X2JEC8_DROME Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession X2JEC8, Species DROME (Drosophila melanogaster, Fruit fly), Gene Dmel\CG44303, Length 88 aa.

						>X2JEC8_DROME|X2JEC8|Dmel\CG44303
MHPPQNPNKLDAEDSLDQAIDNIEDSNEANLYKLIELEEQNVAWEKHLAELQIMIRQVMEKLDRSLVKQEALVAKMQKLKNQKDQEGQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.9	Very low	61.5	Low	238 Å²	238	126.9 Å²	126.9	100%	1.172	67%	0.667	S	S	*	*				0	74.4	0	-71.5	-77.3	-132.2	0	0	108.2
2	H	46.4	Very low	63.6	Low	182 Å²	182	120.3 Å²	120.3	84%	0.843	64%	0.644	S	S	*	*	P	Polyproline II helix	trans	-91.5	131.7	161.5	-85.5	-91.1	0	0	0	106
3	P	56.6	Low	65.5	Low	104 Å²	104	119.5 Å²	119.5	68%	0.675	63%	0.634	S	S	*	*	P	Polyproline II helix	trans	-54.5	137.5	166.1	24.3	-30.3	0	0	0	107.1	Q5	P3-Q5 PolarHBondContact O-N 2.96Å
4	P	58.4	Low	67.2	Low	124 Å²	124	118.3 Å²	118.3	81%	0.805	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-54.3	117.4	175.4	21.6	-29.9	0	0	0	107.1	N6	P4-N6 PolarHBondContact O-N 2.93Å
5	Q	56.7	Low	68.7	Low	162 Å²	162	115.3 Å²	115.3	76%	0.757	62%	0.62	S	S	*	*			trans	-53.4	111	168.9	-78.3	173.7	-40.1	0	0	105.1	P3 P7	P3-Q5 PolarHBondContact O-N 2.96Å; Q5-P7 WeakPolarHBondContact O-CD 3.07Å; Q5-P7 VanDerWaalsContact O-N 3.11Å
6	N	55.1	Low	70.3	Confident	77 Å²	77	114.9 Å²	114.9	41%	0.412	62%	0.617	S	S	.	*			trans	-69.9	108.8	178.8	-173.4	3.6	0	0	0	105.9	P4 N8 K9	P4-N6 PolarHBondContact O-N 2.93Å; N6-N8 PolarHBondContact O-N 3.13Å; N6-N8 VanDerWaalsContact O-N 3.13Å; N6-N8 WeakPolarHBondContact OD1-CB 3.45Å; N6-K9 HydrophobicContact CB-CG 4.22Å; N6-K9 PolarHBondContact O-N 2.93Å
7	P	63.1	Low	71.7	Confident	83 Å²	83	113.6 Å²	113.6	54%	0.539	61%	0.61	S	S	.	*	H	α-helix	trans	-54.9	-36.9	-176	-21.5	34.1	0	0	0	110.6	Q5 K9 L10 D11	Q5-P7 WeakPolarHBondContact O-CD 3.07Å; Q5-P7 VanDerWaalsContact O-N 3.11Å; P7-K9 PolarHBondContact O-N 3.28Å; P7-L10 PolarHBondContact O-N 2.93Å; P7-L10 VanDerWaalsContact O-N 3.1Å; P7-D11 PolarHBondContact O-N 2.93Å; P7-D11 VanDerWaalsContact O-N 3.07Å
8	N	69.4	Low	73	Confident	110 Å²	110	114.3 Å²	114.3	59%	0.588	61%	0.609	S	S	*	*	H	α-helix	trans	-56.9	-23.5	177.3	-58.2	-0.3	0	0	0	114.8	N6 A12	N6-N8 PolarHBondContact O-N 3.13Å; N6-N8 VanDerWaalsContact O-N 3.13Å; N6-N8 WeakPolarHBondContact OD1-CB 3.45Å; N8-A12 WeakPolarHBondContact O-CB 3.41Å; N8-A12 PolarHBondContact O-N 3.01Å
9	K	71.3	Confident	74.2	Confident	140 Å²	140	110.5 Å²	110.5	61%	0.609	60%	0.595	S	S	*	*	H	α-helix	trans	-79.5	-42.3	177.4	-77.6	-168.2	175	-166.7	0	111.9	N6 P7 A12 E13	N6-K9 HydrophobicContact CB-CG 4.22Å; N6-K9 PolarHBondContact O-N 2.93Å; P7-K9 PolarHBondContact O-N 3.28Å; K9-A12 PolarHBondContact O-N 3.04Å; K9-E13 WeakPolarHBondContact O-CG 3.44Å; K9-E13 PolarHBondContact O-N 3.38Å
10	L	74.6	Confident	75.3	Confident	82 Å²	82	109.1 Å²	109.1	43%	0.429	59%	0.586	S	S	.	*	H	α-helix	trans	-66.7	-42.2	176.7	-68.9	170	0	0	0	110.2	P7 A12 E13 D14	P7-L10 PolarHBondContact O-N 2.93Å; P7-L10 VanDerWaalsContact O-N 3.1Å; L10-A12 PolarHBondContact O-N 3.02Å; L10-E13 PolarHBondContact O-N 3.32Å; L10-D14 PolarHBondContact O-N 3.07Å
11	D	86.1	Confident	76.3	Confident	94 Å²	94	108.3 Å²	108.3	50%	0.503	58%	0.582	S	S	.	*	H	α-helix	trans	-58.5	-35.2	175	-63.3	-29.1	0	0	0	112.2	P7 S15	P7-D11 PolarHBondContact O-N 2.93Å; P7-D11 VanDerWaalsContact O-N 3.07Å; D11-S15 VanDerWaalsContact O-CB 3.27Å; D11-S15 WeakPolarHBondContact O-CB 3.25Å; D11-S15 PolarHBondContact O-N 3.1Å; D11-S15 VanDerWaalsContact O-N 3.11Å; D11-S15 PolarHBondContact O-OG 3.11Å
12	A	86.3	Confident	79	Confident	48 Å²	48	101.4 Å²	101.4	40%	0.397	55%	0.55	S	S	.	.	H	α-helix	trans	-76	-38.3	178.4	0	0	0	0	0	112.8	N8 K9 L10 S15 L16	N8-A12 WeakPolarHBondContact O-CB 3.41Å; N8-A12 PolarHBondContact O-N 3.01Å; K9-A12 PolarHBondContact O-N 3.04Å; L10-A12 PolarHBondContact O-N 3.02Å; A12-S15 PolarHBondContact O-N 2.89Å; A12-L16 WeakPolarHBondContact O-CB 3.49Å; A12-L16 VanDerWaalsContact O-CG 3.25Å; A12-L16 WeakPolarHBondContact O-CG 3.48Å; A12-L16 PolarHBondContact O-N 3.48Å
13	E	88.1	Confident	81.4	Confident	110 Å²	110	97.5 Å²	97.5	51%	0.514	53%	0.534	S	S	.	.	H	α-helix	trans	-64.7	-49.2	175.1	-74.1	170.3	-172.6	0	0	110.6	K9 L10 S15 L16 D17	K9-E13 WeakPolarHBondContact O-CG 3.44Å; K9-E13 PolarHBondContact O-N 3.38Å; L10-E13 PolarHBondContact O-N 3.32Å; E13-S15 VanDerWaalsContact C-N 3.28Å; E13-S15 PolarHBondContact O-N 3.19Å; E13-L16 WeakPolarHBondContact O-CB 3.47Å; E13-L16 PolarHBondContact O-N 3.23Å; E13-D17 PolarHBondContact O-N 3.48Å
14	D	89.2	Confident	83.4	Confident	102 Å²	102	98.1 Å²	98.1	55%	0.545	53%	0.528	S	S	.	.	H	α-helix	trans	-59.7	-39.3	175.7	-69	-18.1	0	0	0	111.9	L10 L16 Q18	L10-D14 PolarHBondContact O-N 3.07Å; D14-L16 VanDerWaalsContact C-N 3.31Å; D14-L16 PolarHBondContact O-N 3Å; D14-Q18 WeakPolarHBondContact O-CB 3.35Å; D14-Q18 PolarHBondContact O-N 3.11Å
15	S	90.4	Very high	85.2	Confident	73 Å²	73	97.3 Å²	97.3	51%	0.51	52%	0.517	S	S	.	.	H	α-helix	trans	-66.3	-33.4	175.8	-64.3	0	0	0	0	112.6	D11 A12 E13 A19	D11-S15 VanDerWaalsContact O-CB 3.27Å; D11-S15 WeakPolarHBondContact O-CB 3.25Å; D11-S15 PolarHBondContact O-N 3.1Å; D11-S15 VanDerWaalsContact O-N 3.11Å; D11-S15 PolarHBondContact O-OG 3.11Å; A12-S15 PolarHBondContact O-N 2.89Å; E13-S15 VanDerWaalsContact C-N 3.28Å; E13-S15 PolarHBondContact O-N 3.19Å; S15-A19 WeakPolarHBondContact O-CB 3.33Å; S15-A19 PolarHBondContact O-N 3.12Å
