X2JD93_DROME Loading...

Cytochrome c oxidase subunit 6C-like, isoform C

AlphaFold DB , UniProt , Accession X2JD93, Species DROME (Drosophila melanogaster, Fruit fly), Gene COX6CL, Length 90 aa.

						>X2JD93_DROME|X2JD93|COX6CL
MPEEKPPEFKFPMHDLHLKQTFRNVKMACTLALLAPLLFYTLHNNPRKRKYRNFYSTYDPMDAFDRMMSGGYLSSCPPGSGPKKDDKKKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.5	Low	74.8	Confident	226 Å²	226	153.6 Å²	153.6	100%	1.113	77%	0.765	S	S	*	*				0	130.2	0	-58.5	-154.3	-75.8	0	0	106.5	E3	M1-E3 PolarHBondContact O-N 3.23Å
2	P	71.1	Confident	75.4	Confident	131 Å²	131	146.8 Å²	146.8	85%	0.851	74%	0.739	S	S	*	*	P	Polyproline II helix	trans	-67.5	122.4	175.4	28.2	-29.5	0	0	0	108	E4	P2-E4 PolarHBondContact O-N 3.11Å
3	E	74.3	Confident	76	Confident	189 Å²	189	148.2 Å²	148.2	88%	0.883	75%	0.745	S	S	*	*	P	Polyproline II helix	trans	-68.1	120.1	177.2	-70.6	177.4	169.6	0	0	109.5	M1 K5	M1-E3 PolarHBondContact O-N 3.23Å; E3-K5 PolarHBondContact O-N 2.67Å
4	E	75.6	Confident	76.8	Confident	188 Å²	188	148.3 Å²	148.3	88%	0.879	74%	0.741	S	S	*	*	P	Polyproline II helix	trans	-66.3	117.9	170.1	-73.9	-174.8	160	0	0	109.2	P2	P2-E4 PolarHBondContact O-N 3.11Å
5	K	78.7	Confident	77.6	Confident	158 Å²	158	144.9 Å²	144.9	69%	0.687	73%	0.727	S	S	*	*	P	Polyproline II helix	trans	-67.4	130.2	178.6	-168.4	176.4	175.6	-173.3	0	109.3	E3 E8	E3-K5 PolarHBondContact O-N 2.67Å; K5-E8 WeakPolarHBondContact CE-OE1 3.21Å; K5-E8 IonicContact NZ-OE1 2.67Å; K5-E8 PolarHBondContact NZ-OE1 3.43Å
6	P	75.9	Confident	78.4	Confident	98 Å²	98	141.5 Å²	141.5	64%	0.636	71%	0.711	S	S	*	*	P	Polyproline II helix	trans	-62.4	149.1	179.6	25	-33.5	0	0	0	110.9	E8	P6-E8 PolarHBondContact O-N 2.96Å
7	P	77.1	Confident	79.2	Confident	125 Å²	125	141.8 Å²	141.8	81%	0.812	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-59.9	123.6	-178.5	24	-32.8	0	0	0	110.2	F9	P7-F9 PolarHBondContact O-N 2.75Å
8	E	73.6	Confident	80	Confident	122 Å²	122	138.9 Å²	138.9	57%	0.57	70%	0.696	S	S	*	*			trans	-72.7	76.2	177.5	-70	-169.3	-171.8	0	0	110.6	K5 P6 K10	K5-E8 WeakPolarHBondContact CE-OE1 3.21Å; K5-E8 IonicContact NZ-OE1 2.67Å; K5-E8 PolarHBondContact NZ-OE1 3.43Å; P6-E8 PolarHBondContact O-N 2.96Å; E8-K10 PolarHBondContact O-N 3.41Å
9	F	75.5	Confident	80.8	Confident	141 Å²	141	138.4 Å²	138.4	62%	0.618	69%	0.689	S	S	*	*			trans	-79	113.1	167.5	-162.5	-70.4	0	0	0	109.2	P7 F11	P7-F9 PolarHBondContact O-N 2.75Å; F9-F11 HydrophobicContact CB-CE2 4.29Å; F9-F11 HydrophobicContact CD1-CB 4.41Å; F9-F11 AromaticContact CD1-CD1 3.65Å; F9-F11 HydrophobicContact CD1-CD1 3.65Å; F9-F11 AromaticContact CD1-CD2 3.28Å; F9-F11 HydrophobicContact CD1-CD2 3.28Å; F9-F11 AromaticContact CD1-CE1 3.5Å; F9-F11 HydrophobicContact CD1-CE1 3.5Å; F9-F11 VanDerWaalsContact CD1-CE1 3.5Å; F9-F11 AromaticContact CD1-CE2 3.13Å; F9-F11 HydrophobicContact CD1-CE2 3.13Å; F9-F11 AromaticContact CD1-CG 3.52Å; F9-F11 HydrophobicContact CD1-CG 3.52Å; F9-F11 AromaticContact CD1-CZ 3.22Å; F9-F11 HydrophobicContact CD1-CZ 3.22Å; F9-F11 HydrophobicContact CD2-CZ 4.41Å; F9-F11 HydrophobicContact CE1-CB 4.22Å; F9-F11 AromaticContact CE1-CD1 3.06Å; F9-F11 HydrophobicContact CE1-CD1 3.06Å; F9-F11 AromaticContact CE1-CD2 3.67Å; F9-F11 HydrophobicContact CE1-CD2 3.67Å; F9-F11 AromaticContact CE1-CE1 3Å; F9-F11 HydrophobicContact CE1-CE1 3Å; F9-F11 AromaticContact CE1-CE2 3.64Å; F9-F11 HydrophobicContact CE1-CE2 3.64Å; F9-F11 AromaticContact CE1-CG 3.37Å; F9-F11 HydrophobicContact CE1-CG 3.37Å; F9-F11 AromaticContact CE1-CZ 3.29Å; F9-F11 HydrophobicContact CE1-CZ 3.29Å; F9-F11 HydrophobicContact CE2-CE1 4.39Å; F9-F11 HydrophobicContact CE2-CZ 4.41Å; F9-F11 HydrophobicContact CG-CD2 4.33Å; F9-F11 HydrophobicContact CG-CE1 4.4Å; F9-F11 AromaticContact CG-CE2 3.83Å; F9-F11 HydrophobicContact CG-CE2 3.83Å; F9-F11 AromaticContact CG-CZ 3.85Å; F9-F11 HydrophobicContact CG-CZ 3.85Å; F9-F11 AromaticContact CZ-CD1 3.89Å; F9-F11 HydrophobicContact CZ-CD1 3.89Å; F9-F11 AromaticContact CZ-CE1 3.5Å; F9-F11 HydrophobicContact CZ-CE1 3.5Å; F9-F11 VanDerWaalsContact CZ-CE1 3.5Å; F9-F11 AromaticContact CZ-CZ 3.88Å; F9-F11 HydrophobicContact CZ-CZ 3.88Å
10	K	76	Confident	81.4	Confident	171 Å²	171	136.2 Å²	136.2	74%	0.743	68%	0.676	S	S	*	*			trans	-98.5	97.7	172	-68.1	-179.5	-174.8	171.4	0	109.6	E8	E8-K10 PolarHBondContact O-N 3.41Å
11	F	81.9	Confident	82.2	Confident	141 Å²	141	133.6 Å²	133.6	62%	0.618	67%	0.668	S	S	*	*			trans	-69.2	140.5	167.7	-64.4	-83.5	0	0	0	109.3	F9 M13	F9-F11 HydrophobicContact CB-CE2 4.29Å; F9-F11 HydrophobicContact CD1-CB 4.41Å; F9-F11 AromaticContact CD1-CD1 3.65Å; F9-F11 HydrophobicContact CD1-CD1 3.65Å; F9-F11 AromaticContact CD1-CD2 3.28Å; F9-F11 HydrophobicContact CD1-CD2 3.28Å; F9-F11 AromaticContact CD1-CE1 3.5Å; F9-F11 HydrophobicContact CD1-CE1 3.5Å; F9-F11 VanDerWaalsContact CD1-CE1 3.5Å; F9-F11 AromaticContact CD1-CE2 3.13Å; F9-F11 HydrophobicContact CD1-CE2 3.13Å; F9-F11 AromaticContact CD1-CG 3.52Å; F9-F11 HydrophobicContact CD1-CG 3.52Å; F9-F11 AromaticContact CD1-CZ 3.22Å; F9-F11 HydrophobicContact CD1-CZ 3.22Å; F9-F11 HydrophobicContact CD2-CZ 4.41Å; F9-F11 HydrophobicContact CE1-CB 4.22Å; F9-F11 AromaticContact CE1-CD1 3.06Å; F9-F11 HydrophobicContact CE1-CD1 3.06Å; F9-F11 AromaticContact CE1-CD2 3.67Å; F9-F11 HydrophobicContact CE1-CD2 3.67Å; F9-F11 AromaticContact CE1-CE1 3Å; F9-F11 HydrophobicContact CE1-CE1 3Å; F9-F11 AromaticContact CE1-CE2 3.64Å; F9-F11 HydrophobicContact CE1-CE2 3.64Å; F9-F11 AromaticContact CE1-CG 3.37Å; F9-F11 HydrophobicContact CE1-CG 3.37Å; F9-F11 AromaticContact CE1-CZ 3.29Å; F9-F11 HydrophobicContact CE1-CZ 3.29Å; F9-F11 HydrophobicContact CE2-CE1 4.39Å; F9-F11 HydrophobicContact CE2-CZ 4.41Å; F9-F11 HydrophobicContact CG-CD2 4.33Å; F9-F11 HydrophobicContact CG-CE1 4.4Å; F9-F11 AromaticContact CG-CE2 3.83Å; F9-F11 HydrophobicContact CG-CE2 3.83Å; F9-F11 AromaticContact CG-CZ 3.85Å; F9-F11 HydrophobicContact CG-CZ 3.85Å; F9-F11 AromaticContact CZ-CD1 3.89Å; F9-F11 HydrophobicContact CZ-CD1 3.89Å; F9-F11 AromaticContact CZ-CE1 3.5Å; F9-F11 HydrophobicContact CZ-CE1 3.5Å; F9-F11 VanDerWaalsContact CZ-CE1 3.5Å; F9-F11 AromaticContact CZ-CZ 3.88Å; F9-F11 HydrophobicContact CZ-CZ 3.88Å; F11-M13 PolarHBondContact O-N 2.85Å; F11-M13 VanDerWaalsContact O-N 3.11Å
