.7	-44.4	175.5	0	0	0	0	0	112.9	T21 V22 A23 Y28 A29	T21-G25 PolarHBondContact O-N 3.01Å; V22-G25 PolarHBondContact O-N 2.99Å; A23-G25 VanDerWaalsContact C-N 3.33Å; A23-G25 PolarHBondContact O-N 3.49Å; G25-Y28 PolarHBondContact O-N 2.92Å; G25-A29 WeakPolarHBondContact O-CB 3.25Å; G25-A29 PolarHBondContact O-N 3.25Å
26	S	91.6	Very high	87.1	Confident	70 Å²	70	93.2 Å²	93.2	49%	0.49	49%	0.492	S	S	.	.	H	α-helix	trans	-64.2	-45.5	176.7	-65.9	0	0	0	0	112	V22 A23 Y28 A29 D30	V22-S26 WeakPolarHBondContact O-CB 3.43Å; V22-S26 PolarHBondContact O-N 3.35Å; V22-S26 PolarHBondContact O-OG 2.94Å; V22-S26 VanDerWaalsContact O-OG 3.08Å; A23-S26 PolarHBondContact O-N 3.26Å; S26-Y28 VanDerWaalsContact C-N 3.31Å; S26-Y28 PolarHBondContact O-N 2.9Å; S26-A29 PolarHBondContact O-N 3.43Å; S26-D30 WeakPolarHBondContact O-CB 3.32Å; S26-D30 PolarHBondContact O-N 2.92Å
27	I	90.1	Very high	87.2	Confident	119 Å²	119	95.5 Å²	95.5	61%	0.61	49%	0.49	S	S	*	.	H	α-helix	trans	-61	-42.6	175.6	-67.8	163.7	0	0	0	110.4	A23 V24 D30 W31	A23-I27 VanDerWaalsContact O-CG1 3.26Å; A23-I27 WeakPolarHBondContact O-CG1 3.38Å; A23-I27 PolarHBondContact O-N 3.18Å; V24-I27 PolarHBondContact O-N 3.04Å; I27-D30 PolarHBondContact O-N 3.46Å; I27-W31 VanDerWaalsContact O-CB 3.3Å; I27-W31 WeakPolarHBondContact O-CB 3.4Å; I27-W31 PolarHBondContact O-N 3.5Å
28	Y	91.3	Very high	87.6	Confident	152 Å²	152	97.3 Å²	97.3	60%	0.596	50%	0.495	S	S	*	.	H	α-helix	trans	-65.9	-41.8	178.6	-176.3	-98	0	0	0	112.3	V24 G25 S26 W31 S32	V24-Y28 WeakPolarHBondContact O-CB 3.46Å; V24-Y28 PolarHBondContact O-N 3.35Å; G25-Y28 PolarHBondContact O-N 2.92Å; S26-Y28 VanDerWaalsContact C-N 3.31Å; S26-Y28 PolarHBondContact O-N 2.9Å; Y28-W31 HydrophobicContact CD2-CE3 4.5Å; Y28-W31 HydrophobicContact CE2-CE3 4.33Å; Y28-W31 HydrophobicContact CE2-CZ3 4.39Å; Y28-W31 PolarHBondContact O-N 3.39Å; Y28-S32 WeakPolarHBondContact O-CB 3.21Å; Y28-S32 PolarHBondContact O-N 2.94Å
29	A	89.1	Confident	87.8	Confident	48 Å²	48	97.3 Å²	97.3	40%	0.397	49%	0.491	S	S	.	.	H	α-helix	trans	-62.7	-45.2	175.3	0	0	0	0	0	111.7	G25 S26 W31 S32 H33	G25-A29 WeakPolarHBondContact O-CB 3.25Å; G25-A29 PolarHBondContact O-N 3.25Å; S26-A29 PolarHBondContact O-N 3.43Å; A29-W31 PolarHBondContact O-N 3.48Å; A29-S32 WeakPolarHBondContact O-CB 3.4Å; A29-S32 PolarHBondContact O-N 2.87Å; A29-H33 PolarHBondContact O-N 3.44Å
