X2JDB2_DROME Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession X2JDB2, Species DROME (Drosophila melanogaster, Fruit fly), Gene Dmel\CG9029, Length 122 aa.

						>X2JDB2_DROME|X2JDB2|Dmel\CG9029
MKFLTVFAFACGIVILLVATFVVLHGAYGSPLPEPIPDPSPVADPSPAANPSPVADPKPVAEPSANPGTGTNAEPGPRSKPNPSPSAPATLLEANKQDNFAVPLLETAPQKLDDVQADPQPA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	81.5	Confident	93.5	Very high	211 Å²	211	122.8 Å²	122.8	100%	1.039	64%	0.638	S	S	*	*				0	-61.2	0	-31.8	-177.8	-154	0	0	111.6	F3 L4 T5	M1-F3 PolarHBondContact O-N 3.14Å; M1-L4 PolarHBondContact O-N 3.19Å; M1-L4 VanDerWaalsContact O-N 3.14Å; M1-T5 PolarHBondContact O-N 3.18Å
2	K	92.1	Very high	93.8	Very high	179 Å²	179	115.6 Å²	115.6	78%	0.778	62%	0.615	S	S	*	*	H	α-helix	trans	-53.4	-44.8	-175.2	-66.5	166	168.6	175.6	0	115.1	L4 T5 V6	K2-L4 VanDerWaalsContact C-N 3.32Å; K2-L4 PolarHBondContact O-N 3.01Å; K2-T5 WeakPolarHBondContact O-CB 3.31Å; K2-T5 PolarHBondContact O-N 3.49Å; K2-V6 WeakPolarHBondContact O-CG2 3.42Å; K2-V6 PolarHBondContact O-N 3.41Å
3	F	92.8	Very high	94	Very high	190 Å²	190	112.5 Å²	112.5	83%	0.833	60%	0.598	S	S	*	*	H	α-helix	trans	-61.1	-37.5	179.3	-70.1	-72	0	0	0	113.5	M1 T5 V6 F7	M1-F3 PolarHBondContact O-N 3.14Å; F3-T5 VanDerWaalsContact C-N 3.33Å; F3-V6 PolarHBondContact O-N 3.25Å; F3-F7 WeakPolarHBondContact O-CB 3.36Å; F3-F7 PolarHBondContact O-N 3.22Å
4	L	92.6	Very high	94.3	Very high	127 Å²	127	110.8 Å²	110.8	67%	0.665	59%	0.593	S	S	*	*	H	α-helix	trans	-66.7	-38.2	177.7	-173.6	66.6	0	0	0	110.9	M1 K2 F7 A8	M1-L4 PolarHBondContact O-N 3.19Å; M1-L4 VanDerWaalsContact O-N 3.14Å; K2-L4 VanDerWaalsContact C-N 3.32Å; K2-L4 PolarHBondContact O-N 3.01Å; L4-F7 PolarHBondContact O-N 3.35Å; L4-A8 VanDerWaalsContact O-CB 3.26Å; L4-A8 WeakPolarHBondContact O-CB 3.25Å; L4-A8 PolarHBondContact O-N 3.32Å
5	T	95.2	Very high	94.4	Very high	100 Å²	100	110.7 Å²	110.7	61%	0.613	59%	0.592	S	S	*	*	H	α-helix	trans	-62.7	-45.1	174.1	-50.3	0	0	0	0	111.5	M1 K2 F3 A8 F9	M1-T5 PolarHBondContact O-N 3.18Å; K2-T5 WeakPolarHBondContact O-CB 3.31Å; K2-T5 PolarHBondContact O-N 3.49Å; F3-T5 VanDerWaalsContact C-N 3.33Å; T5-A8 PolarHBondContact O-N 3.31Å; T5-F9 WeakPolarHBondContact O-CB 3.48Å; T5-F9 PolarHBondContact O-N 3.42Å
6	V	94.7	Very high	94.6	Very high	98 Å²	98	110.7 Å²	110.7	59%	0.594	59%	0.591	S	S	*	*	H	α-helix	trans	-64.5	-43	176.8	176.8	0	0	0	0	111	K2 F3 F9 A10	K2-V6 WeakPolarHBondContact O-CG2 3.42Å; K2-V6 PolarHBondContact O-N 3.41Å; F3-V6 PolarHBondContact O-N 3.25Å; V6-F9 PolarHBondContact O-N 3.36Å; V6-A10 WeakPolarHBondContact O-CB 2.95Å; V6-A10 PolarHBondContact O-N 3.34Å
7	F	94.8	Very high	94.7	Very high	141 Å²	141	110.5 Å²	110.5	62%	0.618	59%	0.589	S	S	*	*	H	α-helix	trans	-63.2	-44.2	176.7	177.8	-98.8	0	0	0	112	F3 L4 F9 A10 C11	F3-F7 WeakPolarHBondContact O-CB 3.36Å; F3-F7 PolarHBondContact O-N 3.22Å; L4-F7 PolarHBondContact O-N 3.35Å; F7-F9 VanDerWaalsContact C-N 3.34Å; F7-F9 PolarHBondContact O-N 3.46Å; F7-A10 PolarHBondContact O-N 3.36Å; F7-C11 VanDerWaalsContact O-CB 3.25Å; F7-C11 WeakPolarHBondContact O-CB 3.39Å; F7-C11 PolarHBondContact O-N 2.95Å
8	A	95.3	Very high	94.7	Very high	57 Å²	57	109.1 Å²	109.1	47%	0.471	59%	0.585	S	S	.	*	H	α-helix	trans	-63.4	-40.6	176.6	0	0	0	0	0	111.7	L4 T5 C11 G12	L4-A8 VanDerWaalsContact O-CB 3.26Å; L4-A8 WeakPolarHBondContact O-CB 3.25Å; L4-A8 PolarHBondContact O-N 3.32Å; T5-A8 PolarHBondContact O-N 3.31Å; A8-C11 PolarHBondContact O-N 2.91Å; A8-G12 PolarHBondContact O-N 3.28Å
9	F	96.3	Very high	94.7	Very high	146 Å²	146	106.2 Å²	106.2	64%	0.64	58%	0.577	S	S	*	*	H	α-helix	trans	-64.3	-45.8	175	-177.5	-104.4	0	0	0	112	T5 V6 F7 G12 I13	T5-F9 WeakPolarHBondContact O-CB 3.48Å; T5-F9 PolarHBondContact O-N 3.42Å; V6-F9 PolarHBondContact O-N 3.36Å; F7-F9 VanDerWaalsContact C-N 3.34Å; F7-F9 PolarHBondContact O-N 3.46Å; F9-G12 PolarHBondContact O-N 3.47Å; F9-I13 HydrophobicContact CD1-CD1 3.73Å; F9-I13 HydrophobicContact CE1-CD1 3.25Å; F9-I13 HydrophobicContact CE1-CG1 4.32Å; F9-I13 HydrophobicContact CE2-CD1 4.33Å; F9-I13 HydrophobicContact CG-CD1 4.46Å; F9-I13 HydrophobicContact CZ-CD1 3.6Å; F9-I13 HydrophobicContact CZ-CG1 4.35Å; F9-I13 WeakPolarHBondContact O-CG1 3.22Å; F9-I13 PolarHBondContact O-N 3.08Å