12	P	82.1	Confident	83.7	Confident	71 Å²	71	129.5 Å²	129.5	46%	0.461	64%	0.644	S	S	.	*			trans	-64.4	114.6	169.1	1.2	9.4	0	0	0	108.4	L16	P12-L16 HydrophobicContact CB-CD2 3.87Å; P12-L16 HydrophobicContact CG-CD2 3.88Å; P12-L16 WeakPolarHBondContact O-CD1 3.33Å; P12-L16 WeakPolarHBondContact O-CD2 3.35Å; P12-L16 VanDerWaalsContact O-CG 3.24Å; P12-L16 WeakPolarHBondContact O-CG 3.24Å
13	M	82.3	Confident	85	Confident	165 Å²	165	131.1 Å²	131.1	81%	0.813	63%	0.633	S	S	*	*			trans	-86.8	-17.3	179.4	-67.8	-76.7	-88.9	0	0	112.7	F11	F11-M13 PolarHBondContact O-N 2.85Å; F11-M13 VanDerWaalsContact O-N 3.11Å
14	H	87.1	Confident	86.1	Confident	150 Å²	150	126.2 Å²	126.2	69%	0.694	61%	0.613	S	S	*	*	S	Bend	trans	-116	150.3	-176.6	-59.3	-56.8	0	0	0	112.2	L16	H14-L16 PolarHBondContact O-N 3.05Å
15	D	88.9	Confident	87.1	Confident	97 Å²	97	121 Å²	121	52%	0.519	59%	0.594	S	S	.	*	S	Bend	trans	58.6	16.6	174.1	-57	-39.7	0	0	0	116.2	H17 L18 K19	D15-H17 VanDerWaalsContact C-N 3.34Å; D15-H17 PolarHBondContact O-N 2.84Å; D15-L18 HydrophobicContact CB-CB 4.04Å; D15-L18 HydrophobicContact CB-CD2 4.2Å; D15-L18 PolarHBondContact O-N 3.36Å; D15-K19 WeakPolarHBondContact O-CB 3.43Å; D15-K19 WeakPolarHBondContact O-CG 3.16Å; D15-K19 PolarHBondContact O-N 3.41Å
16	L	91.4	Very high	88	Confident	91 Å²	91	120.6 Å²	120.6	48%	0.476	59%	0.592	S	S	.	*	H	α-helix	trans	-55.3	-50.8	176.4	-72.2	176.2	0	0	0	111	P12 H14 Q20	P12-L16 HydrophobicContact CB-CD2 3.87Å; P12-L16 HydrophobicContact CG-CD2 3.88Å; P12-L16 WeakPolarHBondContact O-CD1 3.33Å; P12-L16 WeakPolarHBondContact O-CD2 3.35Å; P12-L16 VanDerWaalsContact O-CG 3.24Å; P12-L16 WeakPolarHBondContact O-CG 3.24Å; H14-L16 PolarHBondContact O-N 3.05Å; L16-Q20 WeakPolarHBondContact O-CB 3.37Å; L16-Q20 PolarHBondContact O-N 2.86Å
17	H	91.7	Very high	89.1	Confident	146 Å²	146	120.9 Å²	120.9	68%	0.676	59%	0.586	S	S	*	*	H	α-helix	trans	-67.4	-36.6	178	-69.9	-67.9	0	0	0	112.9	D15 Q20 T21	D15-H17 VanDerWaalsContact C-N 3.34Å; D15-H17 PolarHBondContact O-N 2.84Å; H17-Q20 PolarHBondContact O-N 3.18Å; H17-T21 WeakPolarHBondContact O-CB 3.32Å; H17-T21 PolarHBondContact O-N 2.92Å; H17-T21 PolarHBondContact O-OG1 3.13Å
18	L	94.1	Very high	90.1	Very high	90 Å²	90	117.6 Å²	117.6	47%	0.471	57%	0.57	S	S	.	*	H	α-helix	trans	-63.3	-50.8	176.9	-172	89.5	0	0	0	110.5	D15 Q20 T21 F22	D15-L18 HydrophobicContact CB-CB 4.04Å; D15-L18 HydrophobicContact CB-CD2 4.2Å; D15-L18 PolarHBondContact O-N 3.36Å; L18-Q20 VanDerWaalsContact C-N 3.31Å; L18-Q20 PolarHBondContact O-N 3.4Å; L18-T21 PolarHBondContact O-N 3.2Å; L18-F22 HydrophobicContact CD1-CD2 4.47Å; L18-F22 HydrophobicContact CD1-CE2 3.9Å; L18-F22 HydrophobicContact CD2-CD2 4.35Å; L18-F22 HydrophobicContact CD2-CE2 3.99Å; L18-F22 HydrophobicContact CG-CD2 3.87Å; L18-F22 HydrophobicContact CG-CE2 3.67Å; L18-F22 VanDerWaalsContact O-CD2 3.27Å; L18-F22 WeakPolarHBondContact O-CD2 3.37Å; L18-F22 PolarHBondContact O-N 2.96Å
19	K	93.5	Very high	91.2	Very high	130 Å²	130	115.2 Å²	115.2	57%	0.565	57%	0.566	S	S	*	*	H	α-helix	trans	-60	-41.4	176.6	-71.9	174.2	-178.3	172.6	0	111.6	D15 R23	D15-K19 WeakPolarHBondContact O-CB 3.43Å; D15-K19 WeakPolarHBondContact O-CG 3.16Å; D15-K19 PolarHBondContact O-N 3.41Å; K19-R23 WeakPolarHBondContact O-CB 3.41Å; K19-R23 PolarHBondContact O-N 2.81Å
20	Q	94.4	Very high	92.3	Very high	94 Å²	94	111.2 Å²	111.2	44%	0.439	55%	0.553	S	S	.	*	H	α-helix	trans	-63.2	-43.9	175.6	-174.3	176	4.1	0	0	111.6	L16 H17 L18 R23 N24	L16-Q20 WeakPolarHBondContact O-CB 3.37Å; L16-Q20 PolarHBondContact O-N 2.86Å; H17-Q20 PolarHBondContact O-N 3.18Å; L18-Q20 VanDerWaalsContact C-N 3.31Å; L18-Q20 PolarHBondContact O-N 3.4Å; Q20-R23 PolarHBondContact O-N 3.28Å; Q20-N24 VanDerWaalsContact O-CG 3.28Å; Q20-N24 PolarHBondContact O-N 3.26Å; Q20-N24 PolarHBondContact O-OD1 3.4Å
21	T	96.6	Very high	93.3	Very high	82 Å²	82	108.1 Å²	108.1	50%	0.503	54%	0.544	S	S	.	.	H	α-helix	trans	-63.1	-47.7	178.5	-58	0	0	0	0	111	H17 L18 R23 N24 V25	H17-T21 WeakPolarHBondContact O-CB 3.32Å; H17-T21 PolarHBondContact O-N 2.92Å; H17-T21 PolarHBondContact O-OG1 3.13Å; L18-T21 PolarHBondContact O-N 3.2Å; T21-R23 VanDerWaalsContact C-N 3.3Å; T21-R23 PolarHBondContact O-N 2.83Å; T21-N24 PolarHBondContact O-N 3.4Å; T21-N24 VanDerWaalsContact O-N 3.13Å; T21-V25 HydrophobicContact CG2-CG2 4.38Å; T21-V25 WeakPolarHBondContact O-CG2 3.46Å; T21-V25 PolarHBondContact O-N 3.4Å