30	D	88.4	Confident	88	Confident	109 Å²	109	95.2 Å²	95.2	58%	0.583	48%	0.483	S	S	*	.	H	α-helix	trans	-62.3	-42.8	176.6	-172.4	70.9	0	0	0	112	S26 I27 S32 H33 T34	S26-D30 WeakPolarHBondContact O-CB 3.32Å; S26-D30 PolarHBondContact O-N 2.92Å; I27-D30 PolarHBondContact O-N 3.46Å; D30-S32 PolarHBondContact O-N 3.44Å; D30-H33 PolarHBondContact O-N 2.88Å; D30-T34 WeakPolarHBondContact O-CB 3.31Å; D30-T34 PolarHBondContact O-N 3.26Å; D30-T34 PolarHBondContact O-OG1 2.93Å
31	W	86.7	Confident	87.9	Confident	137 Å²	137	96 Å²	96	52%	0.519	48%	0.481	S	S	.	.	H	α-helix	trans	-64.2	-40.7	174.8	-175	74.5	0	0	0	112.5	I27 Y28 A29 T34 R35	I27-W31 VanDerWaalsContact O-CB 3.3Å; I27-W31 WeakPolarHBondContact O-CB 3.4Å; I27-W31 PolarHBondContact O-N 3.5Å; Y28-W31 HydrophobicContact CD2-CE3 4.5Å; Y28-W31 HydrophobicContact CE2-CE3 4.33Å; Y28-W31 HydrophobicContact CE2-CZ3 4.39Å; Y28-W31 PolarHBondContact O-N 3.39Å; A29-W31 PolarHBondContact O-N 3.48Å; W31-T34 PolarHBondContact O-N 2.91Å; W31-R35 WeakPolarHBondContact O-CB 3.46Å; W31-R35 PolarHBondContact O-N 3.25Å
32	S	86	Confident	88	Confident	38 Å²	38	97.5 Å²	97.5	27%	0.266	49%	0.485	S	S	.	.	H	α-helix	trans	-61.9	-46.5	176.4	-174.7	0	0	0	0	111.4	Y28 A29 D30 T34 R35 Q36	Y28-S32 WeakPolarHBondContact O-CB 3.21Å; Y28-S32 PolarHBondContact O-N 2.94Å; A29-S32 WeakPolarHBondContact O-CB 3.4Å; A29-S32 PolarHBondContact O-N 2.87Å; D30-S32 PolarHBondContact O-N 3.44Å; S32-T34 PolarHBondContact O-N 2.96Å; S32-R35 PolarHBondContact O-N 2.9Å; S32-Q36 WeakPolarHBondContact O-CG 2.98Å; S32-Q36 PolarHBondContact O-N 3.31Å
33	H	80.3	Confident	88	Confident	128 Å²	128	100 Å²	100	59%	0.593	49%	0.492	S	S	*	.	H	α-helix	trans	-59.8	-46.3	174.6	-77.4	-178	0	0	0	111.8	A29 D30 R35 Q36 W37	A29-H33 PolarHBondContact O-N 3.44Å; D30-H33 PolarHBondContact O-N 2.88Å; H33-R35 VanDerWaalsContact C-N 3.3Å; H33-R35 PolarHBondContact O-N 2.9Å; H33-Q36 PolarHBondContact O-N 2.89Å; H33-W37 WeakPolarHBondContact O-CB 3.49Å; H33-W37 PolarHBondContact O-N 3.36Å