10	A	96.3	Very high	94.7	Very high	48 Å²	48	104.9 Å²	104.9	40%	0.397	57%	0.573	S	S	.	*	H	α-helix	trans	-62	-45.5	176.1	0	0	0	0	0	111.9	V6 F7 G12 I13 V14	V6-A10 WeakPolarHBondContact O-CB 2.95Å; V6-A10 PolarHBondContact O-N 3.34Å; F7-A10 PolarHBondContact O-N 3.36Å; A10-G12 VanDerWaalsContact C-N 3.34Å; A10-G12 PolarHBondContact O-N 3.49Å; A10-I13 PolarHBondContact O-N 2.72Å; A10-V14 WeakPolarHBondContact O-CG2 3.26Å; A10-V14 PolarHBondContact O-N 3.41Å
11	C	96.5	Very high	94.6	Very high	54 Å²	54	106.1 Å²	106.1	37%	0.365	57%	0.573	S	S	.	*	H	α-helix	trans	-60.6	-43.5	175.3	-171.6	0	0	0	0	111.4	F7 A8 I13 V14 I15	F7-C11 VanDerWaalsContact O-CB 3.25Å; F7-C11 WeakPolarHBondContact O-CB 3.39Å; F7-C11 PolarHBondContact O-N 2.95Å; A8-C11 PolarHBondContact O-N 2.91Å; C11-I13 PolarHBondContact O-N 2.75Å; C11-V14 PolarHBondContact O-N 3.37Å; C11-I15 VanDerWaalsContact O-CG1 3.29Å; C11-I15 WeakPolarHBondContact O-CG1 3.39Å; C11-I15 PolarHBondContact O-N 3.03Å
12	G	96.9	Very high	95.1	Very high	36 Å²	36	100.5 Å²	100.5	37%	0.371	55%	0.55	S	S	.	*	H	α-helix	trans	-59.7	-43.8	175.4	0	0	0	0	0	113.1	A8 F9 A10 I15 L16	A8-G12 PolarHBondContact O-N 3.28Å; F9-G12 PolarHBondContact O-N 3.47Å; A10-G12 VanDerWaalsContact C-N 3.34Å; A10-G12 PolarHBondContact O-N 3.49Å; G12-I15 PolarHBondContact O-N 2.9Å; G12-L16 WeakPolarHBondContact O-CB 3.23Å; G12-L16 PolarHBondContact O-N 3.15Å
13	I	97.1	Very high	95	Very high	76 Å²	76	96.8 Å²	96.8	39%	0.39	54%	0.543	S	S	.	.	H	α-helix	trans	-61	-46.9	174	-70.6	169.5	0	0	0	110.7	F9 A10 C11 I15 L16 L17	F9-I13 HydrophobicContact CD1-CD1 3.73Å; F9-I13 HydrophobicContact CE1-CD1 3.25Å; F9-I13 HydrophobicContact CE1-CG1 4.32Å; F9-I13 HydrophobicContact CE2-CD1 4.33Å; F9-I13 HydrophobicContact CG-CD1 4.46Å; F9-I13 HydrophobicContact CZ-CD1 3.6Å; F9-I13 HydrophobicContact CZ-CG1 4.35Å; F9-I13 WeakPolarHBondContact O-CG1 3.22Å; F9-I13 PolarHBondContact O-N 3.08Å; A10-I13 PolarHBondContact O-N 2.72Å; C11-I13 PolarHBondContact O-N 2.75Å; I13-I15 VanDerWaalsContact C-N 3.35Å; I13-I15 PolarHBondContact O-N 3.25Å; I13-L16 PolarHBondContact O-N 2.87Å; I13-L17 HydrophobicContact CG2-CD1 4.01Å; I13-L17 HydrophobicContact CG2-CG 4.29Å; I13-L17 WeakPolarHBondContact O-CG 3.41Å; I13-L17 PolarHBondContact O-N 3Å
14	V	97.5	Very high	94.8	Very high	88 Å²	88	92.2 Å²	92.2	53%	0.533	53%	0.527	S	S	.	.	H	α-helix	trans	-60.8	-44.9	179.9	171.5	0	0	0	0	111.1	A10 C11 L16 L17 V18	A10-V14 WeakPolarHBondContact O-CG2 3.26Å; A10-V14 PolarHBondContact O-N 3.41Å; C11-V14 PolarHBondContact O-N 3.37Å; V14-L16 VanDerWaalsContact C-N 3.33Å; V14-L16 PolarHBondContact O-N 2.98Å; V14-L17 PolarHBondContact O-N 3.06Å; V14-V18 WeakPolarHBondContact O-CG2 3.34Å; V14-V18 PolarHBondContact O-N 2.74Å
15	I	96.9	Very high	94.5	Very high	110 Å²	110	91.5 Å²	91.5	56%	0.564	52%	0.519	S	S	*	.	H	α-helix	trans	-60.8	-44.1	177	-68.8	165.5	0	0	0	110.7	C11 G12 I13 V18 A19	C11-I15 VanDerWaalsContact O-CG1 3.29Å; C11-I15 WeakPolarHBondContact O-CG1 3.39Å; C11-I15 PolarHBondContact O-N 3.03Å; G12-I15 PolarHBondContact O-N 2.9Å; I13-I15 VanDerWaalsContact C-N 3.35Å; I13-I15 PolarHBondContact O-N 3.25Å; I15-V18 PolarHBondContact O-N 2.9Å; I15-A19 WeakPolarHBondContact O-CB 3.34Å; I15-A19 PolarHBondContact O-N 2.64Å
16	L	96.9	Very high	93.9	Very high	110 Å²	110	89.2 Å²	89.2	58%	0.576	52%	0.516	S	S	*	.	H	α-helix	trans	-62.3	-44.6	178	-174.9	131.9	0	0	0	111.7	G12 I13 V14 V18 A19 T20	G12-L16 WeakPolarHBondContact O-CB 3.23Å; G12-L16 PolarHBondContact O-N 3.15Å; I13-L16 PolarHBondContact O-N 2.87Å; V14-L16 VanDerWaalsContact C-N 3.33Å; V14-L16 PolarHBondContact O-N 2.98Å; L16-V18 PolarHBondContact O-N 3.04Å; L16-A19 PolarHBondContact O-N 3.21Å; L16-T20 PolarHBondContact O-N 2.64Å; L16-T20 PolarHBondContact O-OG1 2.8Å; L16-T20 VanDerWaalsContact O-OG1 3.06Å