22	F	96.8	Very high	94.1	Very high	140 Å²	140	104.5 Å²	104.5	61%	0.614	54%	0.54	S	S	*	.	H	α-helix	trans	-60.4	-39.1	175.8	-83.1	-65	0	0	0	112.7	L18 V25 K26	L18-F22 HydrophobicContact CD1-CD2 4.47Å; L18-F22 HydrophobicContact CD1-CE2 3.9Å; L18-F22 HydrophobicContact CD2-CD2 4.35Å; L18-F22 HydrophobicContact CD2-CE2 3.99Å; L18-F22 HydrophobicContact CG-CD2 3.87Å; L18-F22 HydrophobicContact CG-CE2 3.67Å; L18-F22 VanDerWaalsContact O-CD2 3.27Å; L18-F22 WeakPolarHBondContact O-CD2 3.37Å; L18-F22 PolarHBondContact O-N 2.96Å; F22-V25 PolarHBondContact O-N 2.99Å; F22-K26 WeakPolarHBondContact O-CB 3.27Å; F22-K26 PolarHBondContact O-N 3.29Å
23	R	96.7	Very high	94.8	Very high	164 Å²	164	107.4 Å²	107.4	62%	0.619	55%	0.551	S	S	*	*	H	α-helix	trans	-61.6	-45.1	174.1	-171	178.3	72.6	-176.5	3.5	111.2	K19 Q20 T21 K26 M27	K19-R23 WeakPolarHBondContact O-CB 3.41Å; K19-R23 PolarHBondContact O-N 2.81Å; Q20-R23 PolarHBondContact O-N 3.28Å; T21-R23 VanDerWaalsContact C-N 3.3Å; T21-R23 PolarHBondContact O-N 2.83Å; R23-K26 PolarHBondContact O-N 3.2Å; R23-M27 VanDerWaalsContact O-CG 3.31Å; R23-M27 WeakPolarHBondContact O-CG 3.31Å; R23-M27 PolarHBondContact O-N 3.49Å
24	N	97.6	Very high	95.5	Very high	87 Å²	87	103.7 Å²	103.7	47%	0.465	53%	0.534	S	S	.	.	H	α-helix	trans	-65	-44.5	179.3	-69.4	-5.1	0	0	0	111.8	Q20 T21 K26 M27 A28	Q20-N24 VanDerWaalsContact O-CG 3.28Å; Q20-N24 PolarHBondContact O-N 3.26Å; Q20-N24 PolarHBondContact O-OD1 3.4Å; T21-N24 PolarHBondContact O-N 3.4Å; T21-N24 VanDerWaalsContact O-N 3.13Å; N24-K26 VanDerWaalsContact C-N 3.35Å; N24-K26 PolarHBondContact O-N 3.24Å; N24-M27 PolarHBondContact O-N 3.48Å; N24-A28 WeakPolarHBondContact O-CB 3.27Å; N24-A28 PolarHBondContact O-N 3.46Å
25	V	97.8	Very high	96	Very high	77 Å²	77	99.4 Å²	99.4	47%	0.467	53%	0.525	S	S	.	.	H	α-helix	trans	-61.1	-44.7	176	171.5	0	0	0	0	110.7	T21 F22 M27 A28 C29	T21-V25 HydrophobicContact CG2-CG2 4.38Å; T21-V25 WeakPolarHBondContact O-CG2 3.46Å; T21-V25 PolarHBondContact O-N 3.4Å; F22-V25 PolarHBondContact O-N 2.99Å; V25-M27 VanDerWaalsContact C-N 3.33Å; V25-M27 PolarHBondContact O-N 3.01Å; V25-A28 PolarHBondContact O-N 2.9Å; V25-C29 PolarHBondContact O-N 3Å; V25-C29 PolarHBondContact O-SG 3.38Å; V25-C29 VanDerWaalsContact O-SG 3.35Å
26	K	97.7	Very high	96.4	Very high	151 Å²	151	98.4 Å²	98.4	66%	0.657	52%	0.523	S	S	*	.	H	α-helix	trans	-57.4	-46.8	175.5	-177	178	178.6	178.3	0	111.3	F22 R23 N24 C29 T30	F22-K26 WeakPolarHBondContact O-CB 3.27Å; F22-K26 PolarHBondContact O-N 3.29Å; R23-K26 PolarHBondContact O-N 3.2Å; N24-K26 VanDerWaalsContact C-N 3.35Å; N24-K26 PolarHBondContact O-N 3.24Å; K26-C29 PolarHBondContact O-N 3.41Å; K26-T30 WeakPolarHBondContact O-CG2 3.37Å; K26-T30 PolarHBondContact O-N 3.33Å; K26-T30 PolarHBondContact O-OG1 3.43Å
27	M	97.7	Very high	96.7	Very high	103 Å²	103	98.9 Å²	98.9	51%	0.507	53%	0.526	S	S	.	.	H	α-helix	trans	-65.4	-38.2	177.3	-69.4	-58.1	-61.9	0	0	112.7	R23 N24 V25 T30 L31	R23-M27 VanDerWaalsContact O-CG 3.31Å; R23-M27 WeakPolarHBondContact O-CG 3.31Å; R23-M27 PolarHBondContact O-N 3.49Å; N24-M27 PolarHBondContact O-N 3.48Å; V25-M27 VanDerWaalsContact C-N 3.33Å; V25-M27 PolarHBondContact O-N 3.01Å; M27-T30 WeakPolarHBondContact CA-OG1 3.32Å; M27-T30 PolarHBondContact O-N 2.91Å; M27-T30 PolarHBondContact O-OG1 3.35Å; M27-L31 WeakPolarHBondContact O-CB 3.46Å; M27-L31 VanDerWaalsContact O-CG 3.27Å; M27-L31 WeakPolarHBondContact O-CG 3.33Å; M27-L31 PolarHBondContact O-N 2.92Å
28	A	97.9	Very high	97	Very high	57 Å²	57	96.1 Å²	96.1	47%	0.471	52%	0.516	S	S	.	.	H	α-helix	trans	-63.8	-46.2	176.7	0	0	0	0	0	111.1	N24 V25 T30 L31 A32	N24-A28 WeakPolarHBondContact O-CB 3.27Å; N24-A28 PolarHBondContact O-N 3.46Å; V25-A28 PolarHBondContact O-N 2.9Å; A28-T30 PolarHBondContact O-N 3.45Å; A28-L31 PolarHBondContact O-N 2.86Å; A28-A32 WeakPolarHBondContact O-CB 3.22Å; A28-A32 PolarHBondContact O-N 3.41Å
29	C	98	Very high	97.2	Very high	72 Å²	72	97.3 Å²	97.3	49%	0.486	52%	0.517	S	S	.	.	H	α-helix	trans	-62.4	-41.8	176.9	-68.3	0	0	0	0	112.2	V25 K26 A32 L33	V25-C29 PolarHBondContact O-N 3Å; V25-C29 PolarHBondContact O-SG 3.38Å; V25-C29 VanDerWaalsContact O-SG 3.35Å; K26-C29 PolarHBondContact O-N 3.41Å; C29-A32 PolarHBondContact O-N 2.92Å; C29-L33 WeakPolarHBondContact O-CG 3.42Å; C29-L33 PolarHBondContact O-N 3.48Å; C29-L33 VanDerWaalsContact O-N 3.1Å
30	T	97.9	Very high	97.4	Very high	57 Å²	57	96.6 Å²	96.6	35%	0.35	51%	0.512	S	S	.	.	H	α-helix	trans	-65.9	-44.1	178.2	55.3	0	0	0	0	111.6	K26 M27 A28 L33 L34	K26-T30 WeakPolarHBondContact O-CG2 3.37Å; K26-T30 PolarHBondContact O-N 3.33Å; K26-T30 PolarHBondContact O-OG1 3.43Å; M27-T30 WeakPolarHBondContact CA-OG1 3.32Å; M27-T30 PolarHBondContact O-N 2.91Å; M27-T30 PolarHBondContact O-OG1 3.35Å; A28-T30 PolarHBondContact O-N 3.45Å; T30-L33 PolarHBondContact O-N 3.31Å; T30-L34 WeakPolarHBondContact O-CB 3.42Å; T30-L34 VanDerWaalsContact O-CG 3.27Å; T30-L34 WeakPolarHBondContact O-CG 2.91Å; T30-L34 PolarHBondContact O-N 3.1Å
31	L	97.8	Very high	97.5	Very high	105 Å²	105	94.9 Å²	94.9	55%	0.55	51%	0.508	S	S	.	.	H	α-helix	trans	-64.5	-40	176.3	-69.9	174	0	0	0	112	M27 A28 L33 L34 A35	M27-L31 WeakPolarHBondContact O-CB 3.46Å; M27-L31 VanDerWaalsContact O-CG 3.27Å; M27-L31 WeakPolarHBondContact O-CG 3.33Å; M27-L31 PolarHBondContact O-N 2.92Å; A28-L31 PolarHBondContact O-N 2.86Å; L31-L33 VanDerWaalsContact C-N 3.28Å; L31-L33 PolarHBondContact O-N 3.05Å; L31-L34 PolarHBondContact O-N 3.28Å; L31-A35 WeakPolarHBondContact O-CB 3.36Å; L31-A35 PolarHBondContact O-N 2.96Å
32	A	97.5	Very high	97.5	Very high	66 Å²	66	97.1 Å²	97.1	55%	0.545	52%	0.516	S	S	.	.	H	α-helix	trans	-63.4	-32	177.5	0	0	0	0	0	112.9	A28 C29 P36	A28-A32 WeakPolarHBondContact O-CB 3.22Å; A28-A32 PolarHBondContact O-N 3.41Å; C29-A32 PolarHBondContact O-N 2.92Å; A32-P36 WeakPolarHBondContact O-CD 3.49Å; A32-P36 WeakPolarHBondContact O-CG 3.27Å