16	L	94.4	Very high	87.2	Confident	110 Å²	110	92.4 Å²	92.4	58%	0.576	50%	0.501	S	S	*	.	H	α-helix	trans	-73.4	-45	177.6	-77.4	169	0	0	0	111.1	A12 E13 D14 Q18 A19 I20	A12-L16 WeakPolarHBondContact O-CB 3.49Å; A12-L16 VanDerWaalsContact O-CG 3.25Å; A12-L16 WeakPolarHBondContact O-CG 3.48Å; A12-L16 PolarHBondContact O-N 3.48Å; E13-L16 WeakPolarHBondContact O-CB 3.47Å; E13-L16 PolarHBondContact O-N 3.23Å; D14-L16 VanDerWaalsContact C-N 3.31Å; D14-L16 PolarHBondContact O-N 3Å; L16-Q18 VanDerWaalsContact C-N 3.34Å; L16-Q18 PolarHBondContact O-N 3.48Å; L16-A19 WeakPolarHBondContact O-CB 3.47Å; L16-A19 PolarHBondContact O-N 3.06Å; L16-A19 VanDerWaalsContact O-N 3.11Å; L16-I20 WeakPolarHBondContact O-CG1 3.43Å; L16-I20 PolarHBondContact O-N 3.33Å
17	D	94.1	Very high	89.2	Confident	93 Å²	93	93.3 Å²	93.3	50%	0.497	51%	0.505	S	S	.	.	H	α-helix	trans	-60.2	-45.8	176.1	-72.1	-17.3	0	0	0	110.4	E13 A19 I20 D21	E13-D17 PolarHBondContact O-N 3.48Å; D17-A19 VanDerWaalsContact C-N 3.29Å; D17-A19 PolarHBondContact O-N 3.22Å; D17-I20 WeakPolarHBondContact O-CB 3.49Å; D17-I20 PolarHBondContact O-N 2.94Å; D17-I20 VanDerWaalsContact O-N 3.12Å; D17-D21 PolarHBondContact O-N 3.1Å
18	Q	94.6	Very high	90.9	Very high	126 Å²	126	94.1 Å²	94.1	59%	0.589	50%	0.502	S	S	*	.	H	α-helix	trans	-60.4	-37.6	173.9	-173.5	176.3	21.7	0	0	112.6	D14 L16 N22	D14-Q18 WeakPolarHBondContact O-CB 3.35Å; D14-Q18 PolarHBondContact O-N 3.11Å; L16-Q18 VanDerWaalsContact C-N 3.34Å; L16-Q18 PolarHBondContact O-N 3.48Å; Q18-N22 WeakPolarHBondContact O-CB 3.27Å; Q18-N22 PolarHBondContact O-N 3Å; Q18-N22 VanDerWaalsContact O-N 3.1Å; Q18-N22 PolarHBondContact O-ND2 2.67Å
19	A	95.7	Very high	92.2	Very high	41 Å²	41	91.6 Å²	91.6	34%	0.339	50%	0.496	S	S	.	.	H	α-helix	trans	-68.2	-37	176.6	0	0	0	0	0	112	S15 L16 D17 I23	S15-A19 WeakPolarHBondContact O-CB 3.33Å; S15-A19 PolarHBondContact O-N 3.12Å; L16-A19 WeakPolarHBondContact O-CB 3.47Å; L16-A19 PolarHBondContact O-N 3.06Å; L16-A19 VanDerWaalsContact O-N 3.11Å; D17-A19 VanDerWaalsContact C-N 3.29Å; D17-A19 PolarHBondContact O-N 3.22Å; A19-I23 WeakPolarHBondContact O-CD1 3.19Å; A19-I23 WeakPolarHBondContact O-CG1 3.38Å; A19-I23 PolarHBondContact O-N 3.3Å
20	I	96.6	Very high	93.5	Very high	82 Å²	82	89.6 Å²	89.6	42%	0.421	49%	0.492	S	S	.	.	H	α-helix	trans	-64	-51.5	175.7	-69.9	164.6	0	0	0	109.8	L16 D17 N22 I23 E24	L16-I20 WeakPolarHBondContact O-CG1 3.43Å; L16-I20 PolarHBondContact O-N 3.33Å; D17-I20 WeakPolarHBondContact O-CB 3.49Å; D17-I20 PolarHBondContact O-N 2.94Å; D17-I20 VanDerWaalsContact O-N 3.12Å; I20-N22 VanDerWaalsContact C-N 3.3Å; I20-N22 PolarHBondContact O-N 2.88Å; I20-I23 WeakPolarHBondContact O-CA 3.48Å; I20-I23 WeakPolarHBondContact O-CB 3.23Å; I20-I23 PolarHBondContact O-N 2.99Å; I20-E24 HydrophobicContact CG2-CG 4.36Å; I20-E24 WeakPolarHBondContact O-CG 3.46Å; I20-E24 PolarHBondContact O-N 3.32Å
21	D	95.4	Very high	94.7	Very high	93 Å²	93	90.5 Å²	90.5	50%	0.497	50%	0.497	S	S	.	.	H	α-helix	trans	-55.8	-46.1	178.6	-68.6	-14.8	0	0	0	111.1	D17 I23 E24 D25	D17-D21 PolarHBondContact O-N 3.1Å; D21-I23 VanDerWaalsContact C-N 3.3Å; D21-I23 PolarHBondContact O-N 2.95Å; D21-E24 PolarHBondContact O-N 3.31Å; D21-D25 PolarHBondContact O-N 2.89Å
22	N	96.3	Very high	95.2	Very high	94 Å²	94	93 Å²	93	50%	0.503	50%	0.5	S	S	.	.	H	α-helix	trans	-61.6	-35.9	176.9	-73.7	-39.8	0	0	0	113	Q18 I20 S26	Q18-N22 WeakPolarHBondContact O-CB 3.27Å; Q18-N22 PolarHBondContact O-N 3Å; Q18-N22 VanDerWaalsContact O-N 3.1Å; Q18-N22 PolarHBondContact O-ND2 2.67Å; I20-N22 VanDerWaalsContact C-N 3.3Å; I20-N22 PolarHBondContact O-N 2.88Å; N22-S26 VanDerWaalsContact O-CB 3.25Å; N22-S26 WeakPolarHBondContact O-CB 3.36Å; N22-S26 PolarHBondContact O-N 2.99Å; N22-S26 VanDerWaalsContact O-N 3.09Å
23	I	97.7	Very high	95.8	Very high	99 Å²	99	95.2 Å²	95.2	51%	0.508	50%	0.501	S	S	.	.	H	α-helix	trans	-71.4	-41.6	177.2	-72.1	164.7	0	0	0	110.3	A19 I20 D21 S26 N27	A19-I23 WeakPolarHBondContact O-CD1 3.19Å; A19-I23 WeakPolarHBondContact O-CG1 3.38Å; A19-I23 PolarHBondContact O-N 3.3Å; I20-I23 WeakPolarHBondContact O-CA 3.48Å; I20-I23 WeakPolarHBondContact O-CB 3.23Å; I20-I23 PolarHBondContact O-N 2.99Å; D21-I23 VanDerWaalsContact C-N 3.3Å; D21-I23 PolarHBondContact O-N 2.95Å; I23-S26 PolarHBondContact O-N 2.93Å; I23-N27 VanDerWaalsContact O-CB 3.31Å; I23-N27 WeakPolarHBondContact O-CB 3.31Å; I23-N27 PolarHBondContact O-N 3.19Å; I23-N27 PolarHBondContact O-ND2 3.06Å
24	E	97.5	Very high	96.3	Very high	118 Å²	118	94.3 Å²	94.3	55%	0.551	50%	0.499	S	S	*	.	H	α-helix	trans	-62.1	-50.4	177.4	-70.9	-173.1	168	0	0	111.1	I20 D21 S26 N27 E28	I20-E24 HydrophobicContact CG2-CG 4.36Å; I20-E24 WeakPolarHBondContact O-CG 3.46Å; I20-E24 PolarHBondContact O-N 3.32Å; D21-E24 PolarHBondContact O-N 3.31Å; E24-S26 VanDerWaalsContact C-N 3.32Å; E24-S26 PolarHBondContact O-N 3.48Å; E24-N27 PolarHBondContact O-N 2.89Å; E24-E28 PolarHBondContact O-N 3.09Å
25	D	96.9	Very high	96.7	Very high	107 Å²	107	92.8 Å²	92.8	57%	0.572	49%	0.49	S	S	*	.	H	α-helix	trans	-57.9	-44.1	176.1	-77.5	-10.4	0	0	0	111.7	D21 E28 A29	D21-D25 PolarHBondContact O-N 2.89Å; D25-E28 PolarHBondContact O-N 3.03Å; D25-A29 WeakPolarHBondContact O-CB 3.39Å; D25-A29 PolarHBondContact O-N 2.93Å