17	L	96.6	Very high	93.3	Very high	107 Å²	107	87.7 Å²	87.7	56%	0.56	51%	0.514	S	S	*	.	H	α-helix	trans	-60.9	-43.5	176.5	-70.5	176.6	0	0	0	112.1	I13 V14 T20 F21	I13-L17 HydrophobicContact CG2-CD1 4.01Å; I13-L17 HydrophobicContact CG2-CG 4.29Å; I13-L17 WeakPolarHBondContact O-CG 3.41Å; I13-L17 PolarHBondContact O-N 3Å; V14-L17 PolarHBondContact O-N 3.06Å; L17-T20 PolarHBondContact O-N 3.06Å; L17-F21 WeakPolarHBondContact O-CB 3.48Å; L17-F21 PolarHBondContact O-N 3.16Å
18	V	95.6	Very high	92.3	Very high	86 Å²	86	89.5 Å²	89.5	52%	0.521	52%	0.518	S	S	.	.	H	α-helix	trans	-63.2	-44.8	176.6	172.4	0	0	0	0	110.6	V14 I15 L16 T20 F21 V22	V14-V18 WeakPolarHBondContact O-CG2 3.34Å; V14-V18 PolarHBondContact O-N 2.74Å; I15-V18 PolarHBondContact O-N 2.9Å; L16-V18 PolarHBondContact O-N 3.04Å; V18-T20 PolarHBondContact O-N 3.07Å; V18-F21 PolarHBondContact O-N 2.85Å; V18-V22 HydrophobicContact CG1-CG2 4.41Å; V18-V22 WeakPolarHBondContact O-CG2 3.35Å; V18-V22 PolarHBondContact O-N 3.5Å
19	A	94.7	Very high	90.9	Very high	53 Å²	53	88.4 Å²	88.4	44%	0.438	51%	0.512	S	S	.	.	H	α-helix	trans	-60.4	-46	177.3	0	0	0	0	0	111.7	I15 L16 F21 V22 V23	I15-A19 WeakPolarHBondContact O-CB 3.34Å; I15-A19 PolarHBondContact O-N 2.64Å; L16-A19 PolarHBondContact O-N 3.21Å; A19-F21 VanDerWaalsContact C-N 3.35Å; A19-F21 PolarHBondContact O-N 2.77Å; A19-V22 PolarHBondContact O-N 2.83Å; A19-V23 WeakPolarHBondContact O-CG2 3.34Å; A19-V23 PolarHBondContact O-N 2.78Å
20	T	94	Very high	89.6	Confident	81 Å²	81	85.1 Å²	85.1	50%	0.497	51%	0.507	S	S	.	.	H	α-helix	trans	-62.6	-40.8	175.6	-56	0	0	0	0	111.8	L16 L17 V18 V23 L24	L16-T20 PolarHBondContact O-N 2.64Å; L16-T20 PolarHBondContact O-OG1 2.8Å; L16-T20 VanDerWaalsContact O-OG1 3.06Å; L17-T20 PolarHBondContact O-N 3.06Å; V18-T20 PolarHBondContact O-N 3.07Å; T20-V23 PolarHBondContact O-N 3.33Å; T20-L24 VanDerWaalsContact O-CB 3.26Å; T20-L24 WeakPolarHBondContact O-CB 3.39Å; T20-L24 PolarHBondContact O-N 3.32Å
21	F	93.1	Very high	88.2	Confident	130 Å²	130	88.5 Å²	88.5	57%	0.57	53%	0.525	S	S	*	.	H	α-helix	trans	-64.1	-42.7	177.1	-176.6	-95.4	0	0	0	112	L17 V18 A19 V23 L24 H25	L17-F21 WeakPolarHBondContact O-CB 3.48Å; L17-F21 PolarHBondContact O-N 3.16Å; V18-F21 PolarHBondContact O-N 2.85Å; A19-F21 VanDerWaalsContact C-N 3.35Å; A19-F21 PolarHBondContact O-N 2.77Å; F21-V23 VanDerWaalsContact C-N 3.35Å; F21-L24 PolarHBondContact O-N 2.91Å; F21-H25 HydrophobicContact CE1-CB 4.34Å; F21-H25 AromaticContact CZ-CD2 3.99Å; F21-H25 VanDerWaalsContact O-CB 3.23Å; F21-H25 WeakPolarHBondContact O-CB 3.33Å; F21-H25 PolarHBondContact O-N 3.42Å
22	V	91.4	Very high	86.9	Confident	93 Å²	93	93.1 Å²	93.1	56%	0.564	55%	0.545	S	S	*	.	H	α-helix	trans	-62.5	-42.7	175.6	170.9	0	0	0	0	111	V18 A19 G26	V18-V22 HydrophobicContact CG1-CG2 4.41Å; V18-V22 WeakPolarHBondContact O-CG2 3.35Å; V18-V22 PolarHBondContact O-N 3.5Å; A19-V22 PolarHBondContact O-N 2.83Å; V22-G26 WeakPolarHBondContact O-CA 3.43Å; V22-G26 PolarHBondContact O-N 2.88Å
23	V	90.8	Very high	85.6	Confident	102 Å²	102	96.9 Å²	96.9	62%	0.618	56%	0.563	S	S	*	*	H	α-helix	trans	-64.8	-45.2	175.5	171.9	0	0	0	0	111	A19 T20 F21 G26 A27	A19-V23 WeakPolarHBondContact O-CG2 3.34Å; A19-V23 PolarHBondContact O-N 2.78Å; T20-V23 PolarHBondContact O-N 3.33Å; F21-V23 VanDerWaalsContact C-N 3.35Å; V23-G26 PolarHBondContact O-N 2.9Å; V23-A27 WeakPolarHBondContact O-CB 3.44Å; V23-A27 PolarHBondContact O-N 3.34Å
24	L	87.4	Confident	84.7	Confident	94 Å²	94	101.5 Å²	101.5	49%	0.492	58%	0.583	S	S	.	*	H	α-helix	trans	-65.3	-44.8	-179.8	-170.5	75.2	0	0	0	111.1	T20 F21 G26 A27 Y28	T20-L24 VanDerWaalsContact O-CB 3.26Å; T20-L24 WeakPolarHBondContact O-CB 3.39Å; T20-L24 PolarHBondContact O-N 3.32Å; F21-L24 PolarHBondContact O-N 2.91Å; L24-G26 VanDerWaalsContact C-N 3.34Å; L24-A27 PolarHBondContact O-N 3.24Å; L24-Y28 HydrophobicContact CD1-CD2 3.39Å; L24-Y28 HydrophobicContact CD1-CE2 3.61Å; L24-Y28 HydrophobicContact CD1-CG 4.31Å; L24-Y28 HydrophobicContact CG-CD2 4.07Å; L24-Y28 WeakPolarHBondContact O-CA 3.41Å; L24-Y28 VanDerWaalsContact O-CB 3.25Å; L24-Y28 WeakPolarHBondContact O-CB 3.49Å; L24-Y28 WeakPolarHBondContact O-CD2 3.42Å; L24-Y28 PolarHBondContact O-N 3.47Å