33	L	97.3	Very high	97.5	Very high	131 Å²	131	95 Å²	95	69%	0.686	51%	0.508	S	S	*	.	H	α-helix	trans	-81.6	-36.6	173.8	-68.4	174.2	0	0	0	112.6	C29 T30 L31 P36 L37	C29-L33 WeakPolarHBondContact O-CG 3.42Å; C29-L33 PolarHBondContact O-N 3.48Å; C29-L33 VanDerWaalsContact O-N 3.1Å; T30-L33 PolarHBondContact O-N 3.31Å; L31-L33 VanDerWaalsContact C-N 3.28Å; L31-L33 PolarHBondContact O-N 3.05Å; L33-P36 WeakPolarHBondContact O-CD 3.31Å; L33-P36 WeakPolarHBondContact O-CG 3.5Å; L33-L37 WeakPolarHBondContact O-CB 3.46Å; L33-L37 PolarHBondContact O-N 2.85Å
34	L	97.9	Very high	97.4	Very high	88 Å²	88	88.7 Å²	88.7	46%	0.461	49%	0.486	S	S	.	.	H	α-helix	trans	-67.3	-41.8	179.7	-78.6	169.9	0	0	0	112.4	T30 L31 L37 L38	T30-L34 WeakPolarHBondContact O-CB 3.42Å; T30-L34 VanDerWaalsContact O-CG 3.27Å; T30-L34 WeakPolarHBondContact O-CG 2.91Å; T30-L34 PolarHBondContact O-N 3.1Å; L31-L34 PolarHBondContact O-N 3.28Å; L34-L37 PolarHBondContact O-N 3.39Å; L34-L38 WeakPolarHBondContact O-CB 3.38Å; L34-L38 VanDerWaalsContact O-CG 3.31Å; L34-L38 WeakPolarHBondContact O-CG 3.4Å; L34-L38 PolarHBondContact O-N 3.43Å
35	A	97.2	Very high	97.3	Very high	60 Å²	60	88.1 Å²	88.1	50%	0.496	48%	0.484	S	S	.	.	H	α-helix	trans	-55.4	-54.3	-178.2	0	0	0	0	0	113.9	L31 L37 L38 F39	L31-A35 WeakPolarHBondContact O-CB 3.36Å; L31-A35 PolarHBondContact O-N 2.96Å; A35-L37 VanDerWaalsContact C-N 3.32Å; A35-L37 PolarHBondContact O-N 2.96Å; A35-L38 PolarHBondContact O-N 2.86Å; A35-F39 WeakPolarHBondContact O-CB 3.36Å; A35-F39 PolarHBondContact O-N 3.24Å
36	P	97.8	Very high	97.3	Very high	75 Å²	75	86.3 Å²	86.3	49%	0.487	47%	0.473	S	S	.	.	H	α-helix	trans	-67.2	-32.2	178	26.4	-34.5	0	0	0	112.4	A32 L33 F39 Y40	A32-P36 WeakPolarHBondContact O-CD 3.49Å; A32-P36 WeakPolarHBondContact O-CG 3.27Å; L33-P36 WeakPolarHBondContact O-CD 3.31Å; L33-P36 WeakPolarHBondContact O-CG 3.5Å; P36-F39 PolarHBondContact O-N 3.14Å; P36-Y40 WeakPolarHBondContact O-CB 3.4Å; P36-Y40 PolarHBondContact O-N 3.49Å
37	L	97.6	Very high	97.2	Very high	101 Å²	101	84.8 Å²	84.8	53%	0.529	46%	0.463	S	S	.	.	H	α-helix	trans	-63.9	-47.1	175.8	-172.9	151.1	0	0	0	111	L33 L34 A35 Y40 T41	L33-L37 WeakPolarHBondContact O-CB 3.46Å; L33-L37 PolarHBondContact O-N 2.85Å; L34-L37 PolarHBondContact O-N 3.39Å; A35-L37 VanDerWaalsContact C-N 3.32Å; A35-L37 PolarHBondContact O-N 2.96Å; L37-Y40 PolarHBondContact O-N 3.37Å; L37-T41 HydrophobicContact CD2-CG2 4.19Å; L37-T41 WeakPolarHBondContact O-CG2 3.44Å; L37-T41 PolarHBondContact O-N 3.41Å; L37-T41 PolarHBondContact O-OG1 3.25Å; L37-T41 VanDerWaalsContact O-OG1 3.07Å
38	L	97.7	Very high	97.1	Very high	89 Å²	89	85.7 Å²	85.7	47%	0.466	47%	0.465	S	S	.	.	H	α-helix	trans	-62.2	-43.7	175.4	-71.1	173.3	0	0	0	111.5	L34 A35 Y40 T41 L42	L34-L38 WeakPolarHBondContact O-CB 3.38Å; L34-L38 VanDerWaalsContact O-CG 3.31Å; L34-L38 WeakPolarHBondContact O-CG 3.4Å; L34-L38 PolarHBondContact O-N 3.43Å; A35-L38 PolarHBondContact O-N 2.86Å; L38-Y40 VanDerWaalsContact C-N 3.3Å; L38-Y40 PolarHBondContact O-N 3.26Å; L38-T41 PolarHBondContact O-N 3Å; L38-T41 PolarHBondContact O-OG1 2.89Å; L38-L42 HydrophobicContact CD2-CD1 4.3Å; L38-L42 VanDerWaalsContact O-CB 3.26Å; L38-L42 WeakPolarHBondContact O-CB 3.26Å; L38-L42 WeakPolarHBondContact O-CG 3.49Å; L38-L42 PolarHBondContact O-N 3.07Å
39	F	97.7	Very high	97	Very high	114 Å²	114	90.7 Å²	90.7	50%	0.5	47%	0.471	S	S	.	.	H	α-helix	trans	-61.9	-40.1	176.2	-171.8	-106.7	0	0	0	111.7	A35 P36 H43 N44	A35-F39 WeakPolarHBondContact O-CB 3.36Å; A35-F39 PolarHBondContact O-N 3.24Å; P36-F39 PolarHBondContact O-N 3.14Å; F39-H43 HydrophobicContact CD2-CB 3.99Å; F39-H43 HydrophobicContact CE2-CB 3.89Å; F39-H43 AromaticContact CE2-CD2 3.76Å; F39-H43 AromaticContact CE2-CG 3.8Å; F39-H43 HydrophobicContact CZ-CB 4.33Å; F39-H43 AromaticContact CZ-CD2 3.5Å; F39-H43 VanDerWaalsContact CZ-CD2 3.5Å; F39-H43 WeakPolarHBondContact CZ-CD2 3.43Å; F39-H43 WeakPolarHBondContact O-CA 3.42Å; F39-H43 VanDerWaalsContact O-CB 3.23Å; F39-H43 WeakPolarHBondContact O-CB 3.47Å; F39-H43 PolarHBondContact O-N 3.22Å; F39-N44 PolarHBondContact O-N 3.42Å; F39-N44 VanDerWaalsContact O-N 3.14Å
40	Y	97.5	Very high	96.9	Very high	116 Å²	116	94.8 Å²	94.8	46%	0.455	48%	0.481	S	S	.	.	I	π-helix	trans	-65.1	-48.3	176.7	-178.4	-100.2	0	0	0	112.2	P36 L37 L38 N44 N45	P36-Y40 WeakPolarHBondContact O-CB 3.4Å; P36-Y40 PolarHBondContact O-N 3.49Å; L37-Y40 PolarHBondContact O-N 3.37Å; L38-Y40 VanDerWaalsContact C-N 3.3Å; L38-Y40 PolarHBondContact O-N 3.26Å; Y40-N44 HydrophobicContact CD2-CB 4.01Å; Y40-N44 HydrophobicContact CE2-CB 4.5Å; Y40-N44 PolarHBondContact O-N 3.04Å; Y40-N45 VanDerWaalsContact O-CB 3.31Å; Y40-N45 WeakPolarHBondContact O-CB 3.23Å; Y40-N45 PolarHBondContact O-N 2.94Å
41	T	97.1	Very high	96.8	Very high	58 Å²	58	99.1 Å²	99.1	36%	0.356	49%	0.492	S	S	.	.	I	π-helix	trans	-74.4	-35.4	-174.5	56.8	0	0	0	0	113.2	L37 L38 P46	L37-T41 HydrophobicContact CD2-CG2 4.19Å; L37-T41 WeakPolarHBondContact O-CG2 3.44Å; L37-T41 PolarHBondContact O-N 3.41Å; L37-T41 PolarHBondContact O-OG1 3.25Å; L37-T41 VanDerWaalsContact O-OG1 3.07Å; L38-T41 PolarHBondContact O-N 3Å; L38-T41 PolarHBondContact O-OG1 2.89Å; T41-P46 VanDerWaalsContact O-CD 3.23Å; T41-P46 WeakPolarHBondContact O-CD 3.42Å; T41-P46 WeakPolarHBondContact O-CG 3.3Å
