X2JEG0_DROME Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession X2JEG0, Species DROME (Drosophila melanogaster, Fruit fly), Gene Dmel\CG45691, Length 70 aa.

						>X2JEG0_DROME|X2JEG0|Dmel\CG45691
MSCVTKESPPTSNSNGNSNSKNSYNNNSNGKSGSCHTQATTTTTTVRDRNGGEITWRATSGNCGLMNIPQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50	Low	52.6	Low	203 Å²	203	99.9 Å²	99.9	100%	1	57%	0.57	S	S	*	*				0	121.2	0	-125.4	83.4	177	0	0	108
2	S	49.7	Very low	51.4	Low	113 Å²	113	100.6 Å²	100.6	79%	0.79	59%	0.586	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-106.9	140.6	172	-59.6	0	0	0	0	108.8	C63	S2-C63 VanDerWaalsContact C-SG 3.57Å
3	C	56.8	Low	50.2	Low	27 Å²	27	104.3 Å²	104.3	18%	0.182	60%	0.602	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-125.1	156.6	173.8	31	0	0	0	0	109.6	S60 G61 C63	C3-S60 WeakPolarHBondContact O-CA 2.8Å; C3-G61 PolarHBondContact N-O 2.72Å; C3-G61 PolarHBondContact O-N 2.66Å; C3-G61 VanDerWaalsContact O-N 3.17Å; C3-C63 WeakPolarHBondContact CA-SG 3.46Å; C3-C63 HydrophobicContact CB-CB 4.14Å; C3-C63 WeakPolarHBondContact CB-SG 3.29Å; C3-C63 PolarHBondContact N-SG 3.31Å; C3-C63 WeakPolarHBondContact SG-CA 3.36Å; C3-C63 WeakPolarHBondContact SG-CB 3.2Å; C3-C63 PolarHBondContact SG-N 3.24Å; C3-C63 VanDerWaalsContact SG-N 3.36Å; C3-C63 CovalentContact SG-SG 2.03Å; C3-C63 PolarHBondContact SG-SG 2.78Å
4	V	54.2	Low	49.5	Very low	100 Å²	100	105.4 Å²	105.4	61%	0.606	62%	0.619	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-123.3	117.8	173.5	-177.7	0	0	0	0	105.8	A58	V4-A58 HydrophobicContact CG1-CB 4.13Å
5	T	57.5	Low	48.8	Very low	30 Å²	30	109.8 Å²	109.8	18%	0.184	64%	0.639	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-91.3	131.6	168.8	50	0	0	0	0	108.9	E7 T59 M66 I68	T5-E7 PolarHBondContact O-N 2.77Å; T5-T59 PolarHBondContact N-O 3.29Å; T5-M66 HydrophobicContact CG2-SD 3.87Å; T5-I68 HydrophobicContact CG2-CD1 3.51Å; T5-I68 HydrophobicContact CG2-CG1 3.75Å; T5-I68 HydrophobicContact CG2-CG2 4.06Å
6	K	52.5	Low	48.1	Very low	186 Å²	186	106.8 Å²	106.8	81%	0.809	64%	0.638	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-81.5	107.6	166.5	-71.2	-177.2	177.5	179.1	0	106.5
7	E	53.5	Low	47.4	Very low	86 Å²	86	108.4 Å²	108.4	40%	0.402	64%	0.643	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-77.7	133.2	169	-59.6	-167	127.8	0	0	107.8	T5 R57	T5-E7 PolarHBondContact O-N 2.77Å; E7-R57 HydrophobicContact CB-CB 4.36Å; E7-R57 PolarHBondContact N-O 3.17Å
8	S	53.3	Low	47.2	Very low	98 Å²	98	108.4 Å²	108.4	69%	0.685	65%	0.649	S	S	*	*	P	Polyproline II helix	trans	-58.5	143.7	167.4	-65.8	0	0	0	0	108.1