25	H	85.9	Confident	83.7	Confident	111 Å²	111	103.1 Å²	103.1	51%	0.514	60%	0.595	S	S	.	*	H	α-helix	trans	-73.6	-27.3	177.8	-159.2	-72.5	0	0	0	112.1	F21 G29	F21-H25 HydrophobicContact CE1-CB 4.34Å; F21-H25 AromaticContact CZ-CD2 3.99Å; F21-H25 VanDerWaalsContact O-CB 3.23Å; F21-H25 WeakPolarHBondContact O-CB 3.33Å; F21-H25 PolarHBondContact O-N 3.42Å; H25-G29 CarbonylContact O-C 3.48Å; H25-G29 WeakPolarHBondContact O-CA 3.25Å; H25-G29 PolarHBondContact O-N 3.35Å
26	G	84.4	Confident	82.9	Confident	52 Å²	52	105.3 Å²	105.3	54%	0.536	61%	0.606	S	S	.	*	H	α-helix	trans	-70.9	-45	171.6	0	0	0	0	0	112.2	V22 V23 L24	V22-G26 WeakPolarHBondContact O-CA 3.43Å; V22-G26 PolarHBondContact O-N 2.88Å; V23-G26 PolarHBondContact O-N 2.9Å; L24-G26 VanDerWaalsContact C-N 3.34Å
27	A	81.6	Confident	82.1	Confident	67 Å²	67	105.6 Å²	105.6	55%	0.554	62%	0.615	S	S	*	*	H	α-helix	trans	-77.7	-38.1	-178.3	0	0	0	0	0	113.2	V23 L24	V23-A27 WeakPolarHBondContact O-CB 3.44Å; V23-A27 PolarHBondContact O-N 3.34Å; L24-A27 PolarHBondContact O-N 3.24Å
28	Y	74.2	Confident	81.5	Confident	179 Å²	179	107.5 Å²	107.5	70%	0.702	63%	0.626	S	S	*	*	H	α-helix	trans	-119.5	-11.6	-172.9	-56.9	-88	0	0	0	114	L24 S30	L24-Y28 HydrophobicContact CD1-CD2 3.39Å; L24-Y28 HydrophobicContact CD1-CE2 3.61Å; L24-Y28 HydrophobicContact CD1-CG 4.31Å; L24-Y28 HydrophobicContact CG-CD2 4.07Å; L24-Y28 WeakPolarHBondContact O-CA 3.41Å; L24-Y28 VanDerWaalsContact O-CB 3.25Å; L24-Y28 WeakPolarHBondContact O-CB 3.49Å; L24-Y28 WeakPolarHBondContact O-CD2 3.42Å; L24-Y28 PolarHBondContact O-N 3.47Å; Y28-S30 VanDerWaalsContact C-N 3.3Å
29	G	65.8	Low	81	Confident	33 Å²	33	109.1 Å²	109.1	34%	0.34	64%	0.638	S	S	.	*	S	Bend	trans	-85.8	-3	176.1	0	0	0	0	0	113.3	H25	H25-G29 CarbonylContact O-C 3.48Å; H25-G29 WeakPolarHBondContact O-CA 3.25Å; H25-G29 PolarHBondContact O-N 3.35Å
30	S	67.6	Low	80.5	Confident	77 Å²	77	111.6 Å²	111.6	54%	0.538	65%	0.652	S	S	.	*	S	Bend	trans	-69.7	125.5	155	-68.8	0	0	0	0	107.2	Y28 L32	Y28-S30 VanDerWaalsContact C-N 3.3Å; S30-L32 PolarHBondContact O-N 2.8Å
31	P	67.9	Low	80	Confident	119 Å²	119	113.9 Å²	113.9	77%	0.773	67%	0.668	S	S	*	*			trans	-53.5	123.9	173.1	23.4	-31.4	0	0	0	107
32	L	67.9	Low	79.6	Confident	152 Å²	152	114.2 Å²	114.2	80%	0.796	68%	0.681	S	S	*	*			trans	-46	133	168.5	-124.8	107.4	0	0	0	106.3	S30 E34	S30-L32 PolarHBondContact O-N 2.8Å; L32-E34 PolarHBondContact O-N 3.35Å
33	P	70.9	Confident	79.3	Confident	114 Å²	114	114 Å²	114	74%	0.74	69%	0.689	S	S	*	*	P	Polyproline II helix	trans	-50.5	126.4	176.6	19.8	-30	0	0	0	107.5
34	E	77	Confident	79	Confident	174 Å²	174	116.4 Å²	116.4	81%	0.813	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-50.7	138.8	-179.6	-69.5	-173.1	171.6	0	0	108.4	L32 I36	L32-E34 PolarHBondContact O-N 3.35Å; E34-I36 PolarHBondContact O-N 3.06Å
35	P	76.5	Confident	78.8	Confident	122 Å²	122	117.6 Å²	117.6	79%	0.792	71%	0.711	S	S	*	*	P	Polyproline II helix	trans	-51.4	121.2	175	-23.9	32.6	0	0	0	108.9	P37	P35-P37 WeakPolarHBondContact O-CD 3.26Å
36	I	80.8	Confident	78.8	Confident	155 Å²	155	117.4 Å²	117.4	80%	0.795	72%	0.723	S	S	*	*	P	Polyproline II helix	trans	-58.8	125.6	175.7	-61	174.5	0	0	0	106.5	E34 D38	E34-I36 PolarHBondContact O-N 3.06Å; I36-D38 PolarHBondContact O-N 2.9Å
37	P	81.1	Confident	78.7	Confident	116 Å²	116	120.6 Å²	120.6	75%	0.753	73%	0.734	S	S	*	*	P	Polyproline II helix	trans	-55.3	135.4	177.7	-25.4	33.7	0	0	0	110.6	P35	P35-P37 WeakPolarHBondContact O-CD 3.26Å
38	D	84.1	Confident	78.9	Confident	148 Å²	148	122 Å²	122	79%	0.791	75%	0.745	S	S	*	*	P	Polyproline II helix	trans	-55.5	142.6	174.8	-76.1	-42.9	0	0	0	110.3	I36 S40	I36-D38 PolarHBondContact O-N 2.9Å; D38-S40 PolarHBondContact O-N 3.28Å
39	P	83.5	Confident	79.4	Confident	119 Å²	119	118 Å²	118	77%	0.773	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-58.2	130.6	175.5	24.8	-32.8	0	0	0	109.4