42	L	97.2	Very high	96.7	Very high	129 Å²	129	103.6 Å²	103.6	68%	0.675	50%	0.501	S	S	*	.	I	π-helix	trans	-96.5	-26	-174.8	-59.3	178.2	0	0	0	113.7	L38 P46	L38-L42 HydrophobicContact CD2-CD1 4.3Å; L38-L42 VanDerWaalsContact O-CB 3.26Å; L38-L42 WeakPolarHBondContact O-CB 3.26Å; L38-L42 WeakPolarHBondContact O-CG 3.49Å; L38-L42 PolarHBondContact O-N 3.07Å; L42-P46 WeakPolarHBondContact O-CG 3.31Å
43	H	96	Very high	96.6	Very high	94 Å²	94	104.7 Å²	104.7	44%	0.435	50%	0.498	S	S	.	.	I	π-helix	trans	-111.9	-59.1	-178.4	-173.2	82.4	0	0	0	112.4	F39 R47	F39-H43 HydrophobicContact CD2-CB 3.99Å; F39-H43 HydrophobicContact CE2-CB 3.89Å; F39-H43 AromaticContact CE2-CD2 3.76Å; F39-H43 AromaticContact CE2-CG 3.8Å; F39-H43 HydrophobicContact CZ-CB 4.33Å; F39-H43 AromaticContact CZ-CD2 3.5Å; F39-H43 VanDerWaalsContact CZ-CD2 3.5Å; F39-H43 WeakPolarHBondContact CZ-CD2 3.43Å; F39-H43 WeakPolarHBondContact O-CA 3.42Å; F39-H43 VanDerWaalsContact O-CB 3.23Å; F39-H43 WeakPolarHBondContact O-CB 3.47Å; F39-H43 PolarHBondContact O-N 3.22Å; H43-R47 WeakPolarHBondContact O-CB 3.31Å; H43-R47 PolarHBondContact O-N 2.84Å
44	N	95.3	Very high	96.5	Very high	32 Å²	32	103.8 Å²	103.8	17%	0.171	49%	0.489	C	S	.	.	I	π-helix	trans	-69.9	-45.6	-171.9	-70.1	-33	0	0	0	113	F39 Y40 R47 K48	F39-N44 PolarHBondContact O-N 3.42Å; F39-N44 VanDerWaalsContact O-N 3.14Å; Y40-N44 HydrophobicContact CD2-CB 4.01Å; Y40-N44 HydrophobicContact CE2-CB 4.5Å; Y40-N44 PolarHBondContact O-N 3.04Å; N44-R47 PolarHBondContact O-N 3.43Å; N44-R47 PolarHBondContact OD1-NH2 2.91Å; N44-K48 WeakPolarHBondContact O-CG 3.35Å; N44-K48 PolarHBondContact O-N 3.36Å
45	N	95.8	Very high	96.3	Very high	76 Å²	76	106.6 Å²	106.6	41%	0.406	49%	0.494	S	S	.	.	H	α-helix	trans	-67.5	-45.3	-176.5	-166.6	17.9	0	0	0	112.1	Y40 R47 K48 R49	Y40-N45 VanDerWaalsContact O-CB 3.31Å; Y40-N45 WeakPolarHBondContact O-CB 3.23Å; Y40-N45 PolarHBondContact O-N 2.94Å; N45-R47 VanDerWaalsContact C-N 3.31Å; N45-R47 PolarHBondContact O-N 3.33Å; N45-K48 PolarHBondContact O-N 2.87Å; N45-R49 WeakPolarHBondContact O-CB 3.4Å; N45-R49 PolarHBondContact O-N 3.27Å
46	P	96.9	Very high	96.1	Very high	38 Å²	38	107.7 Å²	107.7	25%	0.247	50%	0.498	C	S	.	.	H	α-helix	trans	-63.1	-36	175.6	-26.4	39.3	0	0	0	112.7	T41 L42 R49 K50	T41-P46 VanDerWaalsContact O-CD 3.23Å; T41-P46 WeakPolarHBondContact O-CD 3.42Å; T41-P46 WeakPolarHBondContact O-CG 3.3Å; L42-P46 WeakPolarHBondContact O-CG 3.31Å; P46-R49 PolarHBondContact O-N 3.11Å; P46-K50 VanDerWaalsContact O-CG 3.31Å; P46-K50 WeakPolarHBondContact O-CG 3.47Å; P46-K50 PolarHBondContact O-N 3.17Å
47	R	95.9	Very high	95.9	Very high	120 Å²	120	109.9 Å²	109.9	45%	0.453	51%	0.51	S	S	.	.	H	α-helix	trans	-58.9	-54.4	172.3	-178	179	64.5	-171.8	-3.7	110.8	H43 N44 N45 R49 K50 Y51	H43-R47 WeakPolarHBondContact O-CB 3.31Å; H43-R47 PolarHBondContact O-N 2.84Å; N44-R47 PolarHBondContact O-N 3.43Å; N44-R47 PolarHBondContact OD1-NH2 2.91Å; N45-R47 VanDerWaalsContact C-N 3.31Å; N45-R47 PolarHBondContact O-N 3.33Å; R47-R49 VanDerWaalsContact C-N 3.29Å; R47-R49 PolarHBondContact O-N 3.24Å; R47-K50 PolarHBondContact O-N 3.36Å; R47-Y51 HydrophobicContact CG-CD2 3.98Å; R47-Y51 HydrophobicContact CG-CE2 3.83Å; R47-Y51 VanDerWaalsContact O-CD2 3.3Å; R47-Y51 WeakPolarHBondContact O-CD2 3.25Å; R47-Y51 PolarHBondContact O-N 3.42Å; R47-Y51 VanDerWaalsContact O-N 3.11Å
48	K	96.1	Very high	95.6	Very high	122 Å²	122	109.5 Å²	109.5	53%	0.53	50%	0.502	S	S	.	.	H	α-helix	trans	-58.1	-41.5	178.4	-71.8	-176.7	179.7	-174.1	0	112.1	N44 N45 Y51 R52	N44-K48 WeakPolarHBondContact O-CG 3.35Å; N44-K48 PolarHBondContact O-N 3.36Å; N45-K48 PolarHBondContact O-N 2.87Å; K48-Y51 PolarHBondContact O-N 3.42Å; K48-R52 WeakPolarHBondContact O-CB 3.23Å; K48-R52 PolarHBondContact O-N 2.96Å
49	R	95.9	Very high	95.4	Very high	162 Å²	162	109.4 Å²	109.4	61%	0.611	50%	0.503	S	S	*	.	H	α-helix	trans	-63	-43	176.9	-169.1	173.9	72.6	-177	3.2	112.2	N45 P46 R47 R52 N53	N45-R49 WeakPolarHBondContact O-CB 3.4Å; N45-R49 PolarHBondContact O-N 3.27Å; P46-R49 PolarHBondContact O-N 3.11Å; R47-R49 VanDerWaalsContact C-N 3.29Å; R47-R49 PolarHBondContact O-N 3.24Å; R49-R52 PolarHBondContact O-N 2.89Å; R49-N53 WeakPolarHBondContact O-CB 3.44Å; R49-N53 PolarHBondContact O-N 3.48Å; R49-N53 PolarHBondContact O-OD1 3.34Å
50	K	95.6	Very high	95.1	Very high	158 Å²	158	107.8 Å²	107.8	69%	0.687	50%	0.503	S	S	*	.	H	α-helix	trans	-60	-47.6	175.9	-75.8	176.8	-178.7	-175.6	0	111.8	P46 R47 N53 F54	P46-K50 VanDerWaalsContact O-CG 3.31Å; P46-K50 WeakPolarHBondContact O-CG 3.47Å; P46-K50 PolarHBondContact O-N 3.17Å; R47-K50 PolarHBondContact O-N 3.36Å; K50-N53 PolarHBondContact O-N 3.45Å; K50-F54 WeakPolarHBondContact O-CB 3.42Å; K50-F54 PolarHBondContact O-N 3.31Å
51	Y	95.3	Very high	94.8	Very high	148 Å²	148	107.5 Å²	107.5	58%	0.58	51%	0.508	S	S	*	.	H	α-helix	trans	-61.4	-45.7	176.8	-83.2	-80.5	0	0	0	112.2	R47 K48 N53 F54 Y55	R47-Y51 HydrophobicContact CG-CD2 3.98Å; R47-Y51 HydrophobicContact CG-CE2 3.83Å; R47-Y51 VanDerWaalsContact O-CD2 3.3Å; R47-Y51 WeakPolarHBondContact O-CD2 3.25Å; R47-Y51 PolarHBondContact O-N 3.42Å; R47-Y51 VanDerWaalsContact O-N 3.11Å; K48-Y51 PolarHBondContact O-N 3.42Å; Y51-N53 VanDerWaalsContact C-N 3.34Å; Y51-N53 PolarHBondContact O-N 3.47Å; Y51-F54 PolarHBondContact O-N 3.45Å; Y51-Y55 HydrophobicContact CD1-CE2 4.13Å; Y51-Y55 VanDerWaalsContact O-CD2 3.25Å; Y51-Y55 WeakPolarHBondContact O-CD2 3.33Å; Y51-Y55 PolarHBondContact O-N 2.92Å; Y51-Y55 VanDerWaalsContact O-N 3.09Å