9	P	54	Low	46.7	Very low	49 Å²	49	109.5 Å²	109.5	32%	0.318	65%	0.651	S	S	.	*	P	Polyproline II helix	trans	-49.7	133.2	174.2	19.7	-30.4	0	0	0	108.2	T11 I54	P9-T11 PolarHBondContact O-N 2.82Å; P9-I54 HydrophobicContact CB-CG2 4.19Å; P9-I54 HydrophobicContact CG-CG2 4.37Å
10	P	51.7	Low	46.7	Very low	80 Å²	80	109.1 Å²	109.1	52%	0.519	65%	0.654	S	S	.	*			trans	-53.4	114.3	-175.4	19.6	-30.7	0	0	0	107.9	S12	P10-S12 PolarHBondContact O-N 3.18Å
11	T	45	Very low	46.4	Very low	127 Å²	127	113 Å²	113	78%	0.779	66%	0.663	S	S	*	*			trans	-62	112.9	171	45.1	0	0	0	0	105.2	P9 N13	P9-T11 PolarHBondContact O-N 2.82Å; T11-N13 PolarHBondContact O-N 3.07Å
12	S	38.5	Very low	46.1	Very low	108 Å²	108	109.1 Å²	109.1	76%	0.755	65%	0.646	S	S	*	*	S	Bend	trans	-52	123	175.7	-59.4	0	0	0	0	108.1	P10	P10-S12 PolarHBondContact O-N 3.18Å
13	N	35.7	Very low	45.6	Very low	149 Å²	149	109.3 Å²	109.3	80%	0.797	65%	0.647	S	S	*	*			trans	83.4	89.6	166.3	-48.9	-11.4	0	0	0	116.4	T11	T11-N13 PolarHBondContact O-N 3.07Å
14	S	40.3	Very low	44.9	Very low	120 Å²	120	117 Å²	117	84%	0.839	67%	0.674	S	S	*	*			trans	-137.6	99.3	136	-84.4	0	0	0	0	108.9	G16	S14-G16 PolarHBondContact O-N 2.99Å
15	N	39.6	Very low	44.1	Very low	171 Å²	171	119.3 Å²	119.3	91%	0.914	68%	0.683	S	S	*	*			trans	-70.2	70.4	169.9	-148.8	40.9	0	0	0	107.7	N17	N15-N17 PolarHBondContact O-N 2.89Å
16	G	37.9	Very low	43.3	Very low	61 Å²	61	124.2 Å²	124.2	63%	0.629	71%	0.708	S	S	*	*			trans	-76.7	87.7	176.3	0	0	0	0	0	109.1	S14 S18	S14-G16 PolarHBondContact O-N 2.99Å; G16-S18 PolarHBondContact O-N 2.86Å
17	N	36.2	Very low	42.6	Very low	135 Å²	135	122.4 Å²	122.4	72%	0.722	71%	0.707	S	S	*	*			trans	-64.7	78.8	170.2	-172.7	33.4	0	0	0	109.4	N15 N19	N15-N17 PolarHBondContact O-N 2.89Å; N17-N19 PolarHBondContact O-N 2.77Å
18	S	42.5	Very low	41.9	Very low	108 Å²	108	122.5 Å²	122.5	76%	0.755	72%	0.717	S	S	*	*			trans	-76.1	78	174.2	-69.3	0	0	0	0	109.3	G16 S20	G16-S18 PolarHBondContact O-N 2.86Å; S18-S20 PolarHBondContact O-N 2.83Å
19	N	38.3	Very low	41.1	Very low	129 Å²	129	126 Å²	126	69%	0.69	73%	0.728	S	S	*	*			trans	-77.1	65	175.1	-147.5	15.7	0	0	0	109.4	N17	N17-N19 PolarHBondContact O-N 2.77Å
20	S	46.2	Very low	40.2	Very low	101 Å²	101	126.1 Å²	126.1	71%	0.706	74%	0.738	S	S	*	*			trans	-100.1	85.2	171.3	65.2	0	0	0	0	109.7	S18 N22	S18-S20 PolarHBondContact O-N 2.83Å; S20-N22 VanDerWaalsContact C-N 3.27Å; S20-N22 PolarHBondContact O-N 3.06Å