40	S	84.8	Confident	80.2	Confident	105 Å²	105	123.8 Å²	123.8	73%	0.734	77%	0.772	S	S	*	*	P	Polyproline II helix	trans	-60.9	141.6	174.1	-69	0	0	0	0	110.2	D38 V42	D38-S40 PolarHBondContact O-N 3.28Å; S40-V42 PolarHBondContact O-N 2.97Å
41	P	82.9	Confident	81	Confident	129 Å²	129	125.5 Å²	125.5	84%	0.838	78%	0.782	S	S	*	*	P	Polyproline II helix	trans	-54.9	129	174.7	-24.2	33.1	0	0	0	110.9
42	V	85.5	Confident	81.7	Confident	138 Å²	138	124.8 Å²	124.8	84%	0.836	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-73.9	131.2	172.4	-177.9	0	0	0	0	107.7	S40	S40-V42 PolarHBondContact O-N 2.97Å
43	A	83.9	Confident	82.4	Confident	89 Å²	89	123.3 Å²	123.3	74%	0.736	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-62.2	137	175.2	0	0	0	0	0	110.4
44	D	85.5	Confident	83	Confident	152 Å²	152	124.3 Å²	124.3	81%	0.813	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-59	142.3	175.5	-75.4	-43.7	0	0	0	110.9	S46	D44-S46 PolarHBondContact O-N 3.48Å
45	P	84.2	Confident	83.3	Confident	118 Å²	118	120.3 Å²	120.3	77%	0.766	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-60.8	133.2	173.9	25.5	-32.6	0	0	0	110
46	S	84.6	Confident	83.7	Confident	108 Å²	108	121.6 Å²	121.6	76%	0.755	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-59.8	140.4	173.6	-176.8	0	0	0	0	110	D44 A48	D44-S46 PolarHBondContact O-N 3.48Å; S46-A48 PolarHBondContact O-N 3.31Å
47	P	82.7	Confident	83.8	Confident	118 Å²	118	120 Å²	120	77%	0.766	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-53.4	133.2	172	-25.5	34.1	0	0	0	111
48	A	85.1	Confident	83.9	Confident	96 Å²	96	123.4 Å²	123.4	79%	0.793	78%	0.782	S	S	*	*	P	Polyproline II helix	trans	-65.2	139.2	172.5	0	0	0	0	0	109.8	S46 N50	S46-A48 PolarHBondContact O-N 3.31Å; A48-N50 PolarHBondContact O-N 2.98Å
49	A	84.1	Confident	83.7	Confident	96 Å²	96	122.5 Å²	122.5	79%	0.793	79%	0.785	S	S	*	*	P	Polyproline II helix	trans	-60.8	137	172.2	0	0	0	0	0	109.9
50	N	84.1	Confident	83.5	Confident	154 Å²	154	123.2 Å²	123.2	82%	0.824	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-59.9	140.5	174.1	-103.7	-51.9	0	0	0	110.1	A48 S52	A48-N50 PolarHBondContact O-N 2.98Å; N50-S52 PolarHBondContact O-N 3.45Å
51	P	83.9	Confident	83.2	Confident	113 Å²	113	122.5 Å²	122.5	73%	0.734	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-59.3	138.3	172	24.3	-31.5	0	0	0	110.1
52	S	83.7	Confident	82.9	Confident	104 Å²	104	125 Å²	125	73%	0.727	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-66.7	143.3	174.6	-170.7	0	0	0	0	110	N50 V54	N50-S52 PolarHBondContact O-N 3.45Å; S52-V54 PolarHBondContact O-N 2.99Å
53	P	80.9	Confident	82.3	Confident	121 Å²	121	124.4 Å²	124.4	79%	0.786	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-54.8	132.4	172.2	-24.9	34	0	0	0	111.2
54	V	84.4	Confident	81.5	Confident	136 Å²	136	125.7 Å²	125.7	82%	0.824	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-75.8	131.4	170.5	-179.7	0	0	0	0	107.5	S52	S52-V54 PolarHBondContact O-N 2.99Å
55	A	83	Confident	80.4	Confident	89 Å²	89	122.7 Å²	122.7	74%	0.736	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-63.6	138.4	175.9	0	0	0	0	0	110.6
56	D	84.2	Confident	79.1	Confident	149 Å²	149	123.8 Å²	123.8	80%	0.797	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-59	143	178.2	-71.3	-48.8	0	0	0	111.7	K58	D56-K58 PolarHBondContact O-N 3.22Å
57	P	82.9	Confident	77.4	Confident	121 Å²	121	124.3 Å²	124.3	79%	0.786	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-59.8	135.4	173.6	23	-30.1	0	0	0	110.3
58	K	84.1	Confident	75.7	Confident	188 Å²	188	121 Å²	121	82%	0.817	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-67.2	143.5	175.2	-69.8	-175.1	179.3	176.1	0	110.2	D56 V60	D56-K58 PolarHBondContact O-N 3.22Å; K58-V60 PolarHBondContact O-N 3.23Å
59	P	79.6	Confident	74	Confident	130 Å²	130	123.1 Å²	123.1	84%	0.844	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-54.4	126.5	171.5	-24.3	33.5	0	0	0	110.9