52	R	96.2	Very high	94.4	Very high	198 Å²	198	107.9 Å²	107.9	75%	0.747	51%	0.508	S	S	*	.	H	α-helix	trans	-59.6	-45.5	176.4	-179.2	178.9	173.2	179.5	-1.4	111.7	K48 R49 Y55 S56	K48-R52 WeakPolarHBondContact O-CB 3.23Å; K48-R52 PolarHBondContact O-N 2.96Å; R49-R52 PolarHBondContact O-N 2.89Å; R52-Y55 PolarHBondContact O-N 3.39Å; R52-S56 WeakPolarHBondContact O-CB 3.25Å; R52-S56 PolarHBondContact O-N 3.33Å
53	N	94.9	Very high	94.1	Very high	89 Å²	89	102.6 Å²	102.6	48%	0.476	48%	0.482	S	S	.	.	H	α-helix	trans	-65.2	-42	179.8	-70.7	0.7	0	0	0	111.3	R49 K50 Y51 Y55 S56	R49-N53 WeakPolarHBondContact O-CB 3.44Å; R49-N53 PolarHBondContact O-N 3.48Å; R49-N53 PolarHBondContact O-OD1 3.34Å; K50-N53 PolarHBondContact O-N 3.45Å; Y51-N53 VanDerWaalsContact C-N 3.34Å; Y51-N53 PolarHBondContact O-N 3.47Å; N53-Y55 PolarHBondContact O-N 3.27Å; N53-S56 PolarHBondContact O-N 3.09Å; N53-S56 PolarHBondContact O-OG 3.06Å
54	F	94.5	Very high	93.9	Very high	113 Å²	113	101.7 Å²	101.7	50%	0.496	48%	0.477	S	S	.	.	H	α-helix	trans	-56	-53.4	176.3	-178.1	-96.8	0	0	0	110.7	K50 Y51 S56 Y58	K50-F54 WeakPolarHBondContact O-CB 3.42Å; K50-F54 PolarHBondContact O-N 3.31Å; Y51-F54 PolarHBondContact O-N 3.45Å; F54-S56 VanDerWaalsContact C-N 3.34Å; F54-S56 PolarHBondContact O-N 2.87Å; F54-Y58 HydrophobicContact CD1-CD2 4.39Å; F54-Y58 AromaticContact CE1-CD2 3.56Å; F54-Y58 HydrophobicContact CE1-CD2 3.56Å; F54-Y58 AromaticContact CE1-CE2 3.85Å; F54-Y58 HydrophobicContact CE1-CE2 3.85Å; F54-Y58 HydrophobicContact CE1-CG 4.01Å; F54-Y58 HydrophobicContact CE2-CD2 4.3Å; F54-Y58 AromaticContact CZ-CD2 3.51Å; F54-Y58 HydrophobicContact CZ-CD2 3.51Å; F54-Y58 AromaticContact CZ-CE2 3.6Å; F54-Y58 HydrophobicContact CZ-CE2 3.6Å; F54-Y58 HydrophobicContact CZ-CG 4.4Å; F54-Y58 WeakPolarHBondContact O-CB 3.34Å; F54-Y58 PolarHBondContact O-N 3.39Å
55	Y	94.4	Very high	93.5	Very high	146 Å²	146	102.5 Å²	102.5	57%	0.573	48%	0.481	S	S	*	.	H	α-helix	trans	-76.7	-15.9	-177.5	-70	-65	0	0	0	115	Y51 R52 N53 T57 Y58	Y51-Y55 HydrophobicContact CD1-CE2 4.13Å; Y51-Y55 VanDerWaalsContact O-CD2 3.25Å; Y51-Y55 WeakPolarHBondContact O-CD2 3.33Å; Y51-Y55 PolarHBondContact O-N 2.92Å; Y51-Y55 VanDerWaalsContact O-N 3.09Å; R52-Y55 PolarHBondContact O-N 3.39Å; N53-Y55 PolarHBondContact O-N 3.27Å; Y55-T57 PolarHBondContact O-N 3.4Å; Y55-Y58 HydrophobicContact CD1-CD1 4.21Å; Y55-Y58 HydrophobicContact CD1-CG 4.35Å; Y55-Y58 HydrophobicContact CE1-CD1 4.34Å
56	S	93.7	Very high	93.2	Very high	83 Å²	83	106.7 Å²	106.7	58%	0.58	49%	0.491	S	S	*	.	H	α-helix	trans	-65.1	-26	178.5	65.3	0	0	0	0	113.9	R52 N53 F54	R52-S56 WeakPolarHBondContact O-CB 3.25Å; R52-S56 PolarHBondContact O-N 3.33Å; N53-S56 PolarHBondContact O-N 3.09Å; N53-S56 PolarHBondContact O-OG 3.06Å; F54-S56 VanDerWaalsContact C-N 3.34Å; F54-S56 PolarHBondContact O-N 2.87Å
57	T	91.7	Very high	92.8	Very high	121 Å²	121	109.4 Å²	109.4	74%	0.742	50%	0.502	S	S	*	.	S	Bend	trans	-130.1	16	-179.6	62.1	0	0	0	0	112.1	Y55 D59	Y55-T57 PolarHBondContact O-N 3.4Å; T57-D59 PolarHBondContact O-N 3.43Å
58	Y	92.5	Very high	92.3	Very high	93 Å²	93	104.3 Å²	104.3	37%	0.365	48%	0.484	S	S	.	.			trans	-78.1	114.1	-178.4	-176.7	-107.2	0	0	0	110.2	F54 Y55 P60 A63	F54-Y58 HydrophobicContact CD1-CD2 4.39Å; F54-Y58 AromaticContact CE1-CD2 3.56Å; F54-Y58 HydrophobicContact CE1-CD2 3.56Å; F54-Y58 AromaticContact CE1-CE2 3.85Å; F54-Y58 HydrophobicContact CE1-CE2 3.85Å; F54-Y58 HydrophobicContact CE1-CG 4.01Å; F54-Y58 HydrophobicContact CE2-CD2 4.3Å; F54-Y58 AromaticContact CZ-CD2 3.51Å; F54-Y58 HydrophobicContact CZ-CD2 3.51Å; F54-Y58 AromaticContact CZ-CE2 3.6Å; F54-Y58 HydrophobicContact CZ-CE2 3.6Å; F54-Y58 HydrophobicContact CZ-CG 4.4Å; F54-Y58 WeakPolarHBondContact O-CB 3.34Å; F54-Y58 PolarHBondContact O-N 3.39Å; Y55-Y58 HydrophobicContact CD1-CD1 4.21Å; Y55-Y58 HydrophobicContact CD1-CG 4.35Å; Y55-Y58 HydrophobicContact CE1-CD1 4.34Å; Y58-P60 HydrophobicContact CE1-CB 3.95Å; Y58-A63 HydrophobicContact CE2-CB 3.62Å; Y58-A63 VanDerWaalsContact OH-CB 3.25Å; Y58-A63 WeakPolarHBondContact OH-CB 3.38Å
59	D	92.8	Very high	91.9	Very high	88 Å²	88	102.7 Å²	102.7	47%	0.471	49%	0.488	S	S	.	.			trans	-94.4	111.5	167.1	-176.9	-8.8	0	0	0	109.1	T57 M61 D62 A63	T57-D59 PolarHBondContact O-N 3.43Å; D59-M61 VanDerWaalsContact C-N 3.26Å; D59-M61 PolarHBondContact O-N 3Å; D59-M61 PolarHBondContact OD1-N 3.04Å; D59-D62 HydrophobicContact CB-CB 3.99Å; D59-D62 PolarHBondContact O-N 3.25Å; D59-A63 PolarHBondContact O-N 2.89Å; D59-A63 VanDerWaalsContact O-N 3.11Å
60	P	92.3	Very high	91.5	Very high	79 Å²	79	97.1 Å²	97.1	51%	0.513	48%	0.481	S	S	.	.	H	α-helix	trans	-63.6	-31	-179	27	-34.7	0	0	0	112.9	Y58 F64	Y58-P60 HydrophobicContact CE1-CB 3.95Å; P60-F64 WeakPolarHBondContact O-CB 3.48Å; P60-F64 PolarHBondContact O-N 3.37Å
61	M	90.2	Very high	91	Very high	111 Å²	111	91.4 Å²	91.4	55%	0.547	47%	0.467	S	S	.	.	H	α-helix	trans	-75	-42.3	-178.5	-69	-56.6	-57.8	0	0	111.3	D59 A63 F64 D65	D59-M61 VanDerWaalsContact C-N 3.26Å; D59-M61 PolarHBondContact O-N 3Å; D59-M61 PolarHBondContact OD1-N 3.04Å; M61-A63 VanDerWaalsContact C-N 3.32Å; M61-A63 PolarHBondContact O-N 3.06Å; M61-F64 PolarHBondContact O-N 2.83Å; M61-D65 WeakPolarHBondContact O-CB 3.48Å; M61-D65 PolarHBondContact O-N 3.05Å