26	S	97.9	Very high	97.1	Very high	59 Å²	59	93.2 Å²	93.2	41%	0.413	48%	0.484	S	S	.	.	H	α-helix	trans	-66.6	-39.7	179	-175.2	0	0	0	0	112	N22 I23 E24 A29 N30	N22-S26 VanDerWaalsContact O-CB 3.25Å; N22-S26 WeakPolarHBondContact O-CB 3.36Å; N22-S26 PolarHBondContact O-N 2.99Å; N22-S26 VanDerWaalsContact O-N 3.09Å; I23-S26 PolarHBondContact O-N 2.93Å; E24-S26 VanDerWaalsContact C-N 3.32Å; E24-S26 PolarHBondContact O-N 3.48Å; S26-A29 PolarHBondContact O-N 3.39Å; S26-N30 WeakPolarHBondContact O-CB 3.42Å; S26-N30 PolarHBondContact O-N 2.92Å; S26-N30 PolarHBondContact O-ND2 3.49Å; S26-N30 VanDerWaalsContact O-ND2 3.1Å
27	N	98.2	Very high	97.3	Very high	96 Å²	96	92 Å²	92	51%	0.513	48%	0.478	S	S	.	.	H	α-helix	trans	-67.3	-41.2	177.9	-76.4	-21.4	0	0	0	111.7	I23 E24 N30 L31	I23-N27 VanDerWaalsContact O-CB 3.31Å; I23-N27 WeakPolarHBondContact O-CB 3.31Å; I23-N27 PolarHBondContact O-N 3.19Å; I23-N27 PolarHBondContact O-ND2 3.06Å; E24-N27 PolarHBondContact O-N 2.89Å; N27-N30 PolarHBondContact O-N 3.37Å; N27-L31 WeakPolarHBondContact O-CB 3.48Å; N27-L31 PolarHBondContact O-N 3.42Å
28	E	98.1	Very high	97.5	Very high	100 Å²	100	93 Å²	93	47%	0.467	48%	0.48	S	S	.	.	H	α-helix	trans	-62	-47	174.9	-179.6	171.2	-163.3	0	0	111	E24 D25 N30 L31 Y32	E24-E28 PolarHBondContact O-N 3.09Å; D25-E28 PolarHBondContact O-N 3.03Å; E28-N30 VanDerWaalsContact C-N 3.34Å; E28-N30 PolarHBondContact O-N 3.19Å; E28-L31 PolarHBondContact O-N 3.41Å; E28-Y32 HydrophobicContact CG-CD2 3.83Å; E28-Y32 HydrophobicContact CG-CE2 3.33Å; E28-Y32 WeakPolarHBondContact O-CD2 3.25Å; E28-Y32 PolarHBondContact O-N 3Å; E28-Y32 VanDerWaalsContact OE1-CE2 3.23Å; E28-Y32 WeakPolarHBondContact OE1-CE2 3.22Å; E28-Y32 PolarHBondContact OE1-OH 3.1Å
29	A	97.8	Very high	97.6	Very high	57 Å²	57	93.3 Å²	93.3	47%	0.471	48%	0.481	S	S	.	.	H	α-helix	trans	-60.7	-42.2	176.5	0	0	0	0	0	112.6	D25 S26 L31 Y32 K33	D25-A29 WeakPolarHBondContact O-CB 3.39Å; D25-A29 PolarHBondContact O-N 2.93Å; S26-A29 PolarHBondContact O-N 3.39Å; A29-L31 VanDerWaalsContact C-N 3.34Å; A29-Y32 PolarHBondContact O-N 3.43Å; A29-K33 PolarHBondContact O-N 3.45Å
30	N	98.4	Very high	97.7	Very high	98 Å²	98	95 Å²	95	52%	0.524	48%	0.482	S	S	.	.	H	α-helix	trans	-64.8	-37.8	176.7	-73.9	-27.6	0	0	0	111.9	S26 N27 E28 K33 L34	S26-N30 WeakPolarHBondContact O-CB 3.42Å; S26-N30 PolarHBondContact O-N 2.92Å; S26-N30 PolarHBondContact O-ND2 3.49Å; S26-N30 VanDerWaalsContact O-ND2 3.1Å; N27-N30 PolarHBondContact O-N 3.37Å; E28-N30 VanDerWaalsContact C-N 3.34Å; E28-N30 PolarHBondContact O-N 3.19Å; N30-K33 PolarHBondContact O-N 3.04Å; N30-L34 PolarHBondContact O-N 3.35Å
31	L	98.4	Very high	97.8	Very high	101 Å²	101	95.1 Å²	95.1	53%	0.529	48%	0.483	S	S	.	.	H	α-helix	trans	-65.3	-46.7	177.1	-178.5	62.8	0	0	0	111.5	N27 E28 A29 K33 L34 I35	N27-L31 WeakPolarHBondContact O-CB 3.48Å; N27-L31 PolarHBondContact O-N 3.42Å; E28-L31 PolarHBondContact O-N 3.41Å; A29-L31 VanDerWaalsContact C-N 3.34Å; L31-K33 VanDerWaalsContact C-N 3.26Å; L31-K33 PolarHBondContact O-N 3.22Å; L31-L34 WeakPolarHBondContact O-CB 3.39Å; L31-L34 PolarHBondContact O-N 2.98Å; L31-I35 HydrophobicContact CG-CD1 4.26Å; L31-I35 WeakPolarHBondContact O-CG1 3.45Å; L31-I35 PolarHBondContact O-N 3.03Å
32	Y	98.1	Very high	97.9	Very high	145 Å²	145	95.1 Å²	95.1	57%	0.569	49%	0.487	S	S	*	.	H	α-helix	trans	-60.5	-39	174.7	-73	-58.4	0	0	0	111.9	E28 A29 L34 I35 E36	E28-Y32 HydrophobicContact CG-CD2 3.83Å; E28-Y32 HydrophobicContact CG-CE2 3.33Å; E28-Y32 WeakPolarHBondContact O-CD2 3.25Å; E28-Y32 PolarHBondContact O-N 3Å; E28-Y32 VanDerWaalsContact OE1-CE2 3.23Å; E28-Y32 WeakPolarHBondContact OE1-CE2 3.22Å; E28-Y32 PolarHBondContact OE1-OH 3.1Å; A29-Y32 PolarHBondContact O-N 3.43Å; Y32-L34 VanDerWaalsContact C-N 3.33Å; Y32-L34 PolarHBondContact O-N 3.37Å; Y32-I35 PolarHBondContact O-N 3.48Å; Y32-E36 PolarHBondContact O-N 3.35Å
33	K	98.3	Very high	97.9	Very high	96 Å²	96	93.6 Å²	93.6	42%	0.417	49%	0.487	S	S	.	.	H	α-helix	trans	-65.2	-38.7	177.3	-174	58.6	-174.6	174.1	0	112.2	A29 N30 L31 E36 L37	A29-K33 PolarHBondContact O-N 3.45Å; N30-K33 PolarHBondContact O-N 3.04Å; L31-K33 VanDerWaalsContact C-N 3.26Å; L31-K33 PolarHBondContact O-N 3.22Å; K33-E36 WeakPolarHBondContact CD-OE2 3.33Å; K33-E36 IonicContact NZ-OE1 3.72Å; K33-E36 IonicContact NZ-OE2 2.71Å; K33-E36 PolarHBondContact NZ-OE2 3.46Å; K33-E36 PolarHBondContact O-N 3.03Å; K33-L37 HydrophobicContact CG-CD1 4.35Å; K33-L37 WeakPolarHBondContact O-CG 3.4Å; K33-L37 PolarHBondContact O-N 3.42Å; K33-L37 VanDerWaalsContact O-N 3.1Å
34	L	98.4	Very high	98	Very high	90 Å²	90	97.1 Å²	97.1	47%	0.471	49%	0.494	S	S	.	.	H	α-helix	trans	-63.1	-45.9	176.1	-178	63.8	0	0	0	111.2	N30 L31 Y32 E36 L37 E38	N30-L34 PolarHBondContact O-N 3.35Å; L31-L34 WeakPolarHBondContact O-CB 3.39Å; L31-L34 PolarHBondContact O-N 2.98Å; Y32-L34 VanDerWaalsContact C-N 3.33Å; Y32-L34 PolarHBondContact O-N 3.37Å; L34-E36 VanDerWaalsContact C-N 3.34Å; L34-E36 PolarHBondContact O-N 3.48Å; L34-L37 PolarHBondContact O-N 3.22Å; L34-L37 VanDerWaalsContact O-N 3.17Å; L34-E38 WeakPolarHBondContact O-CG 3.38Å; L34-E38 PolarHBondContact O-N 2.87Å
