X2JD42_DROME Loading...

Secreted protein

AlphaFold DB , UniProt , Accession X2JD42, Species DROME (Drosophila melanogaster, Fruit fly), Gene Dmel\CG45081, Length 92 aa.

						>X2JD42_DROME|X2JD42|Dmel\CG45081
MILSRSLLIITVVLAILLAPMPTDAQILGSGQCRLTPIRVSAGGTVCERLCFRRDYRGPPSLCRRIPRDAVVPVCGGGCCRSGPNCLQLLYT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.7	Low	74.2	Confident	206 Å²	206	121.3 Å²	121.3	100%	1.015	63%	0.625	S	S	*	*				0	-11.1	0	-69.5	175.8	75.2	0	0	114.7	S4	M1-S4 PolarHBondContact O-OG 2Å
2	I	61.7	Low	75.1	Confident	148 Å²	148	118.1 Å²	118.1	76%	0.759	62%	0.615	S	S	*	*	H	α-helix	trans	-78.5	-42.7	-178.5	-68	142.1	0	0	0	112.1	S4 R5 S6	I2-S4 PolarHBondContact O-N 2.92Å; I2-R5 WeakPolarHBondContact O-CB 3.2Å; I2-R5 PolarHBondContact O-N 2.82Å; I2-R5 VanDerWaalsContact O-N 3.17Å; I2-S6 PolarHBondContact O-N 3.06Å; I2-S6 PolarHBondContact O-OG 3.08Å
3	L	65.4	Low	75.7	Confident	142 Å²	142	114.8 Å²	114.8	74%	0.743	60%	0.603	S	S	*	*	H	α-helix	trans	-60.6	-39.2	178.5	-101.8	103.1	0	0	0	113.9	R5 S6 L7	L3-R5 VanDerWaalsContact C-N 3.26Å; L3-R5 PolarHBondContact O-N 3.4Å; L3-S6 WeakPolarHBondContact CA-OG 3.48Å; L3-S6 PolarHBondContact O-N 3.38Å; L3-S6 PolarHBondContact O-OG 2.93Å; L3-L7 PolarHBondContact O-N 3.23Å; L3-L7 VanDerWaalsContact O-N 3.11Å
4	S	70.4	Confident	76.2	Confident	70 Å²	70	113.8 Å²	113.8	49%	0.49	60%	0.598	S	S	.	*	H	α-helix	trans	-67.1	-31.5	179	51.2	0	0	0	0	112	M1 I2 L8	M1-S4 PolarHBondContact O-OG 2Å; I2-S4 PolarHBondContact O-N 2.92Å; S4-L8 PolarHBondContact O-N 3.05Å
5	R	72	Confident	76.1	Confident	193 Å²	193	110.3 Å²	110.3	73%	0.728	59%	0.591	S	S	*	*	H	α-helix	trans	-72.3	-41.8	178.5	-122.6	178.7	163.2	-172.8	-5.9	111.4	I2 L3 L8 I9	I2-R5 WeakPolarHBondContact O-CB 3.2Å; I2-R5 PolarHBondContact O-N 2.82Å; I2-R5 VanDerWaalsContact O-N 3.17Å; L3-R5 VanDerWaalsContact C-N 3.26Å; L3-R5 PolarHBondContact O-N 3.4Å; R5-L8 PolarHBondContact O-N 3.3Å; R5-I9 VanDerWaalsContact O-CG1 3.31Å; R5-I9 WeakPolarHBondContact O-CG1 3.1Å; R5-I9 PolarHBondContact O-N 3.36Å
6	S	76.6	Confident	76	Confident	52 Å²	52	110.8 Å²	110.8	36%	0.364	59%	0.593	S	S	.	*	H	α-helix	trans	-67.1	-37.4	175.7	22.7	0	0	0	0	112.4	I2 L3 L8 I9 I10	I2-S6 PolarHBondContact O-N 3.06Å; I2-S6 PolarHBondContact O-OG 3.08Å; L3-S6 WeakPolarHBondContact CA-OG 3.48Å; L3-S6 PolarHBondContact O-N 3.38Å; L3-S6 PolarHBondContact O-OG 2.93Å; S6-L8 PolarHBondContact O-N 3.06Å; S6-I9 PolarHBondContact O-N 3.36Å; S6-I10 WeakPolarHBondContact O-CG1 3.08Å; S6-I10 PolarHBondContact O-N 2.87Å
7	L	79.4	Confident	75.7	Confident	110 Å²	110	112.4 Å²	112.4	58%	0.576	60%	0.6	S	S	*	*	H	α-helix	trans	-60	-45	174.6	-109.5	144.1	0	0	0	112.4	L3 I9 I10 T11	L3-L7 PolarHBondContact O-N 3.23Å; L3-L7 VanDerWaalsContact O-N 3.11Å; L7-I9 VanDerWaalsContact C-N 3.35Å; L7-I9 PolarHBondContact O-N 2.75Å; L7-I10 PolarHBondContact O-N 3Å; L7-T11 PolarHBondContact O-N 2.79Å; L7-T11 PolarHBondContact O-OG1 2Å
8	L	82.2	Confident	75.2	Confident	115 Å²	115	113.2 Å²	113.2	60%	0.602	60%	0.604	S	S	*	*	H	α-helix	trans	-59.9	-43.6	176.1	-92.6	164.8	0	0	0	112.3	S4 R5 S6 I10 T11 V12	S4-L8 PolarHBondContact O-N 3.05Å; R5-L8 PolarHBondContact O-N 3.3Å; S6-L8 PolarHBondContact O-N 3.06Å; L8-I10 PolarHBondContact O-N 3.3Å; L8-T11 WeakPolarHBondContact CA-OG1 3.31Å; L8-T11 PolarHBondContact O-N 3.34Å; L8-T11 PolarHBondContact O-OG1 1.94Å; L8-V12 WeakPolarHBondContact O-CG2 3.33Å; L8-V12 PolarHBondContact O-N 2.76Å
9	I	82.7	Confident	74.2	Confident	110 Å²	110	110 Å²	110	56%	0.564	60%	0.595	S	S	*	*	H	α-helix	trans	-62.7	-44.9	179.2	-63.5	164.5	0	0	0	110.4	R5 S6 L7 T11 V12 V13	R5-I9 VanDerWaalsContact O-CG1 3.31Å; R5-I9 WeakPolarHBondContact O-CG1 3.1Å; R5-I9 PolarHBondContact O-N 3.36Å; S6-I9 PolarHBondContact O-N 3.36Å; L7-I9 VanDerWaalsContact C-N 3.35Å; L7-I9 PolarHBondContact O-N 2.75Å; I9-T11 VanDerWaalsContact C-N 3.35Å; I9-T11 PolarHBondContact O-N 3.12Å; I9-V12 PolarHBondContact O-N 2.81Å; I9-V13 HydrophobicContact CG2-CG2 4.43Å; I9-V13 WeakPolarHBondContact O-CG2 3.46Å; I9-V13 PolarHBondContact O-N 2.81Å
10	I	83.2	Confident	73	Confident	114 Å²	114	110.5 Å²	110.5	59%	0.585	60%	0.604	S	S	*	*	H	α-helix	trans	-62.3	-42.9	178.6	-67.1	165.3	0	0	0	110.8	S6 L7 L8 V12 V13 L14	S6-I10 WeakPolarHBondContact O-CG1 3.08Å; S6-I10 PolarHBondContact O-N 2.87Å; L7-I10 PolarHBondContact O-N 3Å; L8-I10 PolarHBondContact O-N 3.3Å; I10-V12 PolarHBondContact O-N 3.45Å; I10-V13 PolarHBondContact O-N 3.23Å; I10-L14 WeakPolarHBondContact O-CB 3.08Å; I10-L14 PolarHBondContact O-N 3.47Å
11	T	83.2	Confident	71.8	Confident	74 Å²	74	113.3 Å²	113.3	45%	0.454	62%	0.615	S	S	.	*	H	α-helix	trans	-63.9	-38.1	177.9	47.3	0	0	0	0	113.2	L7 L8 I9 A15	L7-T11 PolarHBondContact O-N 2.79Å; L7-T11 PolarHBondContact O-OG1 2Å; L8-T11 WeakPolarHBondContact CA-OG1 3.31Å; L8-T11 PolarHBondContact O-N 3.34Å; L8-T11 PolarHBondContact O-OG1 1.94Å; I9-T11 VanDerWaalsContact C-N 3.35Å; I9-T11 PolarHBondContact O-N 3.12Å; T11-A15 WeakPolarHBondContact O-CB 3.28Å; T11-A15 PolarHBondContact O-N 3.47Å