62	D	90.2	Very high	90.6	Very high	66 Å²	66	93.5 Å²	93.5	35%	0.353	48%	0.475	S	S	.	.	H	α-helix	trans	-62.4	-40.6	173.7	-178.2	52.2	0	0	0	111.5	D59 F64 D65 R66	D59-D62 HydrophobicContact CB-CB 3.99Å; D59-D62 PolarHBondContact O-N 3.25Å; D62-F64 PolarHBondContact O-N 3.46Å; D62-D65 PolarHBondContact O-N 3.06Å; D62-R66 VanDerWaalsContact O-CG 3.25Å; D62-R66 WeakPolarHBondContact O-CG 3.4Å; D62-R66 PolarHBondContact O-N 2.99Å; D62-R66 IonicContact OD1-NE 3.55Å; D62-R66 IonicContact OD1-NH2 3.94Å; D62-R66 IonicContact OD2-CZ 3.11Å; D62-R66 IonicContact OD2-NE 3.02Å; D62-R66 PolarHBondContact OD2-NE 3.48Å; D62-R66 IonicContact OD2-NH2 2.66Å; D62-R66 PolarHBondContact OD2-NH2 3.23Å
63	A	91	Very high	90.2	Very high	17 Å²	17	86 Å²	86	14%	0.14	45%	0.45	C	S	.	.	H	α-helix	trans	-62.9	-41.2	174.6	0	0	0	0	0	112.4	Y58 D59 M61 R66 M67	Y58-A63 HydrophobicContact CE2-CB 3.62Å; Y58-A63 VanDerWaalsContact OH-CB 3.25Å; Y58-A63 WeakPolarHBondContact OH-CB 3.38Å; D59-A63 PolarHBondContact O-N 2.89Å; D59-A63 VanDerWaalsContact O-N 3.11Å; M61-A63 VanDerWaalsContact C-N 3.32Å; M61-A63 PolarHBondContact O-N 3.06Å; A63-R66 PolarHBondContact O-N 3.21Å; A63-M67 WeakPolarHBondContact O-CG 3.34Å; A63-M67 PolarHBondContact O-N 3.46Å
64	F	90.1	Very high	89.7	Confident	75 Å²	75	87.8 Å²	87.8	33%	0.329	47%	0.469	S	S	.	.	H	α-helix	trans	-65	-45.3	176.1	177.5	-106.2	0	0	0	112.2	P60 M61 D62 R66 M67 M68 L73	P60-F64 WeakPolarHBondContact O-CB 3.48Å; P60-F64 PolarHBondContact O-N 3.37Å; M61-F64 PolarHBondContact O-N 2.83Å; D62-F64 PolarHBondContact O-N 3.46Å; F64-R66 VanDerWaalsContact C-N 3.28Å; F64-R66 PolarHBondContact O-N 3.43Å; F64-M67 PolarHBondContact O-N 3.11Å; F64-M68 HydrophobicContact CD1-CE 4.03Å; F64-M68 HydrophobicContact CE1-CE 3.14Å; F64-M68 HydrophobicContact CE2-CE 4.5Å; F64-M68 HydrophobicContact CZ-CE 3.43Å; F64-M68 VanDerWaalsContact CZ-CE 3.43Å; F64-M68 PolarHBondContact O-N 3.35Å; F64-L73 HydrophobicContact CD2-CD1 3.87Å; F64-L73 HydrophobicContact CE2-CD1 3.41Å; F64-L73 VanDerWaalsContact CE2-CD1 3.41Å; F64-L73 HydrophobicContact CZ-CD1 4.11Å
65	D	88.6	Confident	89.4	Confident	49 Å²	49	87 Å²	87	26%	0.262	48%	0.478	S	S	.	.	H	α-helix	trans	-59.4	-39.7	176.7	-78.8	-9	0	0	0	111.3	M61 D62 S69	M61-D65 WeakPolarHBondContact O-CB 3.48Å; M61-D65 PolarHBondContact O-N 3.05Å; D62-D65 PolarHBondContact O-N 3.06Å; D65-S69 VanDerWaalsContact O-CB 3.27Å; D65-S69 WeakPolarHBondContact O-CB 3.32Å; D65-S69 PolarHBondContact O-N 3.35Å; D65-S69 PolarHBondContact O-OG 3.42Å
66	R	88.3	Confident	88.7	Confident	164 Å²	164	81.3 Å²	81.3	62%	0.619	46%	0.459	S	S	*	.	H	α-helix	trans	-64.4	-39.1	173.2	-69.2	171.9	-167	-158.5	5.2	112.5	D62 A63 F64 S69 G70	D62-R66 VanDerWaalsContact O-CG 3.25Å; D62-R66 WeakPolarHBondContact O-CG 3.4Å; D62-R66 PolarHBondContact O-N 2.99Å; D62-R66 IonicContact OD1-NE 3.55Å; D62-R66 IonicContact OD1-NH2 3.94Å; D62-R66 IonicContact OD2-CZ 3.11Å; D62-R66 IonicContact OD2-NE 3.02Å; D62-R66 PolarHBondContact OD2-NE 3.48Å; D62-R66 IonicContact OD2-NH2 2.66Å; D62-R66 PolarHBondContact OD2-NH2 3.23Å; A63-R66 PolarHBondContact O-N 3.21Å; F64-R66 VanDerWaalsContact C-N 3.28Å; F64-R66 PolarHBondContact O-N 3.43Å; R66-S69 WeakPolarHBondContact CA-OG 3.44Å; R66-S69 PolarHBondContact O-OG 2.86Å; R66-G70 PolarHBondContact O-N 2.98Å
67	M	88.6	Confident	87.7	Confident	95 Å²	95	81 Å²	81	47%	0.468	46%	0.455	S	S	.	.	H	α-helix	trans	-70.1	-41.8	177.6	-72.7	-177.3	-175.9	0	0	112.4	A63 F64 G70 G71 Y72 L73	A63-M67 WeakPolarHBondContact O-CG 3.34Å; A63-M67 PolarHBondContact O-N 3.46Å; F64-M67 PolarHBondContact O-N 3.11Å; M67-G70 PolarHBondContact O-N 3.48Å; M67-G71 PolarHBondContact O-N 2.72Å; M67-Y72 PolarHBondContact O-N 2.7Å; M67-L73 HydrophobicContact CB-CD1 4.28Å; M67-L73 HydrophobicContact CB-CG 4.29Å
68	M	86.1	Confident	86.7	Confident	13 Å²	13	79.3 Å²	79.3	6%	0.064	45%	0.446	C	S	.	.	H	α-helix	trans	-66.2	-48.9	177.5	-171.4	-167.9	-60	0	0	111.3	F64 G70 G71 L73 C76 P78 G81	F64-M68 HydrophobicContact CD1-CE 4.03Å; F64-M68 HydrophobicContact CE1-CE 3.14Å; F64-M68 HydrophobicContact CE2-CE 4.5Å; F64-M68 HydrophobicContact CZ-CE 3.43Å; F64-M68 VanDerWaalsContact CZ-CE 3.43Å; F64-M68 PolarHBondContact O-N 3.35Å; M68-G70 VanDerWaalsContact C-N 3.25Å; M68-G70 PolarHBondContact O-N 3.33Å; M68-G71 PolarHBondContact O-N 3.33Å; M68-L73 HydrophobicContact CB-CD1 4.12Å; M68-C76 HydrophobicContact CE-CB 3.95Å; M68-C76 HydrophobicContact CG-CB 3.9Å; M68-C76 WeakPolarHBondContact CG-O 3.27Å; M68-C76 HydrophobicContact SD-CB 4.31Å; M68-P78 WeakPolarHBondContact O-CA 3.34Å; M68-G81 WeakPolarHBondContact SD-CA 3.49Å; M68-G81 PolarHBondContact SD-N 3.03Å
69	S	86.3	Confident	85.5	Confident	88 Å²	88	78.5 Å²	78.5	62%	0.615	47%	0.466	S	S	*	.	H	α-helix	trans	-64.5	-31	177.2	57.3	0	0	0	0	112.6	D65 R66 G71	D65-S69 VanDerWaalsContact O-CB 3.27Å; D65-S69 WeakPolarHBondContact O-CB 3.32Å; D65-S69 PolarHBondContact O-N 3.35Å; D65-S69 PolarHBondContact O-OG 3.42Å; R66-S69 WeakPolarHBondContact CA-OG 3.44Å; R66-S69 PolarHBondContact O-OG 2.86Å; S69-G71 PolarHBondContact O-N 2.94Å
70	G	87.8	Confident	84.2	Confident	45 Å²	45	77.4 Å²	77.4	46%	0.464	47%	0.465	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.2	-6.2	171.9	0	0	0	0	0	114.9	R66 M67 M68 Y72	R66-G70 PolarHBondContact O-N 2.98Å; M67-G70 PolarHBondContact O-N 3.48Å; M68-G70 VanDerWaalsContact C-N 3.25Å; M68-G70 PolarHBondContact O-N 3.33Å; G70-Y72 VanDerWaalsContact C-N 3.28Å; G70-Y72 PolarHBondContact O-N 2.9Å
71	G	86.1	Confident	82.8	Confident	39 Å²	39	74.6 Å²	74.6	40%	0.402	45%	0.45	S	S	.	.	T	Hydrogen-bonded Turn	trans	70.4	20.4	179.7	0	0	0	0	0	114.5	M67 M68 S69 L73	M67-G71 PolarHBondContact O-N 2.72Å; M68-G71 PolarHBondContact O-N 3.33Å; S69-G71 PolarHBondContact O-N 2.94Å; G71-L73 VanDerWaalsContact C-N 3.25Å; G71-L73 PolarHBondContact O-N 3.3Å