35	I	98.3	Very high	98	Very high	70 Å²	70	97 Å²	97	36%	0.359	49%	0.493	S	S	.	.	H	α-helix	trans	-58.2	-46.7	176.9	-66.9	165.8	0	0	0	110.7	L31 Y32 L37 E38 E39	L31-I35 HydrophobicContact CG-CD1 4.26Å; L31-I35 WeakPolarHBondContact O-CG1 3.45Å; L31-I35 PolarHBondContact O-N 3.03Å; Y32-I35 PolarHBondContact O-N 3.48Å; I35-L37 VanDerWaalsContact C-N 3.3Å; I35-L37 PolarHBondContact O-N 3.19Å; I35-E38 PolarHBondContact O-N 2.95Å; I35-E39 WeakPolarHBondContact O-CG 3.45Å; I35-E39 PolarHBondContact O-N 3.37Å
36	E	98.3	Very high	98	Very high	82 Å²	82	98.5 Å²	98.5	38%	0.383	50%	0.495	S	S	.	.	H	α-helix	trans	-58.4	-41.7	177.3	-168.8	-160.8	168.2	0	0	112	Y32 K33 L34 Q40	Y32-E36 PolarHBondContact O-N 3.35Å; K33-E36 WeakPolarHBondContact CD-OE2 3.33Å; K33-E36 IonicContact NZ-OE1 3.72Å; K33-E36 IonicContact NZ-OE2 2.71Å; K33-E36 PolarHBondContact NZ-OE2 3.46Å; K33-E36 PolarHBondContact O-N 3.03Å; L34-E36 VanDerWaalsContact C-N 3.34Å; L34-E36 PolarHBondContact O-N 3.48Å; E36-Q40 VanDerWaalsContact O-CG 3.28Å; E36-Q40 WeakPolarHBondContact O-CG 3.41Å; E36-Q40 PolarHBondContact O-N 3.02Å; E36-Q40 PolarHBondContact OE1-NE2 2.99Å; E36-Q40 VanDerWaalsContact OE1-NE2 3.17Å
37	L	98.4	Very high	98	Very high	85 Å²	85	99.6 Å²	99.6	45%	0.445	49%	0.493	S	S	.	.	H	α-helix	trans	-68.8	-38.1	178.4	-72.1	171.5	0	0	0	112.3	K33 L34 I35 Q40 N41	K33-L37 HydrophobicContact CG-CD1 4.35Å; K33-L37 WeakPolarHBondContact O-CG 3.4Å; K33-L37 PolarHBondContact O-N 3.42Å; K33-L37 VanDerWaalsContact O-N 3.1Å; L34-L37 PolarHBondContact O-N 3.22Å; L34-L37 VanDerWaalsContact O-N 3.17Å; I35-L37 VanDerWaalsContact C-N 3.3Å; I35-L37 PolarHBondContact O-N 3.19Å; L37-Q40 PolarHBondContact O-N 3.48Å; L37-N41 WeakPolarHBondContact O-CB 3.33Å; L37-N41 PolarHBondContact O-N 2.93Å
38	E	98.2	Very high	98	Very high	114 Å²	114	99.7 Å²	99.7	53%	0.533	49%	0.493	S	S	.	.	H	α-helix	trans	-64.6	-43.8	175.3	-73.6	-179.5	171.7	0	0	111.4	L34 I35 Q40 N41 V42	L34-E38 WeakPolarHBondContact O-CG 3.38Å; L34-E38 PolarHBondContact O-N 2.87Å; I35-E38 PolarHBondContact O-N 2.95Å; E38-Q40 PolarHBondContact O-N 3.43Å; E38-N41 PolarHBondContact O-N 3.17Å; E38-V42 WeakPolarHBondContact O-CG2 3.28Å; E38-V42 PolarHBondContact O-N 3.17Å
39	E	97.8	Very high	98.1	Very high	132 Å²	132	97 Å²	97	62%	0.617	49%	0.488	S	S	*	.	H	α-helix	trans	-61.1	-43.9	174.8	-72	-177.5	167	0	0	112	I35 V42 A43	I35-E39 WeakPolarHBondContact O-CG 3.45Å; I35-E39 PolarHBondContact O-N 3.37Å; E39-V42 PolarHBondContact O-N 2.94Å; E39-A43 PolarHBondContact O-N 3.1Å
40	Q	97.9	Very high	98.1	Very high	78 Å²	78	98.4 Å²	98.4	36%	0.364	49%	0.485	S	S	.	.	H	α-helix	trans	-61.2	-44.3	174.2	-73.9	174.9	12	0	0	111.3	E36 L37 E38 V42 A43 W44	E36-Q40 VanDerWaalsContact O-CG 3.28Å; E36-Q40 WeakPolarHBondContact O-CG 3.41Å; E36-Q40 PolarHBondContact O-N 3.02Å; E36-Q40 PolarHBondContact OE1-NE2 2.99Å; E36-Q40 VanDerWaalsContact OE1-NE2 3.17Å; L37-Q40 PolarHBondContact O-N 3.48Å; E38-Q40 PolarHBondContact O-N 3.43Å; Q40-V42 PolarHBondContact O-N 3.05Å; Q40-A43 WeakPolarHBondContact O-CB 3.4Å; Q40-A43 PolarHBondContact O-N 3.39Å; Q40-W44 PolarHBondContact O-N 2.9Å
41	N	97.9	Very high	98.1	Very high	83 Å²	83	97 Å²	97	44%	0.444	48%	0.477	S	S	.	.	H	α-helix	trans	-60.1	-45	178.8	-173.2	60.1	0	0	0	111.8	L37 E38 A43 W44 E45	L37-N41 WeakPolarHBondContact O-CB 3.33Å; L37-N41 PolarHBondContact O-N 2.93Å; E38-N41 PolarHBondContact O-N 3.17Å; N41-A43 VanDerWaalsContact C-N 3.3Å; N41-A43 PolarHBondContact O-N 3.06Å; N41-W44 PolarHBondContact O-N 2.71Å; N41-W44 VanDerWaalsContact O-N 3.17Å; N41-E45 PolarHBondContact ND2-OE1 3.25Å; N41-E45 WeakPolarHBondContact O-CG 3.45Å; N41-E45 PolarHBondContact O-N 3.44Å
42	V	97.4	Very high	98.1	Very high	94 Å²	94	97.4 Å²	97.4	57%	0.57	48%	0.476	S	S	*	.	H	α-helix	trans	-60.3	-40.9	175.4	172.2	0	0	0	0	111.5	E38 E39 Q40 E45 K46	E38-V42 WeakPolarHBondContact O-CG2 3.28Å; E38-V42 PolarHBondContact O-N 3.17Å; E39-V42 PolarHBondContact O-N 2.94Å; Q40-V42 PolarHBondContact O-N 3.05Å; V42-E45 PolarHBondContact O-N 3.17Å; V42-K46 PolarHBondContact O-N 3.43Å; V42-K46 VanDerWaalsContact O-N 3.07Å
43	A	97.2	Very high	98.1	Very high	61 Å²	61	94.7 Å²	94.7	50%	0.504	47%	0.471	S	S	.	.	H	α-helix	trans	-63.6	-41.5	175.8	0	0	0	0	0	112.2	E39 Q40 N41 K46 H47	E39-A43 PolarHBondContact O-N 3.1Å; Q40-A43 WeakPolarHBondContact O-CB 3.4Å; Q40-A43 PolarHBondContact O-N 3.39Å; N41-A43 VanDerWaalsContact C-N 3.3Å; N41-A43 PolarHBondContact O-N 3.06Å; A43-K46 PolarHBondContact O-N 3.07Å; A43-H47 PolarHBondContact O-N 3.17Å
44	W	98.1	Very high	98.1	Very high	174 Å²	174	94.6 Å²	94.6	66%	0.659	47%	0.473	S	S	*	.	H	α-helix	trans	-64.5	-42.7	175.9	-76.4	116.9	0	0	0	112.6	Q40 N41 K46 H47 L48	Q40-W44 PolarHBondContact O-N 2.9Å; N41-W44 PolarHBondContact O-N 2.71Å; N41-W44 VanDerWaalsContact O-N 3.17Å; W44-K46 VanDerWaalsContact C-N 3.33Å; W44-K46 PolarHBondContact O-N 3.47Å; W44-H47 PolarHBondContact O-N 3.02Å; W44-L48 WeakPolarHBondContact O-CB 3.41Å; W44-L48 PolarHBondContact O-N 3.22Å
45	E	98.1	Very high	98.1	Very high	114 Å²	114	95 Å²	95	53%	0.533	48%	0.475	S	S	.	.	H	α-helix	trans	-60.8	-43.3	176.5	-74.4	176.1	-177.9	0	0	111.5	N41 V42 L48 A49	N41-E45 PolarHBondContact ND2-OE1 3.25Å; N41-E45 WeakPolarHBondContact O-CG 3.45Å; N41-E45 PolarHBondContact O-N 3.44Å; V42-E45 PolarHBondContact O-N 3.17Å; E45-L48 PolarHBondContact O-N 3.39Å; E45-A49 PolarHBondContact O-N 2.99Å