12	V	84.4	Confident	71.4	Confident	83 Å²	83	108.2 Å²	108.2	50%	0.503	60%	0.597	S	S	.	*	H	α-helix	trans	-68.5	-44.2	177.2	171.5	0	0	0	0	111	L8 I9 I10 L14 A15 I16	L8-V12 WeakPolarHBondContact O-CG2 3.33Å; L8-V12 PolarHBondContact O-N 2.76Å; I9-V12 PolarHBondContact O-N 2.81Å; I10-V12 PolarHBondContact O-N 3.45Å; V12-L14 VanDerWaalsContact C-N 3.33Å; V12-L14 PolarHBondContact O-N 2.89Å; V12-A15 PolarHBondContact O-N 2.74Å; V12-I16 HydrophobicContact CG1-CD1 3.93Å; V12-I16 WeakPolarHBondContact O-CG1 3.37Å; V12-I16 PolarHBondContact O-N 3.45Å
13	V	82.7	Confident	70.9	Confident	75 Å²	75	106.7 Å²	106.7	46%	0.455	60%	0.595	S	S	.	*	H	α-helix	trans	-62.2	-42.8	177.2	172.1	0	0	0	0	110.9	I9 I10 A15 I16 L17	I9-V13 HydrophobicContact CG2-CG2 4.43Å; I9-V13 WeakPolarHBondContact O-CG2 3.46Å; I9-V13 PolarHBondContact O-N 2.81Å; I10-V13 PolarHBondContact O-N 3.23Å; V13-A15 VanDerWaalsContact C-N 3.35Å; V13-A15 PolarHBondContact O-N 3.34Å; V13-I16 PolarHBondContact O-N 3.16Å; V13-L17 HydrophobicContact CG1-CD1 3.79Å; V13-L17 VanDerWaalsContact O-CD1 3.23Å; V13-L17 WeakPolarHBondContact O-CD1 3.27Å; V13-L17 PolarHBondContact O-N 3.4Å
14	L	82.6	Confident	70.2	Confident	101 Å²	101	102.7 Å²	102.7	53%	0.529	57%	0.574	S	S	.	*	H	α-helix	trans	-65.1	-38.6	177.6	-163.5	70.4	0	0	0	111.9	I10 V12 I16 L17 L18	I10-L14 WeakPolarHBondContact O-CB 3.08Å; I10-L14 PolarHBondContact O-N 3.47Å; V12-L14 VanDerWaalsContact C-N 3.33Å; V12-L14 PolarHBondContact O-N 2.89Å; L14-I16 VanDerWaalsContact C-N 3.35Å; L14-I16 PolarHBondContact O-N 2.72Å; L14-L17 PolarHBondContact O-N 3.29Å; L14-L18 HydrophobicContact CD2-CD1 4.41Å; L14-L18 HydrophobicContact CG-CD1 3.89Å; L14-L18 WeakPolarHBondContact O-CB 3.44Å; L14-L18 WeakPolarHBondContact O-CD1 2.85Å; L14-L18 WeakPolarHBondContact O-CG 3.21Å; L14-L18 PolarHBondContact O-N 2.04Å
15	A	75.2	Confident	69.3	Low	61 Å²	61	100.6 Å²	100.6	50%	0.504	56%	0.561	S	S	.	*	H	α-helix	trans	-65.1	-35.7	175.6	0	0	0	0	0	112.8	T11 V12 V13 A19	T11-A15 WeakPolarHBondContact O-CB 3.28Å; T11-A15 PolarHBondContact O-N 3.47Å; V12-A15 PolarHBondContact O-N 2.74Å; V13-A15 VanDerWaalsContact C-N 3.35Å; V13-A15 PolarHBondContact O-N 3.34Å; A15-A19 PolarHBondContact O-N 3.01Å
16	I	75.3	Confident	68.1	Low	119 Å²	119	98.7 Å²	98.7	61%	0.61	56%	0.56	S	S	*	*	H	α-helix	trans	-71.3	-39.3	175.5	-63.9	162.8	0	0	0	111	V12 V13 L14 L18 A19	V12-I16 HydrophobicContact CG1-CD1 3.93Å; V12-I16 WeakPolarHBondContact O-CG1 3.37Å; V12-I16 PolarHBondContact O-N 3.45Å; V13-I16 PolarHBondContact O-N 3.16Å; L14-I16 VanDerWaalsContact C-N 3.35Å; L14-I16 PolarHBondContact O-N 2.72Å; I16-L18 VanDerWaalsContact C-N 3.33Å; I16-A19 WeakPolarHBondContact O-CB 3.04Å; I16-A19 PolarHBondContact O-N 3.29Å
17	L	69.6	Low	67	Low	137 Å²	137	97.3 Å²	97.3	72%	0.717	55%	0.548	S	S	*	.	H	α-helix	trans	-67.6	-33.4	176	-96.1	90.1	0	0	0	112.9	V13 L14	V13-L17 HydrophobicContact CG1-CD1 3.79Å; V13-L17 VanDerWaalsContact O-CD1 3.23Å; V13-L17 WeakPolarHBondContact O-CD1 3.27Å; V13-L17 PolarHBondContact O-N 3.4Å; L14-L17 PolarHBondContact O-N 3.29Å
18	L	67.8	Low	65.9	Low	128 Å²	128	97.3 Å²	97.3	67%	0.67	55%	0.549	S	S	*	.	H	α-helix	trans	-85.1	-10.3	178.3	-71.9	164.8	0	0	0	113	L14 I16 P20	L14-L18 HydrophobicContact CD2-CD1 4.41Å; L14-L18 HydrophobicContact CG-CD1 3.89Å; L14-L18 WeakPolarHBondContact O-CB 3.44Å; L14-L18 WeakPolarHBondContact O-CD1 2.85Å; L14-L18 WeakPolarHBondContact O-CG 3.21Å; L14-L18 PolarHBondContact O-N 2.04Å; I16-L18 VanDerWaalsContact C-N 3.33Å; L18-P20 WeakPolarHBondContact O-CD 3.09Å; L18-P20 VanDerWaalsContact O-N 3.12Å
19	A	55.6	Low	64.4	Low	52 Å²	52	94.1 Å²	94.1	43%	0.43	54%	0.544	S	S	.	.	S	Bend	trans	-62.1	117.6	174.7	0	0	0	0	0	107.9	A15 I16 M21	A15-A19 PolarHBondContact O-N 3.01Å; I16-A19 WeakPolarHBondContact O-CB 3.04Å; I16-A19 PolarHBondContact O-N 3.29Å; A19-M21 PolarHBondContact O-N 3.27Å
20	P	51.2	Low	63.2	Low	120 Å²	120	92.6 Å²	92.6	78%	0.779	54%	0.543	S	S	*	.			trans	-61.2	114.6	-177.3	24.6	-31.2	0	0	0	107.1	L18	L18-P20 WeakPolarHBondContact O-CD 3.09Å; L18-P20 VanDerWaalsContact O-N 3.12Å
21	M	47.9	Very low	62.3	Low	170 Å²	170	87.2 Å²	87.2	84%	0.837	52%	0.515	S	S	*	.			trans	-51.6	121.5	172	-67.5	-130	-178.6	0	0	106.5	A19 T23	A19-M21 PolarHBondContact O-N 3.27Å; M21-T23 PolarHBondContact O-N 3.29Å
22	P	49.4	Very low	61.7	Low	98 Å²	98	87.8 Å²	87.8	64%	0.636	51%	0.512	S	S	*	.			trans	-60.5	121.9	-177.4	25.8	-32.3	0	0	0	106.2	D24	P22-D24 WeakPolarHBondContact CB-OD2 2.96Å; P22-D24 PolarHBondContact O-N 3.33Å
23	T	52.2	Low	61.3	Low	116 Å²	116	84 Å²	84	71%	0.712	49%	0.49	S	S	*	.			trans	-69.4	67.7	173.5	49.7	0	0	0	0	108.2	M21	M21-T23 PolarHBondContact O-N 3.29Å
24	D	51.3	Low	61.1	Low	59 Å²	59	89.8 Å²	89.8	32%	0.316	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	112.3	173.6	-76.6	-43.5	0	0	0	106.3	P22 Q32	P22-D24 WeakPolarHBondContact CB-OD2 2.96Å; P22-D24 PolarHBondContact O-N 3.33Å; D24-Q32 HydrophobicContact CB-CB 4.32Å; D24-Q32 HydrophobicContact CB-CG 4.32Å