21	K	40.2	Very low	39.5	Very low	191 Å²	191	132.4 Å²	132.4	83%	0.83	76%	0.757	S	S	*	*			trans	-62.2	87.7	160.1	-75.1	177.8	178.8	174.8	0	108.7
22	N	44.5	Very low	39.5	Very low	123 Å²	123	131.6 Å²	131.6	66%	0.658	76%	0.757	S	S	*	*			trans	-120.3	94.1	162.8	-100.3	11	0	0	0	108.9	S20 Y24	S20-N22 VanDerWaalsContact C-N 3.27Å; S20-N22 PolarHBondContact O-N 3.06Å; N22-Y24 HydrophobicContact CB-CD2 4.13Å; N22-Y24 HydrophobicContact CB-CE2 4.21Å; N22-Y24 PolarHBondContact O-N 3.21Å; N22-Y24 VanDerWaalsContact O-N 3.09Å
23	S	39.2	Very low	39.3	Very low	116 Å²	116	129.4 Å²	129.4	81%	0.811	75%	0.751	S	S	*	*			trans	-62.8	97.9	164.3	-176.2	0	0	0	0	108.5
24	Y	41.9	Very low	39.7	Very low	190 Å²	190	126.3 Å²	126.3	75%	0.745	74%	0.742	S	S	*	*			trans	-111.2	88.7	160.7	-81.7	-79.7	0	0	0	108.1	N22 N26	N22-Y24 HydrophobicContact CB-CD2 4.13Å; N22-Y24 HydrophobicContact CB-CE2 4.21Å; N22-Y24 PolarHBondContact O-N 3.21Å; N22-Y24 VanDerWaalsContact O-N 3.09Å; Y24-N26 VanDerWaalsContact C-N 3.31Å; Y24-N26 PolarHBondContact O-N 3.23Å
25	N	37.3	Very low	39.9	Very low	147 Å²	147	125.4 Å²	125.4	79%	0.786	73%	0.734	S	S	*	*			trans	-61.4	91.3	160.7	179.7	20.6	0	0	0	108.2
26	N	41.9	Very low	40.3	Very low	133 Å²	133	124.4 Å²	124.4	71%	0.711	72%	0.724	S	S	*	*			trans	-106.3	89.2	174.1	-153	-6.6	0	0	0	109.1	Y24 S28	Y24-N26 VanDerWaalsContact C-N 3.31Å; Y24-N26 PolarHBondContact O-N 3.23Å; N26-S28 PolarHBondContact O-N 3.42Å; N26-S28 PolarHBondContact OD1-OG 2.8Å
27	N	37.7	Very low	41	Very low	149 Å²	149	125.5 Å²	125.5	80%	0.797	72%	0.718	S	S	*	*			trans	-69.7	78.2	171.9	-161.4	31.4	0	0	0	108.6
28	S	38.2	Very low	42	Very low	88 Å²	88	127 Å²	127	62%	0.615	72%	0.721	S	S	*	*			trans	-116.7	101.9	174.5	-76	0	0	0	0	108.8	N26 G30	N26-S28 PolarHBondContact O-N 3.42Å; N26-S28 PolarHBondContact OD1-OG 2.8Å; S28-G30 PolarHBondContact O-N 2.89Å
29	N	35.7	Very low	43	Very low	171 Å²	171	124.5 Å²	124.5	91%	0.914	71%	0.707	S	S	*	*			trans	-67.3	39.2	173.4	-126	18.9	0	0	0	112.1
30	G	36.2	Very low	44.4	Very low	51 Å²	51	122 Å²	122	53%	0.526	70%	0.696	S	S	.	*			trans	-77.6	125.2	169.2	0	0	0	0	0	107.2	S28 S32	S28-G30 PolarHBondContact O-N 2.89Å; G30-S32 PolarHBondContact O-N 2.9Å
31	K	36.6	Very low	45.6	Very low	213 Å²	213	120.9 Å²	120.9	93%	0.926	69%	0.685	S	S	*	*			trans	-57.1	76.8	162.2	-71.2	171.8	176.3	172.8	0	108	G33	K31-G33 PolarHBondContact O-N 2.81Å
32	S	44.3	Very low	47.3	Very low	110 Å²	110	115.5 Å²	115.5	77%	0.769	67%	0.669	S	S	*	*			trans	-71.4	85.6	168.5	54	0	0	0	0	104	G30 S34	G30-S32 PolarHBondContact O-N 2.9Å; S32-S34 VanDerWaalsContact C-N 3.29Å; S32-S34 PolarHBondContact O-N 2.78Å