46	K	98.1	Very high	98.1	Very high	139 Å²	139	98.8 Å²	98.8	60%	0.604	48%	0.484	S	S	*	.	H	α-helix	trans	-61.5	-46.7	174.3	-177.5	-179.4	174.4	-174.2	0	111.7	V42 A43 W44 L48 A49 E50	V42-K46 PolarHBondContact O-N 3.43Å; V42-K46 VanDerWaalsContact O-N 3.07Å; A43-K46 PolarHBondContact O-N 3.07Å; W44-K46 VanDerWaalsContact C-N 3.33Å; W44-K46 PolarHBondContact O-N 3.47Å; K46-L48 VanDerWaalsContact C-N 3.32Å; K46-L48 PolarHBondContact O-N 2.91Å; K46-A49 WeakPolarHBondContact O-CB 3.43Å; K46-A49 PolarHBondContact O-N 3.11Å; K46-E50 VanDerWaalsContact CE-OE1 3.31Å; K46-E50 WeakPolarHBondContact CE-OE1 3.41Å; K46-E50 WeakPolarHBondContact O-CG 3.31Å; K46-E50 PolarHBondContact O-N 3.28Å
47	H	97.9	Very high	98.1	Very high	82 Å²	82	99.7 Å²	99.7	38%	0.38	49%	0.488	S	S	.	.	H	α-helix	trans	-62.2	-40.5	179.2	-172	57.7	0	0	0	111.9	A43 W44 A49 E50 L51	A43-H47 PolarHBondContact O-N 3.17Å; W44-H47 PolarHBondContact O-N 3.02Å; H47-A49 VanDerWaalsContact C-N 3.34Å; H47-A49 PolarHBondContact O-N 3.34Å; H47-E50 IonicContact ND1-OE2 4Å; H47-E50 PolarHBondContact O-N 3.07Å; H47-L51 WeakPolarHBondContact O-CG 3.49Å; H47-L51 PolarHBondContact O-N 3.43Å
48	L	98.2	Very high	98.1	Very high	98 Å²	98	99.5 Å²	99.5	51%	0.513	49%	0.491	S	S	.	.	H	α-helix	trans	-61.1	-42.3	175.5	-177.8	62.9	0	0	0	111.6	W44 E45 K46 L51 Q52	W44-L48 WeakPolarHBondContact O-CB 3.41Å; W44-L48 PolarHBondContact O-N 3.22Å; E45-L48 PolarHBondContact O-N 3.39Å; K46-L48 VanDerWaalsContact C-N 3.32Å; K46-L48 PolarHBondContact O-N 2.91Å; L48-L51 PolarHBondContact O-N 2.87Å; L48-Q52 VanDerWaalsContact O-CG 3.32Å; L48-Q52 WeakPolarHBondContact O-CG 3.32Å; L48-Q52 PolarHBondContact O-N 3.44Å
49	A	98.1	Very high	98.1	Very high	44 Å²	44	98.8 Å²	98.8	36%	0.364	49%	0.489	S	S	.	.	H	α-helix	trans	-63	-40.9	176.5	0	0	0	0	0	112.4	E45 K46 H47 Q52 I53	E45-A49 PolarHBondContact O-N 2.99Å; K46-A49 WeakPolarHBondContact O-CB 3.43Å; K46-A49 PolarHBondContact O-N 3.11Å; H47-A49 VanDerWaalsContact C-N 3.34Å; H47-A49 PolarHBondContact O-N 3.34Å; A49-Q52 PolarHBondContact O-N 3.36Å; A49-I53 WeakPolarHBondContact O-CG1 3.42Å; A49-I53 PolarHBondContact O-N 2.99Å; A49-I53 VanDerWaalsContact O-N 3.11Å
50	E	98	Very high	98.2	Very high	87 Å²	87	96.7 Å²	96.7	41%	0.407	48%	0.479	S	S	.	.	H	α-helix	trans	-62.6	-44.7	175.1	-70.2	172.1	179.9	0	0	111.8	K46 H47 Q52 I53 M54	K46-E50 VanDerWaalsContact CE-OE1 3.31Å; K46-E50 WeakPolarHBondContact CE-OE1 3.41Å; K46-E50 WeakPolarHBondContact O-CG 3.31Å; K46-E50 PolarHBondContact O-N 3.28Å; H47-E50 IonicContact ND1-OE2 4Å; H47-E50 PolarHBondContact O-N 3.07Å; E50-Q52 VanDerWaalsContact C-N 3.34Å; E50-Q52 PolarHBondContact O-N 3.45Å; E50-I53 PolarHBondContact O-N 3.21Å; E50-M54 PolarHBondContact O-N 2.99Å
51	L	98.6	Very high	98.2	Very high	68 Å²	68	99.5 Å²	99.5	36%	0.356	49%	0.49	S	S	.	.	H	α-helix	trans	-59.2	-43.4	175	-71.8	174.7	0	0	0	111.7	H47 L48 I53 M54 I55	H47-L51 WeakPolarHBondContact O-CG 3.49Å; H47-L51 PolarHBondContact O-N 3.43Å; L48-L51 PolarHBondContact O-N 2.87Å; L51-I53 VanDerWaalsContact C-N 3.32Å; L51-I53 PolarHBondContact O-N 2.91Å; L51-M54 HydrophobicContact CD2-CE 3.69Å; L51-M54 HydrophobicContact CG-CE 4.43Å; L51-M54 PolarHBondContact O-N 3.01Å; L51-I55 VanDerWaalsContact O-CG1 3.32Å; L51-I55 WeakPolarHBondContact O-CG1 3.49Å; L51-I55 PolarHBondContact O-N 3.41Å
52	Q	98.6	Very high	98.2	Very high	110 Å²	110	100.7 Å²	100.7	51%	0.514	50%	0.496	S	S	.	.	H	α-helix	trans	-61.2	-39.1	176.9	-73.1	173.6	-3.4	0	0	112.4	L48 A49 E50 R56	L48-Q52 VanDerWaalsContact O-CG 3.32Å; L48-Q52 WeakPolarHBondContact O-CG 3.32Å; L48-Q52 PolarHBondContact O-N 3.44Å; A49-Q52 PolarHBondContact O-N 3.36Å; E50-Q52 VanDerWaalsContact C-N 3.34Å; E50-Q52 PolarHBondContact O-N 3.45Å; Q52-R56 PolarHBondContact O-N 3.47Å
53	I	98.5	Very high	98.2	Very high	87 Å²	87	101 Å²	101	45%	0.446	49%	0.494	S	S	.	.	H	α-helix	trans	-64.3	-46	174.8	-68	166.5	0	0	0	110.6	A49 E50 L51 I55 R56 Q57	A49-I53 WeakPolarHBondContact O-CG1 3.42Å; A49-I53 PolarHBondContact O-N 2.99Å; A49-I53 VanDerWaalsContact O-N 3.11Å; E50-I53 PolarHBondContact O-N 3.21Å; L51-I53 VanDerWaalsContact C-N 3.32Å; L51-I53 PolarHBondContact O-N 2.91Å; I53-I55 PolarHBondContact O-N 3.07Å; I53-R56 WeakPolarHBondContact O-CB 3.4Å; I53-R56 PolarHBondContact O-N 3.23Å; I53-Q57 WeakPolarHBondContact O-CG 3.46Å; I53-Q57 PolarHBondContact O-N 3.24Å
54	M	98.1	Very high	98.3	Very high	94 Å²	94	104.3 Å²	104.3	46%	0.463	49%	0.493	S	S	.	.	H	α-helix	trans	-62.1	-42.9	178.5	-74	-171.5	-73	0	0	112	E50 L51 R56 Q57 V58	E50-M54 PolarHBondContact O-N 2.99Å; L51-M54 HydrophobicContact CD2-CE 3.69Å; L51-M54 HydrophobicContact CG-CE 4.43Å; L51-M54 PolarHBondContact O-N 3.01Å; M54-R56 VanDerWaalsContact C-N 3.31Å; M54-R56 PolarHBondContact O-N 3.44Å; M54-Q57 PolarHBondContact O-N 2.89Å; M54-V58 WeakPolarHBondContact O-CG2 3.33Å; M54-V58 PolarHBondContact O-N 3.43Å
55	I	98.6	Very high	98.3	Very high	99 Å²	99	98.4 Å²	98.4	51%	0.508	48%	0.479	S	S	.	.	H	α-helix	trans	-58.7	-45.3	175.8	-71.2	166.6	0	0	0	110.2	L51 I53 Q57 V58 M59	L51-I55 VanDerWaalsContact O-CG1 3.32Å; L51-I55 WeakPolarHBondContact O-CG1 3.49Å; L51-I55 PolarHBondContact O-N 3.41Å; I53-I55 PolarHBondContact O-N 3.07Å; I55-Q57 PolarHBondContact O-N 3.21Å; I55-V58 PolarHBondContact O-N 2.94Å; I55-M59 HydrophobicContact CG2-CE 3.87Å; I55-M59 HydrophobicContact CG2-CG 4.37Å; I55-M59 HydrophobicContact CG2-SD 4.11Å; I55-M59 WeakPolarHBondContact O-CG 3.32Å; I55-M59 PolarHBondContact O-N 3.39Å