25	A	50.1	Low	60.9	Low	25 Å²	25	87.9 Å²	87.9	21%	0.207	49%	0.494	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.5	138.7	170.1	0	0	0	0	0	110.3	I27 G31 C33 L35	A25-I27 PolarHBondContact O-N 2.83Å; A25-G31 VanDerWaalsContact O-O 3.13Å; A25-C33 PolarHBondContact N-O 3.16Å; A25-L35 HydrophobicContact CB-CD1 3.13Å; A25-L35 HydrophobicContact CB-CD2 3.89Å; A25-L35 HydrophobicContact CB-CG 3.35Å
26	Q	47.8	Very low	61.3	Low	154 Å²	154	87.5 Å²	87.5	72%	0.72	49%	0.485	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75	107.1	174	-68.9	174.1	-6.1	0	0	109.2	G31	Q26-G31 VanDerWaalsContact CA-O 3.26Å; Q26-G31 WeakPolarHBondContact CA-O 3.48Å
27	I	53.9	Low	61.9	Low	22 Å²	22	86.4 Å²	86.4	11%	0.113	49%	0.486	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	120.4	169.9	-51.2	-159.5	0	0	0	109.3	A25 G29 G31 L35 C75 L87	A25-I27 PolarHBondContact O-N 2.83Å; I27-G29 PolarHBondContact O-N 2.89Å; I27-G31 PolarHBondContact N-O 2.74Å; I27-L35 HydrophobicContact CD1-CD2 3.88Å; I27-L35 HydrophobicContact CG1-CD2 4.41Å; I27-C75 WeakPolarHBondContact CD1-SG 3.5Å; I27-L87 HydrophobicContact CG2-CB 3.79Å; I27-L87 HydrophobicContact CG2-CD1 3.86Å; I27-L87 HydrophobicContact CG2-CG 3.64Å
28	L	55	Low	62.8	Low	111 Å²	111	81.6 Å²	81.6	58%	0.581	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	47.4	52.1	176.2	-92.8	149.4	0	0	0	115.7	N85 L87	L28-N85 HydrophobicContact CB-CB 4.26Å; L28-N85 WeakPolarHBondContact O-CB 3.35Å; L28-N85 PolarHBondContact O-ND2 3.25Å; L28-L87 HydrophobicContact CD1-CD1 3.64Å; L28-L87 HydrophobicContact CD1-CG 4.16Å
29	G	51.2	Low	64	Low	48 Å²	48	86 Å²	86	50%	0.495	47%	0.468	S	S	.	.	T	Hydrogen-bonded Turn	trans	93.2	76.5	167.1	0	0	0	0	0	112.6	I27	I27-G29 PolarHBondContact O-N 2.89Å
30	S	57.9	Low	65.7	Low	78 Å²	78	83.8 Å²	83.8	55%	0.545	45%	0.449	S	S	.	.	T	Hydrogen-bonded Turn	trans	90.8	-4.1	162.3	-126.3	0	0	0	0	117.7
31	G	64.4	Low	67.8	Low	0 Å²	0	82.1 Å²	82.1	0%	0	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.8	136.7	178.7	0	0	0	0	0	114.4	A25 Q26 I27 S82 P84 C86	A25-G31 VanDerWaalsContact O-O 3.13Å; Q26-G31 VanDerWaalsContact CA-O 3.26Å; Q26-G31 WeakPolarHBondContact CA-O 3.48Å; I27-G31 PolarHBondContact N-O 2.74Å; G31-S82 CarbonylContact C-O 3.56Å; G31-S82 WeakPolarHBondContact CA-O 3.45Å; G31-P84 PolarHBondContact N-O 3.3Å; G31-C86 WeakPolarHBondContact CA-SG 3.47Å
32	Q	70.9	Confident	70	Confident	86 Å²	86	76.7 Å²	76.7	40%	0.402	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	119.6	180	-68.5	179.7	-31	0	0	112.7	D24 C80 R81 S82	D24-Q32 HydrophobicContact CB-CB 4.32Å; D24-Q32 HydrophobicContact CB-CG 4.32Å; Q32-C80 VanDerWaalsContact C-SG 3.59Å; Q32-C80 CarbonylContact O-C 3.56Å; Q32-C80 VanDerWaalsContact O-CA 3.28Å; Q32-C80 WeakPolarHBondContact O-CA 3.05Å; Q32-C80 WeakPolarHBondContact O-CB 3.32Å; Q32-C80 PolarHBondContact O-SG 3.23Å; Q32-C80 VanDerWaalsContact O-SG 3.34Å; Q32-R81 PolarHBondContact O-N 3.04Å; Q32-S82 WeakPolarHBondContact CB-OG 2.68Å; Q32-S82 PolarHBondContact N-O 3.45Å; Q32-S82 PolarHBondContact OE1-OG 2.76Å
33	C	76.5	Confident	72.1	Confident	4 Å²	4	74.7 Å²	74.7	3%	0.027	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.2	153.7	178.5	112.5	0	0	0	0	113.1	A25 L35 C75 C80	A25-C33 PolarHBondContact N-O 3.16Å; C33-L35 PolarHBondContact O-N 3.32Å; C33-C75 HydrophobicContact CB-CB 3.88Å; C33-C75 WeakPolarHBondContact CB-SG 3.36Å; C33-C75 VanDerWaalsContact SG-CA 3.54Å; C33-C75 WeakPolarHBondContact SG-CB 3.16Å; C33-C75 CovalentContact SG-SG 2Å; C33-C75 PolarHBondContact SG-SG 3.21Å; C33-C80 HydrophobicContact CB-CB 4.37Å; C33-C80 WeakPolarHBondContact CB-SG 3.09Å
34	R	77.1	Confident	74.1	Confident	197 Å²	197	70 Å²	70	74%	0.743	40%	0.395	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.6	108.4	166.4	-173.4	178.5	-177	-178	1	109.9
35	L	79.6	Confident	76.1	Confident	61 Å²	61	69.2 Å²	69.2	32%	0.319	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.4	135.7	170.3	-70.8	179.6	0	0	0	111	A25 I27 C33 P73 V74	A25-L35 HydrophobicContact CB-CD1 3.13Å; A25-L35 HydrophobicContact CB-CD2 3.89Å; A25-L35 HydrophobicContact CB-CG 3.35Å; I27-L35 HydrophobicContact CD1-CD2 3.88Å; I27-L35 HydrophobicContact CG1-CD2 4.41Å; C33-L35 PolarHBondContact O-N 3.32Å; L35-P73 HydrophobicContact CB-CB 4.44Å; L35-P73 HydrophobicContact CD1-CB 3.81Å; L35-P73 HydrophobicContact CD2-CB 4.06Å; L35-P73 HydrophobicContact CG-CB 4.34Å; L35-V74 CarbonylContact C-O 3.5Å; L35-V74 WeakPolarHBondContact CA-O 3.44Å
36	T	83.2	Confident	78	Confident	53 Å²	53	68 Å²	68	33%	0.325	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	119.3	173.9	-48.2	0	0	0	0	107.1	I38 V74 G76	T36-I38 PolarHBondContact O-N 3.48Å; T36-V74 PolarHBondContact N-O 3.03Å; T36-V74 WeakPolarHBondContact O-CG2 3.26Å; T36-V74 PolarHBondContact O-N 3.05Å; T36-V74 VanDerWaalsContact O-N 3.16Å; T36-G76 WeakPolarHBondContact OG1-CA 3.5Å; T36-G76 PolarHBondContact OG1-N 3Å
37	P	87.2	Confident	79.9	Confident	96 Å²	96	60.8 Å²	60.8	62%	0.623	35%	0.348	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73	124.2	176	28.1	-31.4	0	0	0	109.7	V71	P37-V71 HydrophobicContact CB-CG1 3.56Å