33	G	36	Very low	48.9	Very low	62 Å²	62	114.1 Å²	114.1	64%	0.639	66%	0.664	S	S	*	*			trans	-46.9	110.6	159	0	0	0	0	0	104.5	K31 C35	K31-G33 PolarHBondContact O-N 2.81Å; G33-C35 PolarHBondContact O-N 3.19Å
34	S	42.5	Very low	51	Low	84 Å²	84	112.5 Å²	112.5	59%	0.587	65%	0.65	S	S	*	*			trans	-65.5	85.3	167.5	-178.5	0	0	0	0	103.7	S32 H36	S32-S34 VanDerWaalsContact C-N 3.29Å; S32-S34 PolarHBondContact O-N 2.78Å; S34-H36 PolarHBondContact O-N 3.36Å; S34-H36 PolarHBondContact OG-CE1 3.2Å; S34-H36 VanDerWaalsContact OG-CE1 3.31Å; S34-H36 PolarHBondContact OG-ND1 2.03Å
35	C	44.6	Very low	52.8	Low	101 Å²	101	107.5 Å²	107.5	68%	0.682	64%	0.639	S	S	*	*			trans	-56.1	89.8	148.5	-64.5	0	0	0	0	101.8	G33 T37	G33-C35 PolarHBondContact O-N 3.19Å; C35-T37 HydrophobicContact CB-CG2 4.48Å; C35-T37 PolarHBondContact O-N 2.93Å
36	H	48.7	Very low	54.9	Low	150 Å²	150	103.3 Å²	103.3	69%	0.694	62%	0.619	S	S	*	*			trans	-58.4	87.2	162.2	-85.9	79.1	0	0	0	103	S34 Q38	S34-H36 PolarHBondContact O-N 3.36Å; S34-H36 PolarHBondContact OG-CE1 3.2Å; S34-H36 VanDerWaalsContact OG-CE1 3.31Å; S34-H36 PolarHBondContact OG-ND1 2.03Å; H36-Q38 PolarHBondContact O-N 3.39Å
37	T	53.2	Low	56.9	Low	84 Å²	84	106.8 Å²	106.8	52%	0.515	62%	0.622	S	S	.	*			trans	-66.6	91.7	171.9	33.8	0	0	0	0	103.5	C35 A39 L65	C35-T37 HydrophobicContact CB-CG2 4.48Å; C35-T37 PolarHBondContact O-N 2.93Å; T37-A39 PolarHBondContact O-N 2.85Å; T37-L65 HydrophobicContact CG2-CB 4.16Å; T37-L65 HydrophobicContact CG2-CD1 3.36Å; T37-L65 HydrophobicContact CG2-CG 4.36Å
38	Q	56.9	Low	59	Low	166 Å²	166	102.6 Å²	102.6	78%	0.776	60%	0.599	S	S	*	*			trans	-68.3	84.5	177	-68.4	-176.7	62.5	0	0	106.4	H36 T40	H36-Q38 PolarHBondContact O-N 3.39Å; Q38-T40 PolarHBondContact O-N 3.16Å
39	A	64.1	Low	61.1	Low	56 Å²	56	110.3 Å²	110.3	46%	0.463	62%	0.615	S	S	.	*			trans	-71.7	107.6	161.1	0	0	0	0	0	105.8	T37 T41 T59 S60	T37-A39 PolarHBondContact O-N 2.85Å; A39-T41 PolarHBondContact O-N 3.04Å; A39-T59 HydrophobicContact CB-CG2 3.81Å; A39-S60 CarbonylContact C-O 3.57Å; A39-S60 VanDerWaalsContact CA-O 3.29Å; A39-S60 WeakPolarHBondContact CA-O 3.49Å
40	T	65.7	Low	63.7	Low	76 Å²	76	109.5 Å²	109.5	47%	0.466	61%	0.611	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.2	113.2	175.6	-56.4	0	0	0	0	107.5	Q38 T42 S60	Q38-T40 PolarHBondContact O-N 3.16Å; T40-T42 HydrophobicContact CG2-CG2 4.3Å; T40-S60 PolarHBondContact N-O 2.83Å; T40-S60 PolarHBondContact O-N 2.77Å; T40-S60 PolarHBondContact O-OG 3.02Å; T40-S60 VanDerWaalsContact O-OG 3.13Å