60	V	80.1	Confident	72.2	Confident	134 Å²	134	121.5 Å²	121.5	81%	0.812	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-76.8	129.2	170.3	179.5	0	0	0	0	107.3	K58 E62	K58-V60 PolarHBondContact O-N 3.23Å; V60-E62 PolarHBondContact O-N 3.45Å
61	A	78.9	Confident	70.5	Confident	90 Å²	90	121.1 Å²	121.1	74%	0.744	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-61.3	132.4	175.4	0	0	0	0	0	109.7
62	E	75.1	Confident	68.9	Low	180 Å²	180	124 Å²	124	84%	0.841	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-60.4	143	177.9	-67	-174.8	166.6	0	0	110.7	V60 S64	V60-E62 PolarHBondContact O-N 3.45Å; E62-S64 PolarHBondContact O-N 3.34Å; E62-S64 VanDerWaalsContact O-N 3.14Å
63	P	73.8	Confident	67.4	Low	126 Å²	126	123.1 Å²	123.1	82%	0.818	78%	0.782	S	S	*	*	P	Polyproline II helix	trans	-57.7	120.6	174	-20.3	31	0	0	0	110.1	A65	P63-A65 PolarHBondContact O-N 3.46Å
64	S	67.1	Low	66	Low	116 Å²	116	126 Å²	126	81%	0.811	79%	0.785	S	S	*	*	P	Polyproline II helix	trans	-57.9	122.9	171.6	-172.6	0	0	0	0	108.7	E62 N66	E62-S64 PolarHBondContact O-N 3.34Å; E62-S64 VanDerWaalsContact O-N 3.14Å; S64-N66 PolarHBondContact O-N 3.48Å
65	A	61.3	Low	65	Low	89 Å²	89	125.6 Å²	125.6	74%	0.736	79%	0.785	S	S	*	*			trans	-54	113	175.9	0	0	0	0	0	109.3	P63 P67	P63-A65 PolarHBondContact O-N 3.46Å; A65-P67 VanDerWaalsContact O-CD 3.31Å; A65-P67 WeakPolarHBondContact O-CD 3.29Å
66	N	58.4	Low	64.1	Low	141 Å²	141	124.1 Å²	124.1	75%	0.754	78%	0.779	S	S	*	*			trans	-76.4	115.6	174.6	-170.8	32.5	0	0	0	108.5	S64 G68	S64-N66 PolarHBondContact O-N 3.48Å; N66-G68 PolarHBondContact ND2-O 2.95Å
67	P	48.6	Very low	63.1	Low	119 Å²	119	123.3 Å²	123.3	77%	0.773	78%	0.782	S	S	*	*			trans	-85.3	117.2	176.5	15.6	0.8	0	0	0	109.5	A65	A65-P67 VanDerWaalsContact O-CD 3.31Å; A65-P67 WeakPolarHBondContact O-CD 3.29Å
68	G	47	Very low	61.9	Low	49 Å²	49	129.2 Å²	129.2	51%	0.505	79%	0.788	S	S	.	*			trans	86.5	122.4	177.8	0	0	0	0	0	111.1	N66	N66-G68 PolarHBondContact ND2-O 2.95Å
69	T	48.8	Very low	60.7	Low	140 Å²	140	126 Å²	126	86%	0.859	79%	0.79	S	S	*	*				-152.2	122	67.1	48.1	0	0	0	0	107.7
70	G	47.5	Very low	59.9	Low	63 Å²	63	129 Å²	129	65%	0.649	79%	0.789	S	S	*	*				77.6	87.3	66.7	0	0	0	0	0	109.5
71	T	48.2	Very low	59.1	Low	146 Å²	146	128.5 Å²	128.5	90%	0.896	79%	0.789	S	S	*	*			trans	52.3	87.2	155.9	62.2	0	0	0	0	117.3
72	N	50.1	Low	58.5	Low	172 Å²	172	131.2 Å²	131.2	92%	0.92	79%	0.791	S	S	*	*			trans	-90	113.2	159.9	-156.7	6.9	0	0	0	109
73	A	51.3	Low	57.8	Low	87 Å²	87	128.2 Å²	128.2	72%	0.719	79%	0.787	S	S	*	*			trans	-66.9	147.4	179.6	0	0	0	0	0	111.6
74	E	51.6	Low	56.9	Low	182 Å²	182	127.4 Å²	127.4	85%	0.85	78%	0.784	S	S	*	*			trans	-24.7	128.1	177.8	-159	152.6	106	0	0	117.6	G76	E74-G76 PolarHBondContact O-N 3.47Å
75	P	63.5	Low	56.4	Low	126 Å²	126	127.1 Å²	127.1	82%	0.818	78%	0.78	S	S	*	*			trans	-64.4	114.7	169.6	-20	32.4	0	0	0	111.2
76	G	64.2	Low	55.9	Low	59 Å²	59	128.5 Å²	128.5	61%	0.608	78%	0.784	S	S	*	*			trans	-58.3	164.8	175.7	0	0	0	0	0	114.3	E74 R78	E74-G76 PolarHBondContact O-N 3.47Å; G76-R78 PolarHBondContact O-N 3.36Å
77	P	62.8	Low	55.7	Low	132 Å²	132	126.5 Å²	126.5	86%	0.857	79%	0.787	S	S	*	*			trans	-64.4	124.8	-166.3	24.3	-32.5	0	0	0	112.3	S79	P77-S79 PolarHBondContact O-N 3.3Å
78	R	59.1	Low	55.5	Low	244 Å²	244	126.4 Å²	126.4	92%	0.921	79%	0.787	S	S	*	*			trans	-63.2	113.3	173.1	-77.9	177.3	168.2	142.6	-3.7	110.4	G76 K80	G76-R78 PolarHBondContact O-N 3.36Å; R78-K80 PolarHBondContact O-N 2.9Å
79	S	58.7	Low	55.6	Low	121 Å²	121	128.4 Å²	128.4	85%	0.846	80%	0.798	S	S	*	*	P	Polyproline II helix	trans	-61.4	124.9	164.2	-62.3	0	0	0	0	109.6	P77	P77-S79 PolarHBondContact O-N 3.3Å
80	K	62.9	Low	55.3	Low	192 Å²	192	127.1 Å²	127.1	84%	0.835	79%	0.791	S	S	*	*	P	Polyproline II helix	trans	-62.2	145	-175.2	-68.1	174.6	179.9	172.8	0	111.5	R78 N82	R78-K80 PolarHBondContact O-N 2.9Å; K80-N82 PolarHBondContact O-N 2.98Å
81	P	63	Low	55.5	Low	125 Å²	125	132.2 Å²	132.2	81%	0.812	80%	0.802	S	S	*	*	P	Polyproline II helix	trans	-63.4	126.3	172.8	-14.7	28.5	0	0	0	109.9
82	N	66.5	Low	55.4	Low	146 Å²	146	131 Å²	131	78%	0.781	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-72.1	121.9	174.6	-171.1	43.7	0	0	0	109.5	K80	K80-N82 PolarHBondContact O-N 2.98Å