38	I	88.2	Confident	81.4	Confident	36 Å²	36	60.2 Å²	60.2	19%	0.185	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	140.6	170.7	-0.1	158	0	0	0	109.6	T36 V71 V72 V74 L89 T92	T36-I38 PolarHBondContact O-N 3.48Å; I38-V71 CarbonylContact O-C 3.47Å; I38-V71 WeakPolarHBondContact O-CA 3.43Å; I38-V72 PolarHBondContact N-O 3.04Å; I38-V72 PolarHBondContact O-N 3.03Å; I38-V74 HydrophobicContact CD1-CB 4.22Å; I38-V74 HydrophobicContact CD1-CG1 3.77Å; I38-V74 HydrophobicContact CD1-CG2 3.41Å; I38-V74 VanDerWaalsContact CD1-CG2 3.41Å; I38-V74 HydrophobicContact CG1-CB 4.46Å; I38-V74 HydrophobicContact CG1-CG1 4.26Å; I38-V74 HydrophobicContact CG1-CG2 3.4Å; I38-V74 VanDerWaalsContact CG1-CG2 3.4Å; I38-L89 HydrophobicContact CD1-CD1 3.51Å; I38-L89 HydrophobicContact CD1-CD2 3.51Å; I38-L89 HydrophobicContact CD1-CG 4.09Å; I38-L89 HydrophobicContact CG1-CD2 4.26Å; I38-T92 HydrophobicContact CD1-CG2 3.45Å; I38-T92 VanDerWaalsContact CD1-CG2 3.45Å; I38-T92 HydrophobicContact CG2-CG2 4.37Å
39	R	92.8	Very high	82.6	Confident	219 Å²	219	59.1 Å²	59.1	83%	0.826	33%	0.333	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.7	132.3	170.1	-71.2	-177.2	-176.1	-170.4	1.6	109.3	V71	R39-V71 HydrophobicContact CG-CG2 4.12Å
40	V	91.7	Very high	83.8	Confident	7 Å²	7	58.7 Å²	58.7	4%	0.042	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.7	128.1	178.5	-171.7	0	0	0	0	107.6	V46 I66 D69 A70 V72 T92	V40-V46 HydrophobicContact CB-CG2 4.36Å; V40-V46 HydrophobicContact CG1-CG2 4.18Å; V40-V46 HydrophobicContact CG2-CG2 3.53Å; V40-I66 HydrophobicContact CB-CB 4.5Å; V40-I66 HydrophobicContact CB-CG1 4.24Å; V40-I66 HydrophobicContact CB-CG2 4.38Å; V40-I66 HydrophobicContact CG1-CB 3.99Å; V40-I66 HydrophobicContact CG1-CG1 3.83Å; V40-I66 HydrophobicContact CG1-CG2 4.34Å; V40-D69 WeakPolarHBondContact O-CA 3.1Å; V40-A70 PolarHBondContact N-O 3.02Å; V40-A70 PolarHBondContact O-N 3.5Å; V40-V72 HydrophobicContact CB-CG2 4.45Å; V40-V72 HydrophobicContact CG2-CB 4.42Å; V40-V72 HydrophobicContact CG2-CG2 4.03Å; V40-T92 HydrophobicContact CG2-CG2 4.12Å
41	S	95.1	Very high	84.4	Confident	84 Å²	84	55 Å²	55	59%	0.587	29%	0.294	S	S	*	.			trans	-71.9	157.3	179.4	-60.7	0	0	0	0	111.8	G43 G44 D69	S41-G43 PolarHBondContact O-N 3.28Å; S41-G44 WeakPolarHBondContact O-CA 3.17Å; S41-G44 PolarHBondContact O-N 3.27Å; S41-D69 WeakPolarHBondContact CA-OD1 3.38Å
42	A	93.8	Very high	84.4	Confident	57 Å²	57	60.1 Å²	60.1	47%	0.471	32%	0.316	S	S	.	.	T	Hydrogen-bonded Turn	trans	-51.8	130.2	170.9	0	0	0	0	0	111	G44 D69	A42-G44 VanDerWaalsContact C-N 3.26Å; A42-G44 PolarHBondContact O-N 3.46Å; A42-D69 PolarHBondContact N-OD1 3.11Å
43	G	93.5	Very high	84.1	Confident	56 Å²	56	64.6 Å²	64.6	58%	0.577	33%	0.33	S	S	*	.	T	Hydrogen-bonded Turn	trans	83	-8.2	-175.2	0	0	0	0	0	114.9	S41 I66	S41-G43 PolarHBondContact O-N 3.28Å; G43-I66 WeakPolarHBondContact CA-O 3.36Å; G43-I66 PolarHBondContact N-O 3.39Å
44	G	94	Very high	83.3	Confident	18 Å²	18	74.7 Å²	74.7	19%	0.186	37%	0.367	C	S	.	.			trans	-65.3	168.2	174.7	0	0	0	0	0	113.1	S41 A42 I66	S41-G44 WeakPolarHBondContact O-CA 3.17Å; S41-G44 PolarHBondContact O-N 3.27Å; A42-G44 VanDerWaalsContact C-N 3.26Å; A42-G44 PolarHBondContact O-N 3.46Å; G44-I66 PolarHBondContact O-N 3.45Å
45	T	93.8	Very high	82.8	Confident	42 Å²	42	72.4 Å²	72.4	26%	0.258	37%	0.369	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	114.6	-175.5	-57.4	0	0	0	0	111	C63 R64 T92	T45-C63 HydrophobicContact CG2-CB 4Å; T45-R64 CarbonylContact C-O 3.55Å; T45-R64 WeakPolarHBondContact CA-O 3.35Å; T45-T92 PolarHBondContact N-OXT 3.17Å; T45-T92 CarbonylContact O-C 3.57Å; T45-T92 VanDerWaalsContact O-C 3.24Å; T45-T92 WeakPolarHBondContact O-CA 3.47Å
46	V	90.5	Very high	82	Confident	0 Å²	0	74 Å²	74	0%	0	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	117.8	173.6	-177.6	0	0	0	0	108.8	V40 E48 C63 R64 I66 V72 V74 L89 T92	V40-V46 HydrophobicContact CB-CG2 4.36Å; V40-V46 HydrophobicContact CG1-CG2 4.18Å; V40-V46 HydrophobicContact CG2-CG2 3.53Å; V46-E48 HydrophobicContact CG1-CG 3.97Å; V46-C63 CarbonylContact O-C 3.44Å; V46-C63 WeakPolarHBondContact O-CA 3.04Å; V46-R64 HydrophobicContact CB-CG 3.94Å; V46-R64 PolarHBondContact N-O 3.29Å; V46-R64 WeakPolarHBondContact O-CG 2.97Å; V46-R64 PolarHBondContact O-N 2.95Å; V46-I66 HydrophobicContact CG2-CD1 4.19Å; V46-I66 HydrophobicContact CG2-CG1 3.83Å; V46-V72 HydrophobicContact CG2-CB 4.42Å; V46-V72 HydrophobicContact CG2-CG1 4.32Å; V46-V72 HydrophobicContact CG2-CG2 4.28Å; V46-V74 HydrophobicContact CG1-CG1 3.91Å; V46-L89 HydrophobicContact CG1-CD1 3.93Å; V46-T92 HydrophobicContact CG2-CG2 4.36Å