34	T	83.1	Confident	87.9	Confident	55 Å²	55	104 Å²	104	34%	0.337	51%	0.508	S	S	.	.	H	α-helix	trans	-60.8	-39.9	177.7	-61.8	0	0	0	0	111.7	D30 W31 S32 K38	D30-T34 WeakPolarHBondContact O-CB 3.31Å; D30-T34 PolarHBondContact O-N 3.26Å; D30-T34 PolarHBondContact O-OG1 2.93Å; W31-T34 PolarHBondContact O-N 2.91Å; S32-T34 PolarHBondContact O-N 2.96Å; T34-K38 WeakPolarHBondContact O-CG 3.3Å; T34-K38 PolarHBondContact O-N 3.47Å
35	R	82.4	Confident	87.8	Confident	123 Å²	123	101.6 Å²	101.6	46%	0.464	50%	0.499	S	S	.	.	H	α-helix	trans	-69.3	-39.4	178.5	-165.4	174	-171.3	-172.4	1.5	112.1	W31 S32 H33 R39	W31-R35 WeakPolarHBondContact O-CB 3.46Å; W31-R35 PolarHBondContact O-N 3.25Å; S32-R35 PolarHBondContact O-N 2.9Å; H33-R35 VanDerWaalsContact C-N 3.3Å; H33-R35 PolarHBondContact O-N 2.9Å; R35-R39 WeakPolarHBondContact O-CG 3.38Å; R35-R39 PolarHBondContact O-N 2.8Å
36	Q	85.8	Confident	87.7	Confident	102 Å²	102	105 Å²	105	48%	0.477	50%	0.504	S	S	.	.	H	α-helix	trans	-64.6	-45.3	174.9	-72.4	-176.8	6.9	0	0	111.3	S32 H33 K38 R39 Q40	S32-Q36 WeakPolarHBondContact O-CG 2.98Å; S32-Q36 PolarHBondContact O-N 3.31Å; H33-Q36 PolarHBondContact O-N 2.89Å; Q36-K38 PolarHBondContact O-N 3.08Å; Q36-R39 WeakPolarHBondContact O-CB 3.21Å; Q36-R39 PolarHBondContact O-N 2.66Å; Q36-Q40 WeakPolarHBondContact O-CG 3.2Å; Q36-Q40 PolarHBondContact O-N 3.33Å
37	W	82.6	Confident	87.6	Confident	148 Å²	148	109.8 Å²	109.8	56%	0.561	51%	0.511	S	S	*	.	H	α-helix	trans	-61.4	-42.5	176.8	178	73.6	0	0	0	112.6	H33 R39 Q40 Q41	H33-W37 WeakPolarHBondContact O-CB 3.49Å; H33-W37 PolarHBondContact O-N 3.36Å; W37-R39 PolarHBondContact O-N 3.44Å; W37-Q40 PolarHBondContact O-N 2.85Å; W37-Q41 HydrophobicContact CZ2-CG 4.33Å; W37-Q41 PolarHBondContact O-N 3.43Å; W37-Q41 PolarHBondContact O-NE2 2.91Å
38	K	87.2	Confident	87.5	Confident	122 Å²	122	106.9 Å²	106.9	53%	0.53	51%	0.505	S	S	.	.	H	α-helix	trans	-62.4	-40.8	173.8	-75.6	-176.5	179.7	-175.7	0	112.2	T34 Q36 Q41 L42	T34-K38 WeakPolarHBondContact O-CG 3.3Å; T34-K38 PolarHBondContact O-N 3.47Å; Q36-K38 PolarHBondContact O-N 3.08Å; K38-Q41 PolarHBondContact O-N 3.4Å; K38-L42 WeakPolarHBondContact O-CG 2.89Å; K38-L42 PolarHBondContact O-N 2.9Å
39	R	88.2	Confident	87.3	Confident	144 Å²	144	106 Å²	106	54%	0.543	51%	0.506	S	S	.	.	H	α-helix	trans	-63	-42.6	175.2	-75.9	177.6	178.5	-178.6	-0.1	111.9	R35 Q36 W37 L42 Q43	R35-R39 WeakPolarHBondContact O-CG 3.38Å; R35-R39 PolarHBondContact O-N 2.8Å; Q36-R39 WeakPolarHBondContact O-CB 3.21Å; Q36-R39 PolarHBondContact O-N 2.66Å; W37-R39 PolarHBondContact O-N 3.44Å; R39-L42 PolarHBondContact O-N 3.39Å; R39-Q43 WeakPolarHBondContact O-CG 3.36Å; R39-Q43 PolarHBondContact O-N 3.21Å