41	T	72.7	Confident	66	Low	77 Å²	77	109.3 Å²	109.3	47%	0.472	61%	0.609	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.2	121.7	172.9	-56.6	0	0	0	0	108.6	A39 A58 T59	A39-T41 PolarHBondContact O-N 3.04Å; T41-A58 WeakPolarHBondContact CA-O 3.27Å; T41-T59 PolarHBondContact OG1-OG1 3.09Å
42	T	74.6	Confident	68.4	Low	79 Å²	79	100.7 Å²	100.7	49%	0.485	58%	0.58	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-107.5	137.3	172.2	56.2	0	0	0	0	109.3	T40 R57 A58	T40-T42 HydrophobicContact CG2-CG2 4.3Å; T42-R57 WeakPolarHBondContact O-CA 2.88Å; T42-A58 PolarHBondContact N-O 3.13Å; T42-A58 PolarHBondContact O-N 2.89Å; T42-A58 PolarHBondContact OG1-O 2.88Å
43	T	78.8	Confident	70.4	Confident	93 Å²	93	102.2 Å²	102.2	57%	0.571	58%	0.575	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-114.3	128.5	176	59.5	0	0	0	0	108.6	W56 R57	T43-W56 CarbonylContact C-O 3.48Å; T43-W56 VanDerWaalsContact CA-O 3.32Å; T43-W56 WeakPolarHBondContact CA-O 3.04Å; T43-R57 HydrophobicContact CG2-CG 4.05Å
44	T	82.6	Confident	72.7	Confident	82 Å²	82	101.8 Å²	101.8	50%	0.503	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-124.7	130.4	174.8	-173.5	0	0	0	0	109.5	W56	T44-W56 HydrophobicContact CG2-CB 3.77Å; T44-W56 PolarHBondContact N-O 3.45Å; T44-W56 PolarHBondContact O-N 3.05Å
45	T	81	Confident	74.6	Confident	86 Å²	86	100 Å²	100	53%	0.528	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	126.1	174.5	49.3	0	0	0	0	108.6	E53 T55	T45-E53 HydrophobicContact CG2-CG 4.23Å; T45-T55 HydrophobicContact CG2-CG2 4.45Å
46	V	81.8	Confident	76	Confident	58 Å²	58	100.2 Å²	100.2	35%	0.352	53%	0.53	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	164.3	171.5	-53.2	0	0	0	0	108.4	I54 W56	V46-I54 HydrophobicContact CG2-CB 3.91Å; V46-I54 HydrophobicContact CG2-CG2 4.44Å; V46-I54 PolarHBondContact N-O 3.21Å; V46-I54 PolarHBondContact O-N 3Å; V46-W56 VanDerWaalsContact CG2-CD1 3.47Å; V46-W56 VanDerWaalsContact CG2-NE1 3.33Å
47	R	82.8	Confident	77.2	Confident	207 Å²	207	98.6 Å²	98.6	78%	0.781	52%	0.517	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.8	141.1	171.2	-74.6	-173.2	-99.4	-178.9	-6.1	110.4	G52	R47-G52 CarbonylContact C-O 3.49Å; R47-G52 VanDerWaalsContact CA-O 3.27Å; R47-G52 WeakPolarHBondContact CA-O 3.21Å
48	D	81.6	Confident	78	Confident	60 Å²	60	95.8 Å²	95.8	32%	0.321	50%	0.503	S	S	.	.			trans	-71.9	176.6	169	77.5	18.7	0	0	0	110.9	N50 G51 G52 I54	D48-N50 PolarHBondContact O-N 2.96Å; D48-N50 WeakPolarHBondContact OD1-CA 3.48Å; D48-N50 WeakPolarHBondContact OD1-CB 3.32Å; D48-N50 PolarHBondContact OD1-N 3.33Å; D48-G51 PolarHBondContact O-N 3.43Å; D48-G51 PolarHBondContact OD1-N 3.24Å; D48-G52 PolarHBondContact N-O 2.94Å; D48-G52 PolarHBondContact OD1-N 3.31Å; D48-I54 HydrophobicContact CB-CD1 3.61Å; D48-I54 HydrophobicContact CB-CG1 4.13Å