47	C	87.5	Confident	81.1	Confident	1 Å²	1	83.2 Å²	83.2	1%	0.007	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	130.4	173.1	-67.3	0	0	0	0	110.4	L62 C63 L90 Y91	C47-L62 CarbonylContact C-O 3.58Å; C47-L62 WeakPolarHBondContact CA-O 3.41Å; C47-C63 HydrophobicContact CB-CB 4.19Å; C47-C63 WeakPolarHBondContact CB-SG 3.44Å; C47-C63 WeakPolarHBondContact SG-CB 3.36Å; C47-C63 CovalentContact SG-SG 2.04Å; C47-C63 PolarHBondContact SG-SG 3.43Å; C47-L90 VanDerWaalsContact O-CB 3.31Å; C47-L90 WeakPolarHBondContact O-CB 3.23Å; C47-L90 PolarHBondContact O-N 2.93Å; C47-Y91 HydrophobicContact CB-CD1 4.08Å; C47-Y91 HydrophobicContact CB-CD2 4.19Å; C47-Y91 HydrophobicContact CB-CE1 3.73Å; C47-Y91 HydrophobicContact CB-CE2 3.87Å; C47-Y91 HydrophobicContact CB-CG 4.3Å; C47-Y91 PolarHBondContact N-O 3Å; C47-Y91 PolarHBondContact O-N 3.39Å; C47-Y91 WeakPolarHBondContact SG-CE2 3.35Å; C47-Y91 PolarHBondContact SG-OH 2.81Å
48	E	84.8	Confident	79.9	Confident	10 Å²	10	79.9 Å²	79.9	5%	0.047	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	149.3	-179.1	-49.7	175.7	73.6	0	0	109.5	V46 S61 L62 R64 L87 Q88	V46-E48 HydrophobicContact CG1-CG 3.97Å; E48-S61 CarbonylContact O-C 3.49Å; E48-S61 WeakPolarHBondContact O-CA 3.36Å; E48-L62 PolarHBondContact N-O 3.37Å; E48-L62 PolarHBondContact O-N 2.72Å; E48-R64 IonicContact OE1-NH2 3.97Å; E48-R64 IonicContact OE2-CZ 3.28Å; E48-R64 VanDerWaalsContact OE2-CZ 3.28Å; E48-R64 IonicContact OE2-NE 3.23Å; E48-R64 PolarHBondContact OE2-NE 3.17Å; E48-R64 IonicContact OE2-NH2 2.74Å; E48-R64 PolarHBondContact OE2-NH2 3.26Å; E48-L87 HydrophobicContact CB-CB 3.8Å; E48-L87 HydrophobicContact CB-CD1 4.25Å; E48-Q88 CarbonylContact C-O 3.51Å; E48-Q88 WeakPolarHBondContact CA-O 3.34Å
49	R	79.7	Confident	78.6	Confident	88 Å²	88	82.4 Å²	82.4	33%	0.332	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	146.2	173.3	59.3	179.7	-166.7	173.4	8.9	111.4	C51 L87 Q88 L90	R49-C51 PolarHBondContact O-N 3.06Å; R49-L87 CarbonylContact O-C 3.24Å; R49-L87 VanDerWaalsContact O-CA 3.27Å; R49-L87 WeakPolarHBondContact O-CA 3.22Å; R49-Q88 HydrophobicContact CG-CB 4.12Å; R49-Q88 VanDerWaalsContact CZ-OE1 3.23Å; R49-Q88 PolarHBondContact N-O 3.04Å; R49-Q88 PolarHBondContact O-N 2.98Å; R49-L90 HydrophobicContact CB-CD1 3.55Å; R49-L90 HydrophobicContact CG-CD1 3.85Å; R49-L90 HydrophobicContact CG-CG 4.31Å
50	L	76.9	Confident	77.5	Confident	39 Å²	39	77.4 Å²	77.4	20%	0.204	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.8	129.8	168.7	-138.3	110.9	0	0	0	110	Y56 C86 L87	L50-Y56 HydrophobicContact CD2-CE1 4.18Å; L50-C86 CarbonylContact C-O 3.51Å; L50-C86 WeakPolarHBondContact CA-O 3.4Å; L50-L87 HydrophobicContact CB-CD2 4.41Å; L50-L87 HydrophobicContact CD1-CD2 3.92Å; L50-L87 HydrophobicContact CG-CD2 4.35Å
51	C	70.5	Confident	77	Confident	1 Å²	1	79.7 Å²	79.7	1%	0.007	42%	0.415	C	S	.	.			trans	-136.3	75.9	-166.3	-145.2	0	0	0	0	109.2	R49 C79 C86 Q88	R49-C51 PolarHBondContact O-N 3.06Å; C51-C79 VanDerWaalsContact CA-SG 3.58Å; C51-C79 HydrophobicContact CB-CB 3.73Å; C51-C79 WeakPolarHBondContact CB-SG 3.48Å; C51-C79 WeakPolarHBondContact SG-CA 3.44Å; C51-C79 WeakPolarHBondContact SG-CB 3.41Å; C51-C79 CovalentContact SG-SG 2Å; C51-C79 PolarHBondContact SG-SG 3.32Å; C51-C86 PolarHBondContact N-O 2.96Å; C51-Q88 HydrophobicContact CB-CB 3.81Å; C51-Q88 PolarHBondContact SG-OE1 3.36Å
52	F	65.8	Low	76.4	Confident	107 Å²	107	80 Å²	80	47%	0.469	41%	0.409	S	S	.	.	S	Bend	trans	-80.7	-31.8	177.6	-173.6	-111.5	0	0	0	112.5	Y56 P84	F52-Y56 HydrophobicContact CB-CD1 4.28Å; F52-Y56 HydrophobicContact CB-CG 4.39Å; F52-P84 HydrophobicContact CD2-CB 4.42Å; F52-P84 HydrophobicContact CE2-CB 4.18Å
53	R	62.8	Low	76.1	Confident	181 Å²	181	80.4 Å²	80.4	68%	0.683	41%	0.408	S	S	*	.	S	Bend	trans	-147.8	155.8	174.8	-67.7	-171.9	-179.6	-173.4	-0.2	109.1	D55 Y56 C79	R53-D55 PolarHBondContact O-N 3.37Å; R53-Y56 WeakPolarHBondContact O-CB 3.36Å; R53-Y56 PolarHBondContact O-N 2.82Å; R53-C79 VanDerWaalsContact C-SG 3.54Å; R53-C79 PolarHBondContact O-SG 2.83Å; R53-C79 VanDerWaalsContact O-SG 3.38Å
54	R	60.1	Low	75.9	Confident	216 Å²	216	82.4 Å²	82.4	82%	0.815	40%	0.398	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.4	-35	-175.7	-126.8	-179.2	-172.7	-175.3	1.6	113.6
55	D	66.4	Low	75.8	Confident	148 Å²	148	91.6 Å²	91.6	79%	0.791	43%	0.427	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.9	5.4	-176	-47	-53.1	0	0	0	113.2	R53 R57	R53-D55 PolarHBondContact O-N 3.37Å; D55-R57 PolarHBondContact O-N 2.87Å; D55-R57 VanDerWaalsContact O-N 3.08Å
56	Y	63	Low	75.7	Confident	95 Å²	95	90.2 Å²	90.2	37%	0.373	42%	0.418	S	S	.	.			trans	-71.2	106.4	179.3	-173.3	-111.1	0	0	0	109.9	L50 F52 R53 G58 P59	L50-Y56 HydrophobicContact CD2-CE1 4.18Å; F52-Y56 HydrophobicContact CB-CD1 4.28Å; F52-Y56 HydrophobicContact CB-CG 4.39Å; R53-Y56 WeakPolarHBondContact O-CB 3.36Å; R53-Y56 PolarHBondContact O-N 2.82Å; Y56-G58 VanDerWaalsContact CZ-CA 3.48Å; Y56-G58 PolarHBondContact O-N 3.43Å; Y56-P59 WeakPolarHBondContact OH-CD 3.38Å
57	R	65.6	Low	75.9	Confident	247 Å²	247	95.8 Å²	95.8	93%	0.932	45%	0.454	S	S	*	.			trans	-87.7	50.9	171.2	-63.7	-174.3	-178.1	-174.3	0.2	111	D55	D55-R57 PolarHBondContact O-N 2.87Å; D55-R57 VanDerWaalsContact O-N 3.08Å
58	G	60.6	Low	76.2	Confident	26 Å²	26	105 Å²	105	27%	0.268	49%	0.489	S	S	.	.	P	Polyproline II helix	trans	-59.1	172.1	-175.9	0	0	0	0	0	115.5	Y56	Y56-G58 VanDerWaalsContact CZ-CA 3.48Å; Y56-G58 PolarHBondContact O-N 3.43Å