40	Q	88.2	Confident	87.2	Confident	110 Å²	110	108.5 Å²	108.5	51%	0.514	51%	0.513	S	S	.	.	H	α-helix	trans	-62.8	-43.9	176.7	-73.7	175.6	-12.9	0	0	111.4	Q36 W37 L42 Q43 L44	Q36-Q40 WeakPolarHBondContact O-CG 3.2Å; Q36-Q40 PolarHBondContact O-N 3.33Å; W37-Q40 PolarHBondContact O-N 2.85Å; Q40-L42 PolarHBondContact O-N 2.85Å; Q40-Q43 PolarHBondContact O-N 3.05Å; Q40-L44 WeakPolarHBondContact O-CB 3.48Å; Q40-L44 VanDerWaalsContact O-CG 3.3Å; Q40-L44 WeakPolarHBondContact O-CG 3.29Å; Q40-L44 PolarHBondContact O-N 3.3Å
41	Q	88.3	Confident	87	Confident	80 Å²	80	111.3 Å²	111.3	37%	0.374	52%	0.52	S	S	.	.	H	α-helix	trans	-62.3	-42.8	175.1	-80.9	177.5	93.8	0	0	113.2	W37 K38 Q43 L44 A45	W37-Q41 HydrophobicContact CZ2-CG 4.33Å; W37-Q41 PolarHBondContact O-N 3.43Å; W37-Q41 PolarHBondContact O-NE2 2.91Å; K38-Q41 PolarHBondContact O-N 3.4Å; Q41-Q43 VanDerWaalsContact C-N 3.29Å; Q41-Q43 PolarHBondContact O-N 3.45Å; Q41-L44 PolarHBondContact O-N 2.88Å; Q41-A45 WeakPolarHBondContact O-CB 3.39Å; Q41-A45 PolarHBondContact O-N 2.84Å
42	L	91.1	Very high	86.8	Confident	126 Å²	126	111.7 Å²	111.7	66%	0.66	53%	0.532	S	S	*	.	H	α-helix	trans	-61.1	-40.4	175.9	-73.4	170.2	0	0	0	111.3	K38 R39 Q40 H46	K38-L42 WeakPolarHBondContact O-CG 2.89Å; K38-L42 PolarHBondContact O-N 2.9Å; R39-L42 PolarHBondContact O-N 3.39Å; Q40-L42 PolarHBondContact O-N 2.85Å; L42-H46 VanDerWaalsContact O-CB 3.28Å; L42-H46 WeakPolarHBondContact O-CB 3.42Å; L42-H46 PolarHBondContact O-N 3.38Å
43	Q	91.2	Very high	86	Confident	121 Å²	121	118.3 Å²	118.3	57%	0.565	56%	0.559	S	S	*	*	H	α-helix	trans	-66.6	-40.1	175.1	-73.1	178.1	-9.8	0	0	112.5	R39 Q40 Q41 R47	R39-Q43 WeakPolarHBondContact O-CG 3.36Å; R39-Q43 PolarHBondContact O-N 3.21Å; Q40-Q43 PolarHBondContact O-N 3.05Å; Q41-Q43 VanDerWaalsContact C-N 3.29Å; Q41-Q43 PolarHBondContact O-N 3.45Å; Q43-R47 WeakPolarHBondContact O-CB 3.43Å; Q43-R47 VanDerWaalsContact O-CG 3.3Å; Q43-R47 WeakPolarHBondContact O-CG 3.49Å; Q43-R47 PolarHBondContact O-N 2.97Å