56	R	98.4	Very high	98.3	Very high	150 Å²	150	97.1 Å²	97.1	57%	0.566	48%	0.475	S	S	*	.	H	α-helix	trans	-57.8	-47.3	175.5	-171.9	-177.7	-64.5	146.3	2.1	112.2	Q52 I53 M54 V58 M59 E60	Q52-R56 PolarHBondContact O-N 3.47Å; I53-R56 WeakPolarHBondContact O-CB 3.4Å; I53-R56 PolarHBondContact O-N 3.23Å; M54-R56 VanDerWaalsContact C-N 3.31Å; M54-R56 PolarHBondContact O-N 3.44Å; R56-V58 VanDerWaalsContact C-N 3.31Å; R56-V58 PolarHBondContact O-N 3.28Å; R56-M59 PolarHBondContact O-N 3.42Å; R56-E60 WeakPolarHBondContact O-CG 3.38Å; R56-E60 PolarHBondContact O-N 3.14Å
57	Q	98.4	Very high	98.3	Very high	100 Å²	100	94.9 Å²	94.9	47%	0.467	47%	0.473	S	S	.	.	H	α-helix	trans	-62.5	-37.7	178.6	-69.7	176.5	-7.8	0	0	112.8	I53 M54 I55 K61	I53-Q57 WeakPolarHBondContact O-CG 3.46Å; I53-Q57 PolarHBondContact O-N 3.24Å; M54-Q57 PolarHBondContact O-N 2.89Å; I55-Q57 PolarHBondContact O-N 3.21Å; Q57-K61 WeakPolarHBondContact O-CG 3.35Å; Q57-K61 PolarHBondContact O-N 3.41Å
58	V	98.5	Very high	98.3	Very high	82 Å²	82	98.1 Å²	98.1	50%	0.497	49%	0.486	S	S	.	.	H	α-helix	trans	-66.8	-47.4	175.6	170.8	0	0	0	0	110.3	M54 I55 R56 E60 K61 L62	M54-V58 WeakPolarHBondContact O-CG2 3.33Å; M54-V58 PolarHBondContact O-N 3.43Å; I55-V58 PolarHBondContact O-N 2.94Å; R56-V58 VanDerWaalsContact C-N 3.31Å; R56-V58 PolarHBondContact O-N 3.28Å; V58-E60 PolarHBondContact O-N 2.93Å; V58-K61 PolarHBondContact O-N 3.48Å; V58-K61 VanDerWaalsContact O-N 3.14Å; V58-L62 HydrophobicContact CG1-CD1 3.96Å; V58-L62 HydrophobicContact CG1-CG 4.39Å; V58-L62 WeakPolarHBondContact O-CG 3.4Å; V58-L62 PolarHBondContact O-N 3.07Å
59	M	98.5	Very high	98.2	Very high	99 Å²	99	98.7 Å²	98.7	49%	0.488	49%	0.486	S	S	.	.	H	α-helix	trans	-58.2	-46.8	177.5	-70.3	-173.9	-56	0	0	111.6	I55 R56 K61 L62 D63	I55-M59 HydrophobicContact CG2-CE 3.87Å; I55-M59 HydrophobicContact CG2-CG 4.37Å; I55-M59 HydrophobicContact CG2-SD 4.11Å; I55-M59 WeakPolarHBondContact O-CG 3.32Å; I55-M59 PolarHBondContact O-N 3.39Å; R56-M59 PolarHBondContact O-N 3.42Å; M59-K61 VanDerWaalsContact C-N 3.29Å; M59-K61 PolarHBondContact O-N 3.23Å; M59-L62 WeakPolarHBondContact O-CB 3.36Å; M59-L62 PolarHBondContact O-N 3.18Å; M59-L62 VanDerWaalsContact O-N 3.07Å; M59-D63 PolarHBondContact O-N 3.27Å
60	E	98.3	Very high	98.2	Very high	88 Å²	88	102 Å²	102	41%	0.411	49%	0.494	S	S	.	.	H	α-helix	trans	-60.4	-36	176.8	-74.3	177.6	-160.7	0	0	113.4	R56 V58 R64	R56-E60 WeakPolarHBondContact O-CG 3.38Å; R56-E60 PolarHBondContact O-N 3.14Å; V58-E60 PolarHBondContact O-N 2.93Å; E60-R64 WeakPolarHBondContact O-CG 3.38Å; E60-R64 VanDerWaalsContact O-CZ 3.32Å; E60-R64 PolarHBondContact O-N 3.07Å; E60-R64 PolarHBondContact O-NE 3.21Å; E60-R64 IonicContact OE2-NH1 3.63Å
61	K	98.3	Very high	98.2	Very high	136 Å²	136	100.7 Å²	100.7	59%	0.591	50%	0.498	S	S	*	.	H	α-helix	trans	-69.1	-40.1	175.1	-75.7	174.9	-177.5	175	0	111.2	Q57 V58 M59 S65	Q57-K61 WeakPolarHBondContact O-CG 3.35Å; Q57-K61 PolarHBondContact O-N 3.41Å; V58-K61 PolarHBondContact O-N 3.48Å; V58-K61 VanDerWaalsContact O-N 3.14Å; M59-K61 VanDerWaalsContact C-N 3.29Å; M59-K61 PolarHBondContact O-N 3.23Å; K61-S65 WeakPolarHBondContact O-CB 3.46Å; K61-S65 PolarHBondContact O-N 2.88Å
62	L	98.3	Very high	98.1	Very high	108 Å²	108	102.5 Å²	102.5	57%	0.565	51%	0.508	S	S	*	.	H	α-helix	trans	-64	-46.5	176.9	-72	172	0	0	0	111.1	V58 M59 R64 S65 L66	V58-L62 HydrophobicContact CG1-CD1 3.96Å; V58-L62 HydrophobicContact CG1-CG 4.39Å; V58-L62 WeakPolarHBondContact O-CG 3.4Å; V58-L62 PolarHBondContact O-N 3.07Å; M59-L62 WeakPolarHBondContact O-CB 3.36Å; M59-L62 PolarHBondContact O-N 3.18Å; M59-L62 VanDerWaalsContact O-N 3.07Å; L62-R64 PolarHBondContact O-N 3.27Å; L62-S65 CarbonylContact O-C 3.59Å; L62-S65 WeakPolarHBondContact O-CA 3.43Å; L62-S65 WeakPolarHBondContact O-CB 3.49Å; L62-S65 PolarHBondContact O-N 3.37Å; L62-L66 WeakPolarHBondContact O-CB 3.35Å; L62-L66 PolarHBondContact O-N 3.24Å
63	D	98.3	Very high	98.1	Very high	100 Å²	100	101.5 Å²	101.5	54%	0.535	51%	0.509	S	S	.	.	H	α-helix	trans	-59.1	-46.9	178	-70.6	-18.9	0	0	0	111.7	M59 S65 L66 V67	M59-D63 PolarHBondContact O-N 3.27Å; D63-S65 VanDerWaalsContact C-N 3.28Å; D63-S65 PolarHBondContact O-N 2.97Å; D63-L66 PolarHBondContact O-N 2.94Å; D63-V67 WeakPolarHBondContact O-CG2 3.38Å; D63-V67 PolarHBondContact O-N 3.3Å; D63-V67 VanDerWaalsContact O-N 3.07Å
64	R	97.7	Very high	98	Very high	131 Å²	131	100.3 Å²	100.3	49%	0.494	51%	0.512	S	S	.	.	H	α-helix	trans	-62.7	-36	175.4	-72.7	-172.9	-64.2	-96.4	-1.6	112.6	E60 L62 K68	E60-R64 WeakPolarHBondContact O-CG 3.38Å; E60-R64 VanDerWaalsContact O-CZ 3.32Å; E60-R64 PolarHBondContact O-N 3.07Å; E60-R64 PolarHBondContact O-NE 3.21Å; E60-R64 IonicContact OE2-NH1 3.63Å; L62-R64 PolarHBondContact O-N 3.27Å; R64-K68 WeakPolarHBondContact O-CG 3.41Å; R64-K68 PolarHBondContact O-N 2.82Å