59	P	60.8	Low	76.7	Confident	88 Å²	88	110.3 Å²	110.3	57%	0.571	52%	0.518	S	S	*	.	S	Bend	trans	-56.9	163.6	-177.2	25.8	-34	0	0	0	113	Y56	Y56-P59 WeakPolarHBondContact OH-CD 3.38Å
60	P	70.7	Confident	77.3	Confident	114 Å²	114	107.8 Å²	107.8	74%	0.74	52%	0.516	S	S	*	.	P	Polyproline II helix	trans	-63.8	152.4	-143.9	26.3	-33.9	0	0	0	113.5	L62	P60-L62 PolarHBondContact O-N 2.9Å
61	S	80.2	Confident	78	Confident	56 Å²	56	110.2 Å²	110.2	39%	0.392	53%	0.532	S	S	.	.			trans	-43	126.2	175.1	46.2	0	0	0	0	112.2	E48 C63	E48-S61 CarbonylContact O-C 3.49Å; E48-S61 WeakPolarHBondContact O-CA 3.36Å; S61-C63 PolarHBondContact O-N 3.32Å
62	L	83.1	Confident	78.8	Confident	90 Å²	90	110.6 Å²	110.6	47%	0.471	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.9	110.4	172	-80.4	147.9	0	0	0	108.6	C47 E48 P60 L87	C47-L62 CarbonylContact C-O 3.58Å; C47-L62 WeakPolarHBondContact CA-O 3.41Å; E48-L62 PolarHBondContact N-O 3.37Å; E48-L62 PolarHBondContact O-N 2.72Å; P60-L62 PolarHBondContact O-N 2.9Å; L62-L87 HydrophobicContact CD1-CD1 4.24Å; L62-L87 HydrophobicContact CD1-CD2 3.54Å
63	C	88.2	Confident	79.6	Confident	66 Å²	66	108.8 Å²	108.8	45%	0.446	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	131.3	177.9	-65.6	0	0	0	0	110.7	T45 V46 C47 S61	T45-C63 HydrophobicContact CG2-CB 4Å; V46-C63 CarbonylContact O-C 3.44Å; V46-C63 WeakPolarHBondContact O-CA 3.04Å; C47-C63 HydrophobicContact CB-CB 4.19Å; C47-C63 WeakPolarHBondContact CB-SG 3.44Å; C47-C63 WeakPolarHBondContact SG-CB 3.36Å; C47-C63 CovalentContact SG-SG 2.04Å; C47-C63 PolarHBondContact SG-SG 3.43Å; S61-C63 PolarHBondContact O-N 3.32Å
64	R	88	Confident	80.4	Confident	98 Å²	98	100.1 Å²	100.1	37%	0.37	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	130.5	173.4	56.7	177	164.5	173.8	-8.4	110.2	T45 V46 E48 I66	T45-R64 CarbonylContact C-O 3.55Å; T45-R64 WeakPolarHBondContact CA-O 3.35Å; V46-R64 HydrophobicContact CB-CG 3.94Å; V46-R64 PolarHBondContact N-O 3.29Å; V46-R64 WeakPolarHBondContact O-CG 2.97Å; V46-R64 PolarHBondContact O-N 2.95Å; E48-R64 IonicContact OE1-NH2 3.97Å; E48-R64 IonicContact OE2-CZ 3.28Å; E48-R64 VanDerWaalsContact OE2-CZ 3.28Å; E48-R64 IonicContact OE2-NE 3.23Å; E48-R64 PolarHBondContact OE2-NE 3.17Å; E48-R64 IonicContact OE2-NH2 2.74Å; E48-R64 PolarHBondContact OE2-NH2 3.26Å; R64-I66 HydrophobicContact CG-CD1 4.29Å
65	R	92.7	Very high	81.2	Confident	210 Å²	210	90 Å²	90	79%	0.792	46%	0.462	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.7	139.9	169.2	-84.7	-172.7	-178.6	-168	1.6	110.3
66	I	92.7	Very high	81.2	Confident	14 Å²	14	84.6 Å²	84.6	7%	0.072	44%	0.442	C	S	.	.			trans	-104.3	109.3	178.5	-58.9	-54.8	0	0	0	107.9	V40 G43 G44 V46 R64 R68 A70 V72	V40-I66 HydrophobicContact CB-CB 4.5Å; V40-I66 HydrophobicContact CB-CG1 4.24Å; V40-I66 HydrophobicContact CB-CG2 4.38Å; V40-I66 HydrophobicContact CG1-CB 3.99Å; V40-I66 HydrophobicContact CG1-CG1 3.83Å; V40-I66 HydrophobicContact CG1-CG2 4.34Å; G43-I66 WeakPolarHBondContact CA-O 3.36Å; G43-I66 PolarHBondContact N-O 3.39Å; G44-I66 PolarHBondContact O-N 3.45Å; V46-I66 HydrophobicContact CG2-CD1 4.19Å; V46-I66 HydrophobicContact CG2-CG1 3.83Å; R64-I66 HydrophobicContact CG-CD1 4.29Å; I66-R68 VanDerWaalsContact C-N 3.3Å; I66-R68 WeakPolarHBondContact CG2-O 3.32Å; I66-R68 PolarHBondContact O-N 3.14Å; I66-A70 HydrophobicContact CG2-CB 3.95Å; I66-V72 HydrophobicContact CD1-CG2 3.87Å; I66-V72 HydrophobicContact CG1-CG2 4.23Å
67	P	93.3	Very high	81.4	Confident	117 Å²	117	83.7 Å²	83.7	76%	0.76	46%	0.462	S	S	*	.	S	Bend	trans	-74.6	-18.3	-170.5	27.8	-34.6	0	0	0	114
68	R	94.7	Very high	81.5	Confident	194 Å²	194	72.9 Å²	72.9	73%	0.732	43%	0.427	S	S	*	.	S	Bend	trans	-147.1	156.1	-176.1	60.6	-178	177.7	-177.2	-0.7	109.8	I66 A70	I66-R68 VanDerWaalsContact C-N 3.3Å; I66-R68 WeakPolarHBondContact CG2-O 3.32Å; I66-R68 PolarHBondContact O-N 3.14Å; R68-A70 PolarHBondContact O-N 3.46Å; R68-A70 VanDerWaalsContact O-N 3.17Å
69	D	95.2	Very high	81.9	Confident	121 Å²	121	73.4 Å²	73.4	65%	0.647	43%	0.426	S	S	*	.			trans	-51.7	124.2	176.9	-60.1	-49.9	0	0	0	110.7	V40 S41 A42	V40-D69 WeakPolarHBondContact O-CA 3.1Å; S41-D69 WeakPolarHBondContact CA-OD1 3.38Å; A42-D69 PolarHBondContact N-OD1 3.11Å
70	A	93	Very high	82.2	Confident	36 Å²	36	70.1 Å²	70.1	30%	0.298	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.8	151.3	-173.5	0	0	0	0	0	112.1	V40 I66 R68 V72	V40-A70 PolarHBondContact N-O 3.02Å; V40-A70 PolarHBondContact O-N 3.5Å; I66-A70 HydrophobicContact CG2-CB 3.95Å; R68-A70 PolarHBondContact O-N 3.46Å; R68-A70 VanDerWaalsContact O-N 3.17Å; A70-V72 HydrophobicContact CB-CG2 4.27Å
71	V	91.3	Very high	82	Confident	90 Å²	90	75.9 Å²	75.9	55%	0.545	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	112.5	163.5	-179.3	0	0	0	0	107.2	P37 I38 R39	P37-V71 HydrophobicContact CB-CG1 3.56Å; I38-V71 CarbonylContact O-C 3.47Å; I38-V71 WeakPolarHBondContact O-CA 3.43Å; R39-V71 HydrophobicContact CG-CG2 4.12Å