44	L	90.1	Very high	85.2	Confident	114 Å²	114	125.9 Å²	125.9	60%	0.597	58%	0.582	S	S	*	*	H	α-helix	trans	-66	-44.1	176.1	-72.1	170.7	0	0	0	111.4	Q40 Q41 R47 A48	Q40-L44 WeakPolarHBondContact O-CB 3.48Å; Q40-L44 VanDerWaalsContact O-CG 3.3Å; Q40-L44 WeakPolarHBondContact O-CG 3.29Å; Q40-L44 PolarHBondContact O-N 3.3Å; Q41-L44 PolarHBondContact O-N 2.88Å; L44-R47 PolarHBondContact O-N 3.42Å; L44-A48 WeakPolarHBondContact O-CB 3.36Å; L44-A48 PolarHBondContact O-N 3.38Å
45	A	90.2	Very high	85.3	Confident	48 Å²	48	129.5 Å²	129.5	40%	0.397	59%	0.594	S	S	.	*	H	α-helix	trans	-61.4	-45.5	175.4	0	0	0	0	0	111.3	Q41 R47 A48 Q49	Q41-A45 WeakPolarHBondContact O-CB 3.39Å; Q41-A45 PolarHBondContact O-N 2.84Å; A45-R47 VanDerWaalsContact C-N 3.35Å; A45-R47 PolarHBondContact O-N 2.83Å; A45-A48 PolarHBondContact O-N 2.92Å; A45-Q49 WeakPolarHBondContact O-CG 3.35Å; A45-Q49 PolarHBondContact O-N 3.24Å
46	H	89.9	Confident	85.5	Confident	111 Å²	111	129.8 Å²	129.8	51%	0.514	60%	0.601	S	S	.	*	H	α-helix	trans	-60.9	-42.9	176.1	-173	62.4	0	0	0	112.1	L42 A48 Q49 L50	L42-H46 VanDerWaalsContact O-CB 3.28Å; L42-H46 WeakPolarHBondContact O-CB 3.42Å; L42-H46 PolarHBondContact O-N 3.38Å; H46-A48 PolarHBondContact O-N 3.42Å; H46-Q49 PolarHBondContact O-N 2.91Å; H46-L50 WeakPolarHBondContact O-CG 3.34Å; H46-L50 PolarHBondContact O-N 2.86Å
47	R	89.1	Confident	85.5	Confident	170 Å²	170	131.3 Å²	131.3	64%	0.642	61%	0.608	S	S	*	*	H	α-helix	trans	-65.5	-35.3	174.7	-75.8	176.8	172.4	-177.2	-0.9	113	Q43 L44 A45 K51	Q43-R47 WeakPolarHBondContact O-CB 3.43Å; Q43-R47 VanDerWaalsContact O-CG 3.3Å; Q43-R47 WeakPolarHBondContact O-CG 3.49Å; Q43-R47 PolarHBondContact O-N 2.97Å; L44-R47 PolarHBondContact O-N 3.42Å; A45-R47 VanDerWaalsContact C-N 3.35Å; A45-R47 PolarHBondContact O-N 2.83Å; R47-K51 WeakPolarHBondContact O-CG 3.29Å; R47-K51 PolarHBondContact O-N 2.97Å; R47-K51 VanDerWaalsContact O-N 3.16Å
48	A	88.9	Confident	85.6	Confident	58 Å²	58	130.4 Å²	130.4	48%	0.479	61%	0.611	S	S	.	*	H	α-helix	trans	-67	-44.7	175.7	0	0	0	0	0	111.2	L44 A45 H46 L50 K51 D52	L44-A48 WeakPolarHBondContact O-CB 3.36Å; L44-A48 PolarHBondContact O-N 3.38Å; A45-A48 PolarHBondContact O-N 2.92Å; H46-A48 PolarHBondContact O-N 3.42Å; A48-L50 VanDerWaalsContact C-N 3.35Å; A48-L50 PolarHBondContact O-N 3.44Å; A48-K51 PolarHBondContact O-N 3.08Å; A48-K51 VanDerWaalsContact O-N 3.16Å; A48-D52 PolarHBondContact O-N 3.46Å