49	R	83.2	Confident	78.7	Confident	250 Å²	250	88.8 Å²	88.8	94%	0.943	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.3	-17.1	-179.5	-64.2	-177.4	-179.1	170.3	0.2	113.8
50	N	89.9	Confident	78.8	Confident	155 Å²	155	88 Å²	88	83%	0.829	46%	0.463	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.3	1.4	179.4	-56	-31.2	0	0	0	112.1	D48	D48-N50 PolarHBondContact O-N 2.96Å; D48-N50 WeakPolarHBondContact OD1-CA 3.48Å; D48-N50 WeakPolarHBondContact OD1-CB 3.32Å; D48-N50 PolarHBondContact OD1-N 3.33Å
51	G	84.6	Confident	78.9	Confident	47 Å²	47	85 Å²	85	49%	0.485	45%	0.447	S	S	.	.	S	Bend	trans	86.9	2.8	-177.8	0	0	0	0	0	115.4	D48	D48-G51 PolarHBondContact O-N 3.43Å; D48-G51 PolarHBondContact OD1-N 3.24Å
52	G	86.7	Confident	78.4	Confident	31 Å²	31	85.5 Å²	85.5	32%	0.32	45%	0.447	S	S	.	.			trans	-69.2	140.9	174.1	0	0	0	0	0	111.9	R47 D48	R47-G52 CarbonylContact C-O 3.49Å; R47-G52 VanDerWaalsContact CA-O 3.27Å; R47-G52 WeakPolarHBondContact CA-O 3.21Å; D48-G52 PolarHBondContact N-O 2.94Å; D48-G52 PolarHBondContact OD1-N 3.31Å
53	E	87.6	Confident	77.7	Confident	143 Å²	143	83.9 Å²	83.9	67%	0.668	44%	0.438	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-78.7	129.4	177.4	-169.7	174.6	105.7	0	0	110.9	T45	T45-E53 HydrophobicContact CG2-CG 4.23Å
54	I	82.9	Confident	76.6	Confident	52 Å²	52	82.9 Å²	82.9	27%	0.267	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	118.9	172.3	-58.2	175.8	0	0	0	108.2	P9 V46 D48	P9-I54 HydrophobicContact CB-CG2 4.19Å; P9-I54 HydrophobicContact CG-CG2 4.37Å; V46-I54 HydrophobicContact CG2-CB 3.91Å; V46-I54 HydrophobicContact CG2-CG2 4.44Å; V46-I54 PolarHBondContact N-O 3.21Å; V46-I54 PolarHBondContact O-N 3Å; D48-I54 HydrophobicContact CB-CD1 3.61Å; D48-I54 HydrophobicContact CB-CG1 4.13Å
55	T	83.1	Confident	75.2	Confident	47 Å²	47	84.2 Å²	84.2	29%	0.288	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.2	115.7	174.7	-58.3	0	0	0	0	110.2	T45	T45-T55 HydrophobicContact CG2-CG2 4.45Å
56	W	74.3	Confident	74.1	Confident	105 Å²	105	81.7 Å²	81.7	40%	0.398	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94	141.3	171.4	-68.5	83.1	0	0	0	110.3	T43 T44 V46	T43-W56 CarbonylContact C-O 3.48Å; T43-W56 VanDerWaalsContact CA-O 3.32Å; T43-W56 WeakPolarHBondContact CA-O 3.04Å; T44-W56 HydrophobicContact CG2-CB 3.77Å; T44-W56 PolarHBondContact N-O 3.45Å; T44-W56 PolarHBondContact O-N 3.05Å; V46-W56 VanDerWaalsContact CG2-CD1 3.47Å; V46-W56 VanDerWaalsContact CG2-NE1 3.33Å