72	V	85.7	Confident	81.4	Confident	8 Å²	8	75.6 Å²	75.6	5%	0.048	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102	120	-177.2	-175.3	0	0	0	0	108.7	I38 V40 V46 I66 A70 V74	I38-V72 PolarHBondContact N-O 3.04Å; I38-V72 PolarHBondContact O-N 3.03Å; V40-V72 HydrophobicContact CB-CG2 4.45Å; V40-V72 HydrophobicContact CG2-CB 4.42Å; V40-V72 HydrophobicContact CG2-CG2 4.03Å; V46-V72 HydrophobicContact CG2-CB 4.42Å; V46-V72 HydrophobicContact CG2-CG1 4.32Å; V46-V72 HydrophobicContact CG2-CG2 4.28Å; I66-V72 HydrophobicContact CD1-CG2 3.87Å; I66-V72 HydrophobicContact CG1-CG2 4.23Å; A70-V72 HydrophobicContact CB-CG2 4.27Å; V72-V74 HydrophobicContact CG1-CG1 4.03Å
73	P	83.3	Confident	80.3	Confident	69 Å²	69	72.8 Å²	72.8	45%	0.448	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.1	127.7	171.3	28.5	-30.6	0	0	0	110.1	L35	L35-P73 HydrophobicContact CB-CB 4.44Å; L35-P73 HydrophobicContact CD1-CB 3.81Å; L35-P73 HydrophobicContact CD2-CB 4.06Å; L35-P73 HydrophobicContact CG-CB 4.34Å
74	V	80.1	Confident	79.1	Confident	0 Å²	0	72.4 Å²	72.4	0%	0	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.3	164.2	176.4	-60.2	0	0	0	0	110.9	L35 T36 I38 V46 V72 G76 L89	L35-V74 CarbonylContact C-O 3.5Å; L35-V74 WeakPolarHBondContact CA-O 3.44Å; T36-V74 PolarHBondContact N-O 3.03Å; T36-V74 WeakPolarHBondContact O-CG2 3.26Å; T36-V74 PolarHBondContact O-N 3.05Å; T36-V74 VanDerWaalsContact O-N 3.16Å; I38-V74 HydrophobicContact CD1-CB 4.22Å; I38-V74 HydrophobicContact CD1-CG1 3.77Å; I38-V74 HydrophobicContact CD1-CG2 3.41Å; I38-V74 VanDerWaalsContact CD1-CG2 3.41Å; I38-V74 HydrophobicContact CG1-CB 4.46Å; I38-V74 HydrophobicContact CG1-CG1 4.26Å; I38-V74 HydrophobicContact CG1-CG2 3.4Å; I38-V74 VanDerWaalsContact CG1-CG2 3.4Å; V46-V74 HydrophobicContact CG1-CG1 3.91Å; V72-V74 HydrophobicContact CG1-CG1 4.03Å; V74-G76 PolarHBondContact O-N 3.45Å; V74-L89 HydrophobicContact CB-CB 4.21Å; V74-L89 HydrophobicContact CB-CD1 4.5Å; V74-L89 HydrophobicContact CG1-CD1 4.31Å; V74-L89 HydrophobicContact CG2-CB 3.81Å; V74-L89 HydrophobicContact CG2-CD1 4.22Å; V74-L89 HydrophobicContact CG2-CD2 4Å; V74-L89 HydrophobicContact CG2-CG 4.2Å
75	C	76.7	Confident	78.1	Confident	2 Å²	2	71.1 Å²	71.1	1%	0.014	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.6	91.4	164.5	-50.6	0	0	0	0	110	I27 C33 L87 L89	I27-C75 WeakPolarHBondContact CD1-SG 3.5Å; C33-C75 HydrophobicContact CB-CB 3.88Å; C33-C75 WeakPolarHBondContact CB-SG 3.36Å; C33-C75 VanDerWaalsContact SG-CA 3.54Å; C33-C75 WeakPolarHBondContact SG-CB 3.16Å; C33-C75 CovalentContact SG-SG 2Å; C33-C75 PolarHBondContact SG-SG 3.21Å; C75-L87 WeakPolarHBondContact CB-O 3.37Å; C75-L87 PolarHBondContact SG-O 3.48Å; C75-L89 PolarHBondContact O-N 2.97Å
76	G	66.5	Low	77.1	Confident	35 Å²	35	61.1 Å²	61.1	36%	0.361	36%	0.363	S	S	.	.			trans	-80.2	-18	-177.7	0	0	0	0	0	114.9	T36 V74	T36-G76 WeakPolarHBondContact OG1-CA 3.5Å; T36-G76 PolarHBondContact OG1-N 3Å; V74-G76 PolarHBondContact O-N 3.45Å
77	G	67.3	Low	76.4	Confident	77 Å²	77	61 Å²	61	79%	0.794	36%	0.362	S	S	*	.	S	Bend	trans	-97.7	0.7	-170.5	0	0	0	0	0	117
78	G	66.3	Low	75.7	Confident	20 Å²	20	57.1 Å²	57.1	21%	0.206	33%	0.334	C	S	.	.	S	Bend	trans	131.7	-172.7	-174.7	0	0	0	0	0	113.4
79	C	69.2	Low	75.1	Confident	36 Å²	36	49.8 Å²	49.8	24%	0.243	31%	0.309	C	S	.	.	S	Bend	trans	-61.9	161.2	172.1	-66.6	0	0	0	0	111.6	C51 R53	C51-C79 VanDerWaalsContact CA-SG 3.58Å; C51-C79 HydrophobicContact CB-CB 3.73Å; C51-C79 WeakPolarHBondContact CB-SG 3.48Å; C51-C79 WeakPolarHBondContact SG-CA 3.44Å; C51-C79 WeakPolarHBondContact SG-CB 3.41Å; C51-C79 CovalentContact SG-SG 2Å; C51-C79 PolarHBondContact SG-SG 3.32Å; R53-C79 VanDerWaalsContact C-SG 3.54Å; R53-C79 PolarHBondContact O-SG 2.83Å; R53-C79 VanDerWaalsContact O-SG 3.38Å
80	C	67.5	Low	74.4	Confident	20 Å²	20	48.1 Å²	48.1	14%	0.135	30%	0.299	C	S	.	.			trans	-60.8	152.2	174.3	-74.2	0	0	0	0	114	Q32 C33 S82 C86	Q32-C80 VanDerWaalsContact C-SG 3.59Å; Q32-C80 CarbonylContact O-C 3.56Å; Q32-C80 VanDerWaalsContact O-CA 3.28Å; Q32-C80 WeakPolarHBondContact O-CA 3.05Å; Q32-C80 WeakPolarHBondContact O-CB 3.32Å; Q32-C80 PolarHBondContact O-SG 3.23Å; Q32-C80 VanDerWaalsContact O-SG 3.34Å; C33-C80 HydrophobicContact CB-CB 4.37Å; C33-C80 WeakPolarHBondContact CB-SG 3.09Å; C80-S82 VanDerWaalsContact C-N 3.35Å; C80-C86 HydrophobicContact CB-CB 3.35Å; C80-C86 WeakPolarHBondContact CB-SG 3.32Å; C80-C86 WeakPolarHBondContact SG-CB 3.31Å; C80-C86 CovalentContact SG-SG 1.94Å; C80-C86 PolarHBondContact SG-SG 3.46Å
81	R	67.4	Low	74	Confident	235 Å²	235	52.5 Å²	52.5	89%	0.887	31%	0.309	S	S	*	.	S	Bend	trans	-70.4	-35.4	173.9	-75.9	-175.1	172.5	-174.1	-2.4	111.4	Q32	Q32-R81 PolarHBondContact O-N 3.04Å
82	S	66.1	Low	73.7	Confident	49 Å²	49	52.5 Å²	52.5	34%	0.343	31%	0.309	S	S	.	.	B	Isolated β-bridge	trans	-153.9	162	-176.5	72.8	0	0	0	0	110.9	G31 Q32 C80	G31-S82 CarbonylContact C-O 3.56Å; G31-S82 WeakPolarHBondContact CA-O 3.45Å; Q32-S82 WeakPolarHBondContact CB-OG 2.68Å; Q32-S82 PolarHBondContact N-O 3.45Å; Q32-S82 PolarHBondContact OE1-OG 2.76Å; C80-S82 VanDerWaalsContact C-N 3.35Å
83	G	61.2	Low	73.1	Confident	31 Å²	31	54.7 Å²	54.7	32%	0.32	32%	0.322	S	S	.	.	S	Bend	trans	83.1	153.6	172.2	0	0	0	0	0	115.7