49	Q	87.4	Confident	85.5	Confident	133 Å²	133	130.9 Å²	130.9	62%	0.621	62%	0.616	S	S	*	*	H	α-helix	trans	-61.5	-41	175.3	-70.2	-176.2	-85	0	0	112.5	A45 H46 K51 D52 Q53	A45-Q49 WeakPolarHBondContact O-CG 3.35Å; A45-Q49 PolarHBondContact O-N 3.24Å; H46-Q49 PolarHBondContact O-N 2.91Å; Q49-K51 VanDerWaalsContact C-N 3.28Å; Q49-K51 PolarHBondContact O-N 3.4Å; Q49-D52 PolarHBondContact O-N 3.33Å; Q49-Q53 PolarHBondContact O-N 3.46Å
50	L	86.1	Confident	85.4	Confident	102 Å²	102	130 Å²	130	53%	0.534	62%	0.621	S	S	.	*	H	α-helix	trans	-65.5	-29.9	176.2	-72.2	171.5	0	0	0	113.2	H46 A48	H46-L50 WeakPolarHBondContact O-CG 3.34Å; H46-L50 PolarHBondContact O-N 2.86Å; A48-L50 VanDerWaalsContact C-N 3.35Å; A48-L50 PolarHBondContact O-N 3.44Å
51	K	84.5	Confident	85.2	Confident	167 Å²	167	131.4 Å²	131.4	73%	0.726	63%	0.629	S	S	*	*	H	α-helix	trans	-75.2	-35.6	175.4	-78.3	-179.2	176.1	-172	0	112.4	R47 A48 Q49 Q53 R54	R47-K51 WeakPolarHBondContact O-CG 3.29Å; R47-K51 PolarHBondContact O-N 2.97Å; R47-K51 VanDerWaalsContact O-N 3.16Å; A48-K51 PolarHBondContact O-N 3.08Å; A48-K51 VanDerWaalsContact O-N 3.16Å; Q49-K51 VanDerWaalsContact C-N 3.28Å; Q49-K51 PolarHBondContact O-N 3.4Å; K51-Q53 VanDerWaalsContact C-N 3.27Å; K51-Q53 PolarHBondContact O-N 3.46Å; K51-R54 PolarHBondContact O-N 3.48Å
52	D	81.4	Confident	84.9	Confident	146 Å²	146	135.4 Å²	135.4	78%	0.781	65%	0.648	S	S	*	*	H	α-helix	trans	-69.1	-25.7	-180	-164.5	65.3	0	0	0	112.6	A48 Q49 R54	A48-D52 PolarHBondContact O-N 3.46Å; Q49-D52 PolarHBondContact O-N 3.33Å; D52-R54 VanDerWaalsContact C-N 3.34Å; D52-R54 PolarHBondContact O-N 3.39Å
53	Q	71	Confident	84.4	Confident	177 Å²	177	136.2 Å²	136.2	83%	0.827	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.8	4.3	177.9	-66.8	-149.5	-22.8	0	0	115.4	Q49 K51	Q49-Q53 PolarHBondContact O-N 3.46Å; K51-Q53 VanDerWaalsContact C-N 3.27Å; K51-Q53 PolarHBondContact O-N 3.46Å
54	R	63.1	Low	83.8	Confident	287 Å²	287	137.5 Å²	137.5	100%	1.083	66%	0.655	S	S	*	*			trans	-118	0	-177.8	-167	-177	-163.8	-172.7	5.2	111.7	K51 D52	K51-R54 PolarHBondContact O-N 3.48Å; D52-R54 VanDerWaalsContact C-N 3.34Å; D52-R54 PolarHBondContact O-N 3.39Å

Retrieved 54 of 54 residues in 87.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).