72	Y	87	Confident	81.3	Confident	191 Å²	191	74.5 Å²	74.5	75%	0.749	46%	0.458	S	S	*	.			trans	-75.6	-13.8	178.5	-64.8	-76.5	0	0	0	113.3	M67 G70	M67-Y72 PolarHBondContact O-N 2.7Å; G70-Y72 VanDerWaalsContact C-N 3.28Å; G70-Y72 PolarHBondContact O-N 2.9Å
73	L	87.1	Confident	79.8	Confident	41 Å²	41	80.3 Å²	80.3	22%	0.215	48%	0.48	C	S	.	.			trans	-105.9	113.1	-174.3	-58.8	176.6	0	0	0	110.4	F64 M67 M68 G71 S75 C76	F64-L73 HydrophobicContact CD2-CD1 3.87Å; F64-L73 HydrophobicContact CE2-CD1 3.41Å; F64-L73 VanDerWaalsContact CE2-CD1 3.41Å; F64-L73 HydrophobicContact CZ-CD1 4.11Å; M67-L73 HydrophobicContact CB-CD1 4.28Å; M67-L73 HydrophobicContact CB-CG 4.29Å; M68-L73 HydrophobicContact CB-CD1 4.12Å; G71-L73 VanDerWaalsContact C-N 3.25Å; G71-L73 PolarHBondContact O-N 3.3Å; L73-S75 VanDerWaalsContact C-N 3.28Å; L73-S75 PolarHBondContact O-N 3.04Å; L73-C76 HydrophobicContact CB-CB 3.99Å; L73-C76 HydrophobicContact CD1-CB 4.14Å; L73-C76 CarbonylContact O-C 3.32Å; L73-C76 PolarHBondContact O-N 3.35Å; L73-C76 VanDerWaalsContact O-O 3.12Å
74	S	85.2	Confident	78.2	Confident	127 Å²	127	87.7 Å²	87.7	89%	0.888	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67	-30.7	174	56.2	0	0	0	0	112.8	C76	S74-C76 VanDerWaalsContact C-N 3.32Å
75	S	87.8	Confident	76.4	Confident	97 Å²	97	91 Å²	91	68%	0.678	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.5	-17.8	177.1	58.9	0	0	0	0	113.7	L73	L73-S75 VanDerWaalsContact C-N 3.28Å; L73-S75 PolarHBondContact O-N 3.04Å
76	C	78.5	Confident	74.6	Confident	26 Å²	26	96.1 Å²	96.1	18%	0.176	56%	0.558	C	S	.	*	S	Bend	trans	-135.9	79.4	-176.4	-58	0	0	0	0	109	M68 L73 S74 S80	M68-C76 HydrophobicContact CE-CB 3.95Å; M68-C76 HydrophobicContact CG-CB 3.9Å; M68-C76 WeakPolarHBondContact CG-O 3.27Å; M68-C76 HydrophobicContact SD-CB 4.31Å; L73-C76 HydrophobicContact CB-CB 3.99Å; L73-C76 HydrophobicContact CD1-CB 4.14Å; L73-C76 CarbonylContact O-C 3.32Å; L73-C76 PolarHBondContact O-N 3.35Å; L73-C76 VanDerWaalsContact O-O 3.12Å; S74-C76 VanDerWaalsContact C-N 3.32Å; C76-S80 WeakPolarHBondContact CA-OG 3.26Å
77	P	74.2	Confident	72.7	Confident	75 Å²	75	97.9 Å²	97.9	49%	0.487	57%	0.57	S	S	.	*			trans	-58.4	147.9	-179.1	22	-30.6	0	0	0	110.7	G79 S80	P77-G79 PolarHBondContact O-N 3.43Å; P77-S80 WeakPolarHBondContact O-CB 3.25Å; P77-S80 PolarHBondContact O-N 3.02Å; P77-S80 PolarHBondContact O-OG 2.66Å; P77-S80 VanDerWaalsContact O-OG 3.06Å
78	P	70.8	Confident	70.3	Confident	87 Å²	87	102.6 Å²	102.6	57%	0.565	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.1	118.8	-177.7	18.1	-27.7	0	0	0	110	M68	M68-P78 WeakPolarHBondContact O-CA 3.34Å
79	G	66.8	Low	68.2	Low	75 Å²	75	112.2 Å²	112.2	77%	0.773	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	105.1	-6.1	-174.2	0	0	0	0	0	116	P77 G81	P77-G79 PolarHBondContact O-N 3.43Å; G79-G81 PolarHBondContact O-N 3.43Å
80	S	66.1	Low	66	Low	65 Å²	65	120.9 Å²	120.9	46%	0.455	66%	0.656	S	S	.	*			trans	-80.4	-1.2	173.7	73.4	0	0	0	0	114	C76 P77	C76-S80 WeakPolarHBondContact CA-OG 3.26Å; P77-S80 WeakPolarHBondContact O-CB 3.25Å; P77-S80 PolarHBondContact O-N 3.02Å; P77-S80 PolarHBondContact O-OG 2.66Å; P77-S80 VanDerWaalsContact O-OG 3.06Å
81	G	62.4	Low	64.9	Low	20 Å²	20	124.7 Å²	124.7	21%	0.206	67%	0.665	C	S	.	*	S	Bend	trans	-72.1	159.6	-178.9	0	0	0	0	0	112.1	M68 G79 K83	M68-G81 WeakPolarHBondContact SD-CA 3.49Å; M68-G81 PolarHBondContact SD-N 3.03Å; G79-G81 PolarHBondContact O-N 3.43Å; G81-K83 PolarHBondContact O-N 3.21Å
82	P	59.2	Low	63.8	Low	110 Å²	110	129.2 Å²	129.2	71%	0.714	68%	0.679	S	S	*	*			trans	-54.5	119.8	174	22.7	-30.3	0	0	0	108.3	K84	P82-K84 PolarHBondContact O-N 2.79Å
83	K	56.8	Low	62.5	Low	187 Å²	187	125.8 Å²	125.8	81%	0.813	68%	0.675	S	S	*	*			trans	-53.3	113.5	169.3	-76.2	-179.6	178.2	174.6	0	105.4	G81 D85	G81-K83 PolarHBondContact O-N 3.21Å; K83-D85 PolarHBondContact O-N 2.93Å
84	K	57.5	Low	61.1	Low	172 Å²	172	130.8 Å²	130.8	75%	0.748	70%	0.703	S	S	*	*			trans	-60	98.8	165.3	-83.5	-179	178.8	169.6	0	104.5	P82 D86	P82-K84 PolarHBondContact O-N 2.79Å; K84-D86 VanDerWaalsContact C-N 3.34Å; K84-D86 PolarHBondContact O-N 2.77Å
85	D	52.6	Low	59.6	Low	145 Å²	145	131 Å²	131	78%	0.775	69%	0.691	S	S	*	*			trans	-55.8	107.7	168.7	-71.2	-34.5	0	0	0	105.3	K83 K87	K83-D85 PolarHBondContact O-N 2.93Å; D85-K87 VanDerWaalsContact C-N 3.27Å; D85-K87 PolarHBondContact O-N 2.9Å
86	D	52.3	Low	57.7	Low	157 Å²	157	133.3 Å²	133.3	84%	0.84	69%	0.692	S	S	*	*			trans	-51	102.1	166.8	-79.9	-43.3	0	0	0	105.9	K84 K88	K84-D86 VanDerWaalsContact C-N 3.34Å; K84-D86 PolarHBondContact O-N 2.77Å; D86-K88 PolarHBondContact O-N 2.73Å
87	K	46.6	Very low	56.2	Low	200 Å²	200	140.9 Å²	140.9	87%	0.87	73%	0.729	S	S	*	*			trans	-54.6	100	165.1	-93.5	-175.4	176.3	177.5	0	105.2	D85 K89	D85-K87 VanDerWaalsContact C-N 3.27Å; D85-K87 PolarHBondContact O-N 2.9Å; K87-K89 PolarHBondContact O-N 2.84Å
88	K	38.9	Very low	54.8	Low	194 Å²	194	146 Å²	146	84%	0.843	75%	0.747	S	S	*	*			trans	-36.1	102.6	163.7	-96	175	170.7	170	0	107.8	D86 K90	D86-K88 PolarHBondContact O-N 2.73Å; K88-K90 PolarHBondContact O-N 3.06Å
89	K	42.6	Very low	53.5	Low	216 Å²	216	150.9 Å²	150.9	94%	0.939	76%	0.763	S	S	*	*			trans	-63.6	99.6	148.4	-82	-173.9	174.5	-177.7	0	104.8	K87	K87-K89 PolarHBondContact O-N 2.84Å
90	K	39.8	Very low	52.3	Low	270 Å²	270	157.8 Å²	157.8	100%	1.174	76%	0.762	S	S	*	*			trans	-92.3	0	161.8	-152.2	-173.6	-174	-170	0	107.5	K88	K88-K90 PolarHBondContact O-N 3.06Å

Retrieved 90 of 90 residues in 26 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).