83	P	59.9	Low	55.2	Low	118 Å²	118	129.9 Å²	129.9	77%	0.766	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-83.3	124.5	174.4	31.8	-27.1	0	0	0	108.7
84	S	55.5	Low	55.1	Low	108 Å²	108	129.8 Å²	129.8	76%	0.755	78%	0.778	S	S	*	*			trans	-128.2	140	170.4	-143.3	0	0	0	0	109.7
85	P	55	Low	55.1	Low	110 Å²	110	128.7 Å²	128.7	71%	0.714	78%	0.778	S	S	*	*			trans	-101.2	147.6	-144.7	7.2	13.8	0	0	0	114.4
86	S	50.8	Low	54.8	Low	119 Å²	119	130.7 Å²	130.7	83%	0.832	77%	0.773	S	S	*	*			trans	39.8	111.9	134	-48.9	0	0	0	0	119.9
87	A	54.2	Low	54.1	Low	98 Å²	98	135.6 Å²	135.6	81%	0.81	78%	0.781	S	S	*	*				-169.1	150.9	124	0	0	0	0	0	111.2
88	P	45.4	Very low	53.6	Low	118 Å²	118	136 Å²	136	77%	0.766	78%	0.776	S	S	*	*			trans	-101	145.5	-149.8	37.1	-29.6	0	0	0	112.5
89	A	48.7	Very low	53.4	Low	91 Å²	91	130.8 Å²	130.8	75%	0.752	77%	0.766	S	S	*	*			trans	-148.2	78.1	155.1	0	0	0	0	0	108.2	L91	A89-L91 VanDerWaalsContact C-N 3.25Å; A89-L91 PolarHBondContact O-N 3.43Å
90	T	42.8	Very low	53.1	Low	113 Å²	113	134.3 Å²	134.3	69%	0.693	77%	0.767	S	S	*	*			trans	-56.3	95.4	157.2	-51.5	0	0	0	0	106.8	L92	T90-L92 HydrophobicContact CG2-CB 4.06Å; T90-L92 HydrophobicContact CG2-CD1 4.23Å; T90-L92 PolarHBondContact O-N 2.89Å
91	L	52	Low	52.6	Low	169 Å²	169	128.6 Å²	128.6	89%	0.885	76%	0.755	S	S	*	*			trans	-74.2	72.2	155.8	-72.9	-177.9	0	0	0	107.6	A89	A89-L91 VanDerWaalsContact C-N 3.25Å; A89-L91 PolarHBondContact O-N 3.43Å
92	L	45.5	Very low	52.2	Low	122 Å²	122	128.2 Å²	128.2	64%	0.639	75%	0.75	S	S	*	*			trans	-56	115.7	135.9	-141.7	71.3	0	0	0	103.4	T90	T90-L92 HydrophobicContact CG2-CB 4.06Å; T90-L92 HydrophobicContact CG2-CD1 4.23Å; T90-L92 PolarHBondContact O-N 2.89Å
93	E	46.4	Very low	51.8	Low	148 Å²	148	126.2 Å²	126.2	69%	0.692	75%	0.745	S	S	*	*				-179.1	144.2	75.5	-130.9	102.5	158.8	0	0	108.9
94	A	47.8	Very low	51.2	Low	85 Å²	85	127.7 Å²	127.7	70%	0.702	75%	0.746	S	S	*	*			trans	58	78.2	139.1	0	0	0	0	0	119.5	K96	A94-K96 PolarHBondContact O-N 2.92Å
95	N	53.2	Low	51	Low	159 Å²	159	130.5 Å²	130.5	85%	0.85	75%	0.752	S	S	*	*			trans	-89.7	73.7	137.7	-160.4	-66.8	0	0	0	107.4
96	K	56.9	Low	50.4	Low	167 Å²	167	132.2 Å²	132.2	73%	0.726	75%	0.75	S	S	*	*			trans	-82.8	124.7	167.3	-148.3	178.4	-164.2	177.5	0	105.4	A94 D98	A94-K96 PolarHBondContact O-N 2.92Å; K96-D98 PolarHBondContact O-N 3.38Å
97	Q	49.5	Very low	50.1	Low	163 Å²	163	132.5 Å²	132.5	76%	0.762	75%	0.747	S	S	*	*			trans	-49.7	78.4	170.7	-162.3	89.6	-4.9	0	0	110.7	N99	Q97-N99 PolarHBondContact O-N 3.06Å
98	D	52	Low	49.9	Very low	141 Å²	141	132.1 Å²	132.1	75%	0.754	74%	0.744	S	S	*	*			trans	-86.9	112.9	178.8	-100.8	-23.8	0	0	0	109.3	K96	K96-D98 PolarHBondContact O-N 3.38Å
99	N	55.8	Low	50.3	Low	134 Å²	134	132.2 Å²	132.2	72%	0.717	74%	0.744	S	S	*	*			trans	57.5	93.5	153.5	-89	-18.7	0	0	0	116.9	Q97 A101	Q97-N99 PolarHBondContact O-N 3.06Å; N99-A101 HydrophobicContact CB-CB 3.95Å; N99-A101 PolarHBondContact O-N 3.41Å
100	F	51.1	Low	50.5	Low	195 Å²	195	136.5 Å²	136.5	86%	0.855	75%	0.749	S	S	*	*				-56.5	68.6	129.2	-83.4	-92.2	0	0	0	109.2	V102	F100-V102 PolarHBondContact O-N 3.19Å; F100-V102 VanDerWaalsContact O-N 3.08Å
101	A	52.4	Low	50.9	Low	72 Å²	72	138.6 Å²	138.6	60%	0.595	75%	0.748	S	S	*	*			trans	-78.5	84.4	162.3	0	0	0	0	0	105.9	N99	N99-A101 HydrophobicContact CB-CB 3.95Å; N99-A101 PolarHBondContact O-N 3.41Å
102	V	54.3	Low	51.1	Low	117 Å²	117	138.1 Å²	138.1	71%	0.709	75%	0.746	S	S	*	*			trans	-48.2	128.2	152.5	-175.5	0	0	0	0	105.8	F100 L104	F100-V102 PolarHBondContact O-N 3.19Å; F100-V102 VanDerWaalsContact O-N 3.08Å; V102-L104 PolarHBondContact O-N 2.85Å
103	P	57.7	Low	51.7	Low	104 Å²	104	137.5 Å²	137.5	68%	0.675	74%	0.743	S	S	*	*			trans	-63.1	108.7	173.3	26.8	-29.9	0	0	0	106	L105	P103-L105 PolarHBondContact O-N 3.37Å
104	L	49	Very low	52	Low	149 Å²	149	138 Å²	138	78%	0.78	75%	0.75	S	S	*	*			trans	-63.2	79.2	169.5	-168.4	90.7	0	0	0	107.1	V102 E106	V102-L104 PolarHBondContact O-N 2.85Å; L104-E106 HydrophobicContact CD1-CB 4.36Å; L104-E106 HydrophobicContact CG-CB 4.11Å; L104-E106 PolarHBondContact O-N 3.34Å