57	R	74.3	Confident	72.7	Confident	116 Å²	116	86.7 Å²	86.7	44%	0.438	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.4	134.9	173.7	-57.4	-167.9	172.9	179.8	-2.4	109	E7 T42 T43	E7-R57 HydrophobicContact CB-CB 4.36Å; E7-R57 PolarHBondContact N-O 3.17Å; T42-R57 WeakPolarHBondContact O-CA 2.88Å; T43-R57 HydrophobicContact CG2-CG 4.05Å
58	A	69.5	Low	71.3	Confident	25 Å²	25	80.6 Å²	80.6	21%	0.207	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.2	124.4	172.1	0	0	0	0	0	108.1	V4 T41 T42	V4-A58 HydrophobicContact CG1-CB 4.13Å; T41-A58 WeakPolarHBondContact CA-O 3.27Å; T42-A58 PolarHBondContact N-O 3.13Å; T42-A58 PolarHBondContact O-N 2.89Å; T42-A58 PolarHBondContact OG1-O 2.88Å
59	T	71.1	Confident	70	Confident	19 Å²	19	83.3 Å²	83.3	12%	0.117	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	124.6	174	-58.2	0	0	0	0	108.1	T5 A39 T41	T5-T59 PolarHBondContact N-O 3.29Å; A39-T59 HydrophobicContact CB-CG2 3.81Å; T41-T59 PolarHBondContact OG1-OG1 3.09Å
60	S	66.7	Low	68.4	Low	40 Å²	40	84.1 Å²	84.1	28%	0.28	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	138.3	177.6	63.5	0	0	0	0	109.9	C3 A39 T40	C3-S60 WeakPolarHBondContact O-CA 2.8Å; A39-S60 CarbonylContact C-O 3.57Å; A39-S60 VanDerWaalsContact CA-O 3.29Å; A39-S60 WeakPolarHBondContact CA-O 3.49Å; T40-S60 PolarHBondContact N-O 2.83Å; T40-S60 PolarHBondContact O-N 2.77Å; T40-S60 PolarHBondContact O-OG 3.02Å; T40-S60 VanDerWaalsContact O-OG 3.13Å
61	G	66.9	Low	67.3	Low	13 Å²	13	80.6 Å²	80.6	13%	0.134	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	177.1	-176.8	-174.3	0	0	0	0	0	112.8	C3 C63 M66	C3-G61 PolarHBondContact N-O 2.72Å; C3-G61 PolarHBondContact O-N 2.66Å; C3-G61 VanDerWaalsContact O-N 3.17Å; G61-C63 PolarHBondContact O-N 2.74Å; G61-M66 VanDerWaalsContact CA-CE 3.41Å
62	N	63.1	Low	66.4	Low	87 Å²	87	82.3 Å²	82.3	47%	0.465	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.4	121.9	178.1	-174.6	-17.4	0	0	0	110.7	G64 L65 M66	N62-G64 VanDerWaalsContact C-N 3.32Å; N62-G64 PolarHBondContact O-N 2.91Å; N62-G64 PolarHBondContact OD1-N 2.79Å; N62-L65 HydrophobicContact CB-CD1 4.44Å; N62-L65 PolarHBondContact O-N 2.83Å; N62-M66 PolarHBondContact O-N 2.85Å