65	S	98.1	Very high	98	Very high	50 Å²	50	102.4 Å²	102.4	35%	0.35	52%	0.519	S	S	.	.	H	α-helix	trans	-67.8	-43.2	177.1	-174.4	0	0	0	0	110.9	K61 L62 D63 K68 Q69	K61-S65 WeakPolarHBondContact O-CB 3.46Å; K61-S65 PolarHBondContact O-N 2.88Å; L62-S65 CarbonylContact O-C 3.59Å; L62-S65 WeakPolarHBondContact O-CA 3.43Å; L62-S65 WeakPolarHBondContact O-CB 3.49Å; L62-S65 PolarHBondContact O-N 3.37Å; D63-S65 VanDerWaalsContact C-N 3.28Å; D63-S65 PolarHBondContact O-N 2.97Å; S65-K68 PolarHBondContact O-N 2.95Å; S65-Q69 WeakPolarHBondContact O-CG 3.37Å; S65-Q69 PolarHBondContact O-N 3.25Å
66	L	98.2	Very high	97.9	Very high	87 Å²	87	103.2 Å²	103.2	46%	0.455	52%	0.522	S	S	.	.	H	α-helix	trans	-60.1	-49.6	178.8	-177.4	61.8	0	0	0	111.1	L62 D63 K68 Q69 E70	L62-L66 WeakPolarHBondContact O-CB 3.35Å; L62-L66 PolarHBondContact O-N 3.24Å; D63-L66 PolarHBondContact O-N 2.94Å; L66-K68 VanDerWaalsContact C-N 3.27Å; L66-K68 PolarHBondContact O-N 3.06Å; L66-Q69 WeakPolarHBondContact O-CB 3.48Å; L66-Q69 PolarHBondContact O-N 3.01Å; L66-E70 HydrophobicContact CD1-CG 4.45Å; L66-E70 WeakPolarHBondContact O-CG 3.36Å; L66-E70 PolarHBondContact O-N 3.2Å
67	V	97.8	Very high	97.8	Very high	93 Å²	93	100.7 Å²	100.7	56%	0.564	52%	0.516	S	S	*	.	H	α-helix	trans	-57.2	-40.5	177	172.8	0	0	0	0	111.9	D63 A71	D63-V67 WeakPolarHBondContact O-CG2 3.38Å; D63-V67 PolarHBondContact O-N 3.3Å; D63-V67 VanDerWaalsContact O-N 3.07Å; V67-A71 WeakPolarHBondContact O-CB 3.49Å; V67-A71 PolarHBondContact O-N 3.02Å
68	K	97.9	Very high	97.7	Very high	150 Å²	150	102.6 Å²	102.6	65%	0.652	52%	0.523	S	S	*	.	H	α-helix	trans	-66.1	-40.8	176.1	-73.4	176.5	-178.1	-177.7	0	111.9	R64 S65 L66 A71 L72	R64-K68 WeakPolarHBondContact O-CG 3.41Å; R64-K68 PolarHBondContact O-N 2.82Å; S65-K68 PolarHBondContact O-N 2.95Å; L66-K68 VanDerWaalsContact C-N 3.27Å; L66-K68 PolarHBondContact O-N 3.06Å; K68-A71 PolarHBondContact O-N 3.45Å; K68-L72 WeakPolarHBondContact O-CG 3.48Å; K68-L72 PolarHBondContact O-N 2.87Å
69	Q	97.5	Very high	97.5	Very high	110 Å²	110	102.7 Å²	102.7	51%	0.514	52%	0.52	S	S	.	.	H	α-helix	trans	-65.5	-43.5	177.9	-72.2	176	6.2	0	0	111.3	S65 L66 A71 L72 V73	S65-Q69 WeakPolarHBondContact O-CG 3.37Å; S65-Q69 PolarHBondContact O-N 3.25Å; L66-Q69 WeakPolarHBondContact O-CB 3.48Å; L66-Q69 PolarHBondContact O-N 3.01Å; Q69-A71 PolarHBondContact O-N 3.04Å; Q69-L72 WeakPolarHBondContact O-CB 3.45Å; Q69-L72 PolarHBondContact O-N 2.9Å; Q69-V73 WeakPolarHBondContact O-CG2 3.34Å; Q69-V73 PolarHBondContact O-N 3.43Å
70	E	97.8	Very high	97.4	Very high	113 Å²	113	103.8 Å²	103.8	53%	0.528	52%	0.522	S	S	.	.	H	α-helix	trans	-59.8	-44.7	175	-70.4	174.9	159.2	0	0	111.6	L66 L72 V73 A74	L66-E70 HydrophobicContact CD1-CG 4.45Å; L66-E70 WeakPolarHBondContact O-CG 3.36Å; L66-E70 PolarHBondContact O-N 3.2Å; E70-L72 VanDerWaalsContact C-N 3.34Å; E70-L72 PolarHBondContact O-N 3.02Å; E70-V73 PolarHBondContact O-N 3.23Å; E70-A74 WeakPolarHBondContact O-CB 3.39Å; E70-A74 PolarHBondContact O-N 3.49Å
71	A	97.5	Very high	97.1	Very high	60 Å²	60	103.3 Å²	103.3	50%	0.496	52%	0.522	S	S	.	.	H	α-helix	trans	-62.4	-39.3	176	0	0	0	0	0	112.6	V67 K68 Q69 K75	V67-A71 WeakPolarHBondContact O-CB 3.49Å; V67-A71 PolarHBondContact O-N 3.02Å; K68-A71 PolarHBondContact O-N 3.45Å; Q69-A71 PolarHBondContact O-N 3.04Å; A71-K75 WeakPolarHBondContact O-CB 3.47Å; A71-K75 PolarHBondContact O-N 3.46Å
72	L	97.6	Very high	96.9	Very high	106 Å²	106	100.8 Å²	100.8	56%	0.555	51%	0.513	S	S	*	.	H	α-helix	trans	-64.8	-45	174.9	-75.8	176.4	0	0	0	111.8	K68 Q69 E70 A74 K75 M76	K68-L72 WeakPolarHBondContact O-CG 3.48Å; K68-L72 PolarHBondContact O-N 2.87Å; Q69-L72 WeakPolarHBondContact O-CB 3.45Å; Q69-L72 PolarHBondContact O-N 2.9Å; E70-L72 VanDerWaalsContact C-N 3.34Å; E70-L72 PolarHBondContact O-N 3.02Å; L72-A74 PolarHBondContact O-N 2.93Å; L72-K75 PolarHBondContact O-N 3.29Å; L72-M76 WeakPolarHBondContact O-CG 3.49Å; L72-M76 PolarHBondContact O-N 3.39Å
73	V	97.6	Very high	96.4	Very high	88 Å²	88	102.8 Å²	102.8	53%	0.533	52%	0.517	S	S	.	.	H	α-helix	trans	-59.8	-46.1	176.3	170.5	0	0	0	0	110.9	Q69 E70 K75 M76 Q77	Q69-V73 WeakPolarHBondContact O-CG2 3.34Å; Q69-V73 PolarHBondContact O-N 3.43Å; E70-V73 PolarHBondContact O-N 3.23Å; V73-K75 VanDerWaalsContact C-N 3.33Å; V73-K75 PolarHBondContact O-N 2.91Å; V73-M76 HydrophobicContact CG2-CE 4.1Å; V73-M76 PolarHBondContact O-N 3.03Å; V73-Q77 PolarHBondContact O-N 3.41Å
74	A	97.3	Very high	96	Very high	63 Å²	63	102.2 Å²	102.2	52%	0.521	51%	0.514	S	S	.	.	H	α-helix	trans	-60	-41.9	176.4	0	0	0	0	0	112.3	E70 L72 Q77 K78	E70-A74 WeakPolarHBondContact O-CB 3.39Å; E70-A74 PolarHBondContact O-N 3.49Å; L72-A74 PolarHBondContact O-N 2.93Å; A74-Q77 PolarHBondContact O-N 2.93Å; A74-K78 PolarHBondContact O-N 3.23Å
75	K	97.2	Very high	95.4	Very high	138 Å²	138	102.7 Å²	102.7	60%	0.6	52%	0.522	S	S	*	.	H	α-helix	trans	-64.5	-42.2	176.4	-171.7	177.8	-179.4	-179	0	112	A71 L72 V73 K78 L79	A71-K75 WeakPolarHBondContact O-CB 3.47Å; A71-K75 PolarHBondContact O-N 3.46Å; L72-K75 PolarHBondContact O-N 3.29Å; V73-K75 VanDerWaalsContact C-N 3.33Å; V73-K75 PolarHBondContact O-N 2.91Å; K75-K78 PolarHBondContact O-N 3.45Å; K75-L79 HydrophobicContact CG-CD1 4.44Å; K75-L79 WeakPolarHBondContact O-CG 3.49Å; K75-L79 PolarHBondContact O-N 3.3Å
76	M	96.9	Very high	94.6	Very high	116 Å²	116	108 Å²	108	57%	0.571	54%	0.541	S	S	*	.	H	α-helix	trans	-63.8	-42.2	176.5	-72.4	-172.5	-64.6	0	0	111.7	L72 V73 K78 L79 K80	L72-M76 WeakPolarHBondContact O-CG 3.49Å; L72-M76 PolarHBondContact O-N 3.39Å; V73-M76 HydrophobicContact CG2-CE 4.1Å; V73-M76 PolarHBondContact O-N 3.03Å; M76-K78 VanDerWaalsContact C-N 3.33Å; M76-K78 PolarHBondContact O-N 3.31Å; M76-L79 PolarHBondContact O-N 2.93Å; M76-K80 WeakPolarHBondContact O-CB 3.41Å; M76-K80 PolarHBondContact O-N 3.34Å