105	L	50.2	Low	52.5	Low	167 Å²	167	140.1 Å²	140.1	87%	0.874	76%	0.755	S	S	*	*			trans	-74.2	57.2	161.6	-101.1	164.7	0	0	0	107.4	P103	P103-L105 PolarHBondContact O-N 3.37Å
106	E	43.3	Very low	52.2	Low	145 Å²	145	141.8 Å²	141.8	68%	0.678	76%	0.757	S	S	*	*			trans	-144.7	128.9	179.1	-161.3	126.5	99.4	0	0	108.6	L104	L104-E106 HydrophobicContact CD1-CB 4.36Å; L104-E106 HydrophobicContact CG-CB 4.11Å; L104-E106 PolarHBondContact O-N 3.34Å
107	T	43	Very low	52.3	Low	125 Å²	125	137.8 Å²	137.8	77%	0.767	76%	0.756	S	S	*	*			trans	91	65.4	168.5	-34	0	0	0	0	116.1
108	A	51.5	Low	52.9	Low	90 Å²	90	135.7 Å²	135.7	74%	0.744	75%	0.75	S	S	*	*			trans	-80.7	128	145.2	0	0	0	0	0	108.3	Q110	A108-Q110 PolarHBondContact O-N 2.95Å; A108-Q110 VanDerWaalsContact O-N 3.15Å
109	P	54	Low	53.5	Low	120 Å²	120	134.6 Å²	134.6	78%	0.779	75%	0.75	S	S	*	*			trans	-73.9	108	179.5	29.1	-31.4	0	0	0	109.3	K111	P109-K111 PolarHBondContact O-N 3.41Å
110	Q	51.8	Low	53.8	Low	182 Å²	182	136 Å²	136	85%	0.85	75%	0.752	S	S	*	*			trans	-66.2	101.7	164	-75.6	-87.6	-45.8	0	0	107.4	A108 L112	A108-Q110 PolarHBondContact O-N 2.95Å; A108-Q110 VanDerWaalsContact O-N 3.15Å; Q110-L112 VanDerWaalsContact C-N 3.32Å; Q110-L112 PolarHBondContact O-N 3.44Å
111	K	52.6	Low	54	Low	157 Å²	157	132.5 Å²	132.5	68%	0.683	75%	0.749	S	S	*	*			trans	-54.5	92.2	167.2	-177.6	175.2	179.6	-81.8	0	108.6	P109 D113	P109-K111 PolarHBondContact O-N 3.41Å; K111-D113 IonicContact NZ-OD1 2.64Å; K111-D113 PolarHBondContact NZ-OD1 2.84Å; K111-D113 IonicContact NZ-OD2 2.64Å; K111-D113 PolarHBondContact NZ-OD2 3.49Å; K111-D113 PolarHBondContact O-N 2.85Å; K111-D113 VanDerWaalsContact O-N 3.16Å
112	L	54.5	Low	54.3	Low	158 Å²	158	137.6 Å²	137.6	83%	0.827	79%	0.791	S	S	*	*			trans	-72.2	94.9	163	-96.3	143.2	0	0	0	106.3	Q110 D114	Q110-L112 VanDerWaalsContact C-N 3.32Å; Q110-L112 PolarHBondContact O-N 3.44Å; L112-D114 PolarHBondContact O-N 3.5Å
113	D	58.5	Low	54.3	Low	109 Å²	109	138.6 Å²	138.6	58%	0.583	80%	0.795	S	S	*	*			trans	-68.2	108.8	167.1	-77.6	-72.5	0	0	0	108.8	K111 V115	K111-D113 IonicContact NZ-OD1 2.64Å; K111-D113 PolarHBondContact NZ-OD1 2.84Å; K111-D113 IonicContact NZ-OD2 2.64Å; K111-D113 PolarHBondContact NZ-OD2 3.49Å; K111-D113 PolarHBondContact O-N 2.85Å; K111-D113 VanDerWaalsContact O-N 3.16Å; D113-V115 PolarHBondContact O-N 2.83Å
114	D	53.2	Low	54.2	Low	158 Å²	158	140.4 Å²	140.4	85%	0.845	80%	0.801	S	S	*	*			trans	-49.6	104.7	161.1	-66.4	-75.6	0	0	0	110.8	L112	L112-D114 PolarHBondContact O-N 3.5Å
115	V	58.4	Low	54.4	Low	131 Å²	131	139.9 Å²	139.9	79%	0.794	80%	0.803	S	S	*	*			trans	-125.1	68.2	154.7	-174.8	0	0	0	0	107.7	D113	D113-V115 PolarHBondContact O-N 2.83Å
116	Q	46.1	Very low	54.7	Low	193 Å²	193	138.4 Å²	138.4	90%	0.902	80%	0.798	S	S	*	*			trans	-85.8	94.1	158.1	-173.7	145.5	-77.5	0	0	107.4
117	A	60.3	Low	55.4	Low	84 Å²	84	137.9 Å²	137.9	69%	0.694	81%	0.806	S	S	*	*			trans	-135.5	98.4	165.3	0	0	0	0	0	108.1
118	D	60.9	Low	56.2	Low	119 Å²	119	138.8 Å²	138.8	64%	0.636	81%	0.808	S	S	*	*			trans	-45.4	148.4	169.1	-175	51.6	0	0	0	113	Q120	D118-Q120 PolarHBondContact OD1-N 3.3Å; D118-Q120 WeakPolarHBondContact OD2-CG 3.33Å; D118-Q120 PolarHBondContact OD2-N 3.14Å
119	P	65.6	Low	56.6	Low	117 Å²	117	142.3 Å²	142.3	76%	0.76	81%	0.813	S	S	*	*				-129	112.9	121.5	32.4	-23	0	0	0	112.1
120	Q	61.3	Low	56.8	Low	164 Å²	164	144 Å²	144	77%	0.766	82%	0.816	S	S	*	*			trans	-55.3	138.2	166.6	-92.2	-167.7	-108.2	0	0	111.9	D118	D118-Q120 PolarHBondContact OD1-N 3.3Å; D118-Q120 WeakPolarHBondContact OD2-CG 3.33Å; D118-Q120 PolarHBondContact OD2-N 3.14Å
121	P	55.2	Low	57.2	Low	122 Å²	122	140.8 Å²	140.8	79%	0.792	81%	0.813	S	S	*	*			trans	-91.6	130.1	169	33.9	-27.8	0	0	0	111.1
122	A	59.9	Low	57.6	Low	178 Å²	178	139.4 Å²	139.4	100%	1.471	83%	0.825	S	S	*	*			trans	-146.8	0	153.2	0	0	0	0	0	108.7

Retrieved 122 of 122 residues in 94.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).