84	P	63.4	Low	72.6	Confident	59 Å²	59	53.9 Å²	53.9	38%	0.383	32%	0.316	S	S	.	.	S	Bend	trans	-71.4	163.2	178.8	30.1	-33.4	0	0	0	112.7	G31 F52 C86	G31-P84 PolarHBondContact N-O 3.3Å; F52-P84 HydrophobicContact CD2-CB 4.42Å; F52-P84 HydrophobicContact CE2-CB 4.18Å; P84-C86 VanDerWaalsContact C-N 3.34Å; P84-C86 PolarHBondContact O-N 3.49Å
85	N	66.7	Low	72.2	Confident	71 Å²	71	56.9 Å²	56.9	38%	0.38	33%	0.333	S	S	.	.			trans	66.2	17.7	163.8	-56.6	-28.5	0	0	0	119	L28	L28-N85 HydrophobicContact CB-CB 4.26Å; L28-N85 WeakPolarHBondContact O-CB 3.35Å; L28-N85 PolarHBondContact O-ND2 3.25Å
86	C	72.2	Confident	71.9	Confident	0 Å²	0	60.2 Å²	60.2	0%	0	35%	0.352	C	S	.	.			trans	-66.1	144.8	173.6	-99.2	0	0	0	0	114.3	G31 L50 C51 C80 P84	G31-C86 WeakPolarHBondContact CA-SG 3.47Å; L50-C86 CarbonylContact C-O 3.51Å; L50-C86 WeakPolarHBondContact CA-O 3.4Å; C51-C86 PolarHBondContact N-O 2.96Å; C80-C86 HydrophobicContact CB-CB 3.35Å; C80-C86 WeakPolarHBondContact CB-SG 3.32Å; C80-C86 WeakPolarHBondContact SG-CB 3.31Å; C80-C86 CovalentContact SG-SG 1.94Å; C80-C86 PolarHBondContact SG-SG 3.46Å; P84-C86 VanDerWaalsContact C-N 3.34Å; P84-C86 PolarHBondContact O-N 3.49Å
87	L	76.3	Confident	72.2	Confident	10 Å²	10	61.8 Å²	61.8	5%	0.052	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	129.5	175.6	-57	179.3	0	0	0	111.2	I27 L28 E48 R49 L50 L62 C75	I27-L87 HydrophobicContact CG2-CB 3.79Å; I27-L87 HydrophobicContact CG2-CD1 3.86Å; I27-L87 HydrophobicContact CG2-CG 3.64Å; L28-L87 HydrophobicContact CD1-CD1 3.64Å; L28-L87 HydrophobicContact CD1-CG 4.16Å; E48-L87 HydrophobicContact CB-CB 3.8Å; E48-L87 HydrophobicContact CB-CD1 4.25Å; R49-L87 CarbonylContact O-C 3.24Å; R49-L87 VanDerWaalsContact O-CA 3.27Å; R49-L87 WeakPolarHBondContact O-CA 3.22Å; L50-L87 HydrophobicContact CB-CD2 4.41Å; L50-L87 HydrophobicContact CD1-CD2 3.92Å; L50-L87 HydrophobicContact CG-CD2 4.35Å; L62-L87 HydrophobicContact CD1-CD1 4.24Å; L62-L87 HydrophobicContact CD1-CD2 3.54Å; C75-L87 WeakPolarHBondContact CB-O 3.37Å; C75-L87 PolarHBondContact SG-O 3.48Å
88	Q	78.9	Confident	72.6	Confident	37 Å²	37	60.7 Å²	60.7	17%	0.173	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	135.2	171.8	-178.3	-168.3	-1.5	0	0	109.8	E48 R49 C51 L90	E48-Q88 CarbonylContact C-O 3.51Å; E48-Q88 WeakPolarHBondContact CA-O 3.34Å; R49-Q88 HydrophobicContact CG-CB 4.12Å; R49-Q88 VanDerWaalsContact CZ-OE1 3.23Å; R49-Q88 PolarHBondContact N-O 3.04Å; R49-Q88 PolarHBondContact O-N 2.98Å; C51-Q88 HydrophobicContact CB-CB 3.81Å; C51-Q88 PolarHBondContact SG-OE1 3.36Å; Q88-L90 PolarHBondContact O-N 3.01Å
89	L	82.2	Confident	73	Confident	40 Å²	40	63.6 Å²	63.6	21%	0.209	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-57.1	129.8	170.5	-178.1	66.8	0	0	0	111.2	I38 V46 V74 C75 T92	I38-L89 HydrophobicContact CD1-CD1 3.51Å; I38-L89 HydrophobicContact CD1-CD2 3.51Å; I38-L89 HydrophobicContact CD1-CG 4.09Å; I38-L89 HydrophobicContact CG1-CD2 4.26Å; V46-L89 HydrophobicContact CG1-CD1 3.93Å; V74-L89 HydrophobicContact CB-CB 4.21Å; V74-L89 HydrophobicContact CB-CD1 4.5Å; V74-L89 HydrophobicContact CG1-CD1 4.31Å; V74-L89 HydrophobicContact CG2-CB 3.81Å; V74-L89 HydrophobicContact CG2-CD1 4.22Å; V74-L89 HydrophobicContact CG2-CD2 4Å; V74-L89 HydrophobicContact CG2-CG 4.2Å; C75-L89 PolarHBondContact O-N 2.97Å; L89-T92 HydrophobicContact CD1-CG2 4.04Å
90	L	81.9	Confident	73.3	Confident	85 Å²	85	65.8 Å²	65.8	45%	0.445	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	-55.5	174.6	-117.6	155.2	0	0	0	110.4	C47 R49 Q88	C47-L90 VanDerWaalsContact O-CB 3.31Å; C47-L90 WeakPolarHBondContact O-CB 3.23Å; C47-L90 PolarHBondContact O-N 2.93Å; R49-L90 HydrophobicContact CB-CD1 3.55Å; R49-L90 HydrophobicContact CG-CD1 3.85Å; R49-L90 HydrophobicContact CG-CG 4.31Å; Q88-L90 PolarHBondContact O-N 3.01Å
91	Y	83.8	Confident	73.8	Confident	129 Å²	129	69.6 Å²	69.6	51%	0.506	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-163.4	166.8	176.2	59	-89.9	0	0	0	111.3	C47	C47-Y91 HydrophobicContact CB-CD1 4.08Å; C47-Y91 HydrophobicContact CB-CD2 4.19Å; C47-Y91 HydrophobicContact CB-CE1 3.73Å; C47-Y91 HydrophobicContact CB-CE2 3.87Å; C47-Y91 HydrophobicContact CB-CG 4.3Å; C47-Y91 PolarHBondContact N-O 3Å; C47-Y91 PolarHBondContact O-N 3.39Å; C47-Y91 WeakPolarHBondContact SG-CE2 3.35Å; C47-Y91 PolarHBondContact SG-OH 2.81Å
92	T	85.5	Confident	74.4	Confident	89 Å²	89	54.5 Å²	54.5	55%	0.546	31%	0.305	S	S	.	.			trans	-123.6	0	178.5	56.7	0	0	0	0	111.7	I38 V40 T45 V46 L89	I38-T92 HydrophobicContact CD1-CG2 3.45Å; I38-T92 VanDerWaalsContact CD1-CG2 3.45Å; I38-T92 HydrophobicContact CG2-CG2 4.37Å; V40-T92 HydrophobicContact CG2-CG2 4.12Å; T45-T92 PolarHBondContact N-OXT 3.17Å; T45-T92 CarbonylContact O-C 3.57Å; T45-T92 VanDerWaalsContact O-C 3.24Å; T45-T92 WeakPolarHBondContact O-CA 3.47Å; V46-T92 HydrophobicContact CG2-CG2 4.36Å; L89-T92 HydrophobicContact CD1-CG2 4.04Å

Retrieved 92 of 92 residues in 53.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).