77	Q	96.1	Very high	93.5	Very high	97 Å²	97	107.3 Å²	107.3	45%	0.453	56%	0.555	S	S	.	*	H	α-helix	trans	-61.5	-42.3	176.1	-173.5	60.7	46.1	0	0	111.6	V73 A74 K80 N81	V73-Q77 PolarHBondContact O-N 3.41Å; A74-Q77 PolarHBondContact O-N 2.93Å; Q77-K80 PolarHBondContact O-N 3.47Å; Q77-N81 PolarHBondContact NE2-OD1 3.13Å; Q77-N81 VanDerWaalsContact O-CG 3.3Å; Q77-N81 PolarHBondContact O-N 3.07Å; Q77-N81 PolarHBondContact O-OD1 3.35Å
78	K	95.9	Very high	91.5	Very high	139 Å²	139	113.5 Å²	113.5	60%	0.604	58%	0.578	S	S	*	*	H	α-helix	trans	-60.8	-46.7	176	-174	178.4	-179.7	178.5	0	112	A74 K75 M76 K80 N81 Q82	A74-K78 PolarHBondContact O-N 3.23Å; K75-K78 PolarHBondContact O-N 3.45Å; M76-K78 VanDerWaalsContact C-N 3.33Å; M76-K78 PolarHBondContact O-N 3.31Å; K78-K80 VanDerWaalsContact C-N 3.32Å; K78-K80 PolarHBondContact O-N 3.04Å; K78-N81 PolarHBondContact O-N 3.34Å; K78-Q82 WeakPolarHBondContact O-CG 3.41Å; K78-Q82 PolarHBondContact O-N 3.04Å; K78-Q82 VanDerWaalsContact O-N 3.07Å
79	L	95.6	Very high	91.2	Very high	85 Å²	85	111.7 Å²	111.7	45%	0.445	57%	0.574	S	S	.	*	H	α-helix	trans	-62.8	-38.5	178	-73.5	171.2	0	0	0	112.2	K75 M76 Q82 K83	K75-L79 HydrophobicContact CG-CD1 4.44Å; K75-L79 WeakPolarHBondContact O-CG 3.49Å; K75-L79 PolarHBondContact O-N 3.3Å; M76-L79 PolarHBondContact O-N 2.93Å; L79-Q82 PolarHBondContact O-N 2.87Å; L79-K83 PolarHBondContact O-N 3.49Å; L79-K83 VanDerWaalsContact O-N 3.1Å
80	K	94.6	Very high	90.9	Very high	122 Å²	122	111.8 Å²	111.8	53%	0.53	58%	0.577	S	S	.	*	H	α-helix	trans	-61.2	-50	175	-175	177.6	178.6	-179.3	0	111.2	M76 Q77 K78 Q82 K83 D84	M76-K80 WeakPolarHBondContact O-CB 3.41Å; M76-K80 PolarHBondContact O-N 3.34Å; Q77-K80 PolarHBondContact O-N 3.47Å; K78-K80 VanDerWaalsContact C-N 3.32Å; K78-K80 PolarHBondContact O-N 3.04Å; K80-Q82 VanDerWaalsContact C-N 3.26Å; K80-Q82 PolarHBondContact O-N 3.14Å; K80-K83 PolarHBondContact O-N 2.94Å; K80-K83 VanDerWaalsContact O-N 3.14Å; K80-D84 PolarHBondContact O-N 3.29Å
81	N	93.5	Very high	90.5	Very high	77 Å²	77	111.7 Å²	111.7	41%	0.412	58%	0.58	S	S	.	*	H	α-helix	trans	-60.2	-36	178.8	-66.4	-0.8	0	0	0	112.5	Q77 K78 Q85	Q77-N81 PolarHBondContact NE2-OD1 3.13Å; Q77-N81 VanDerWaalsContact O-CG 3.3Å; Q77-N81 PolarHBondContact O-N 3.07Å; Q77-N81 PolarHBondContact O-OD1 3.35Å; K78-N81 PolarHBondContact O-N 3.34Å; N81-Q85 VanDerWaalsContact O-CG 3.29Å; N81-Q85 WeakPolarHBondContact O-CG 3.29Å; N81-Q85 PolarHBondContact O-N 3.4Å; N81-Q85 VanDerWaalsContact O-N 3.13Å
82	Q	92.6	Very high	90.1	Very high	83 Å²	83	114.8 Å²	114.8	39%	0.388	59%	0.585	S	S	.	*	H	α-helix	trans	-65.7	-44.3	175.6	-73.5	176.8	-36.6	0	0	112	K78 L79 K80 D84 Q85 E86	K78-Q82 WeakPolarHBondContact O-CG 3.41Å; K78-Q82 PolarHBondContact O-N 3.04Å; K78-Q82 VanDerWaalsContact O-N 3.07Å; L79-Q82 PolarHBondContact O-N 2.87Å; K80-Q82 VanDerWaalsContact C-N 3.26Å; K80-Q82 PolarHBondContact O-N 3.14Å; Q82-D84 VanDerWaalsContact C-N 3.35Å; Q82-D84 PolarHBondContact O-N 3.1Å; Q82-Q85 PolarHBondContact O-N 2.97Å; Q82-E86 WeakPolarHBondContact O-CG 3.48Å; Q82-E86 PolarHBondContact O-N 3.21Å
83	K	89.3	Confident	89.6	Confident	151 Å²	151	115.3 Å²	115.3	66%	0.657	59%	0.587	S	S	*	*	H	α-helix	trans	-63.8	-40	175.8	-73.4	-172.3	173.2	-168.6	0	112.7	L79 K80 Q85 E86 G87	L79-K83 PolarHBondContact O-N 3.49Å; L79-K83 VanDerWaalsContact O-N 3.1Å; K80-K83 PolarHBondContact O-N 2.94Å; K80-K83 VanDerWaalsContact O-N 3.14Å; K83-Q85 PolarHBondContact O-N 3.04Å; K83-E86 PolarHBondContact O-N 3.3Å; K83-G87 PolarHBondContact O-N 3.37Å
84	D	88.8	Confident	89.1	Confident	87 Å²	87	117.1 Å²	117.1	47%	0.465	59%	0.59	S	S	.	*	H	α-helix	trans	-65.6	-27.9	177.5	-66.7	-18.6	0	0	0	111.5	K80 Q82	K80-D84 PolarHBondContact O-N 3.29Å; Q82-D84 VanDerWaalsContact C-N 3.35Å; Q82-D84 PolarHBondContact O-N 3.1Å
85	Q	85.9	Confident	88.5	Confident	141 Å²	141	121 Å²	121	66%	0.659	60%	0.595	S	S	*	*	H	α-helix	trans	-80.6	-34.1	173.8	-73.4	174.4	0.3	0	0	113.5	N81 Q82 K83 G87	N81-Q85 VanDerWaalsContact O-CG 3.29Å; N81-Q85 WeakPolarHBondContact O-CG 3.29Å; N81-Q85 PolarHBondContact O-N 3.4Å; N81-Q85 VanDerWaalsContact O-N 3.13Å; Q82-Q85 PolarHBondContact O-N 2.97Å; K83-Q85 PolarHBondContact O-N 3.04Å; Q85-G87 VanDerWaalsContact C-N 3.34Å
86	E	79.9	Confident	87.8	Confident	162 Å²	162	119.7 Å²	119.7	76%	0.757	60%	0.595	S	S	*	*	H	α-helix	trans	-75.1	-23.3	176.4	-73	175.3	178.7	0	0	112.9	Q82 K83 Q88	Q82-E86 WeakPolarHBondContact O-CG 3.48Å; Q82-E86 PolarHBondContact O-N 3.21Å; K83-E86 PolarHBondContact O-N 3.3Å; E86-Q88 VanDerWaalsContact C-N 3.31Å
87	G	77	Confident	87.1	Confident	72 Å²	72	120 Å²	120	74%	0.742	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.9	0.6	175.6	0	0	0	0	0	115	K83 Q85	K83-G87 PolarHBondContact O-N 3.37Å; Q85-G87 VanDerWaalsContact C-N 3.34Å
88	Q	55.5	Low	86.2	Confident	224 Å²	224	122.1 Å²	122.1	100%	1.047	61%	0.61	S	S	*	*			trans	-109.9	0	173.1	-70.5	-178.1	10.7	0	0	110.1	E86	E86-Q88 VanDerWaalsContact C-N 3.31Å

Retrieved 88 of 88 residues in 57 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).