63	C	59.8	Low	65.3	Low	46 Å²	46	85.2 Å²	85.2	31%	0.311	46%	0.463	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.8	-31.9	-172.8	-48.1	0	0	0	0	115.1	S2 C3 G61 L65	S2-C63 VanDerWaalsContact C-SG 3.57Å; C3-C63 WeakPolarHBondContact CA-SG 3.46Å; C3-C63 HydrophobicContact CB-CB 4.14Å; C3-C63 WeakPolarHBondContact CB-SG 3.29Å; C3-C63 PolarHBondContact N-SG 3.31Å; C3-C63 WeakPolarHBondContact SG-CA 3.36Å; C3-C63 WeakPolarHBondContact SG-CB 3.2Å; C3-C63 PolarHBondContact SG-N 3.24Å; C3-C63 VanDerWaalsContact SG-N 3.36Å; C3-C63 CovalentContact SG-SG 2.03Å; C3-C63 PolarHBondContact SG-SG 2.78Å; G61-C63 PolarHBondContact O-N 2.74Å; C63-L65 PolarHBondContact O-N 2.69Å
64	G	55.3	Low	64	Low	72 Å²	72	81.8 Å²	81.8	74%	0.742	45%	0.451	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.3	-14	177.4	0	0	0	0	0	113.1	N62	N62-G64 VanDerWaalsContact C-N 3.32Å; N62-G64 PolarHBondContact O-N 2.91Å; N62-G64 PolarHBondContact OD1-N 2.79Å
65	L	53	Low	62.8	Low	109 Å²	109	83.6 Å²	83.6	57%	0.571	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-121.5	-9.8	-174.3	-55.7	175.3	0	0	0	112.5	T37 N62 C63 N67	T37-L65 HydrophobicContact CG2-CB 4.16Å; T37-L65 HydrophobicContact CG2-CD1 3.36Å; T37-L65 HydrophobicContact CG2-CG 4.36Å; N62-L65 HydrophobicContact CB-CD1 4.44Å; N62-L65 PolarHBondContact O-N 2.83Å; C63-L65 PolarHBondContact O-N 2.69Å; L65-N67 PolarHBondContact O-N 3.31Å
66	M	57.3	Low	61.4	Low	34 Å²	34	86.1 Å²	86.1	17%	0.167	47%	0.474	C	S	.	.			trans	-78.7	112.2	175.3	-160.3	177.3	-61.9	0	0	107	T5 G61 N62 I68	T5-M66 HydrophobicContact CG2-SD 3.87Å; G61-M66 VanDerWaalsContact CA-CE 3.41Å; N62-M66 PolarHBondContact O-N 2.85Å; M66-I68 HydrophobicContact CB-CD1 4.3Å; M66-I68 HydrophobicContact CB-CG1 3.95Å; M66-I68 HydrophobicContact CG-CD1 4.36Å; M66-I68 HydrophobicContact CG-CG1 3.78Å; M66-I68 PolarHBondContact O-N 3.01Å; M66-I68 HydrophobicContact SD-CD1 4.15Å; M66-I68 HydrophobicContact SD-CG1 4.04Å
67	N	54	Low	60.5	Low	162 Å²	162	84.7 Å²	84.7	87%	0.866	48%	0.479	S	S	*	.			trans	-73	72.2	177.3	-160	56.4	0	0	0	108.7	L65 P69	L65-N67 PolarHBondContact O-N 3.31Å; N67-P69 WeakPolarHBondContact O-CD 3.36Å
68	I	53.2	Low	59.4	Low	79 Å²	79	82.3 Å²	82.3	41%	0.405	48%	0.483	S	S	.	.			trans	-77.2	111.3	178.4	-53.1	172.3	0	0	0	106.1	T5 M66 Q70	T5-I68 HydrophobicContact CG2-CD1 3.51Å; T5-I68 HydrophobicContact CG2-CG1 3.75Å; T5-I68 HydrophobicContact CG2-CG2 4.06Å; M66-I68 HydrophobicContact CB-CD1 4.3Å; M66-I68 HydrophobicContact CB-CG1 3.95Å; M66-I68 HydrophobicContact CG-CD1 4.36Å; M66-I68 HydrophobicContact CG-CG1 3.78Å; M66-I68 PolarHBondContact O-N 3.01Å; M66-I68 HydrophobicContact SD-CD1 4.15Å; M66-I68 HydrophobicContact SD-CG1 4.04Å; I68-Q70 PolarHBondContact O-N 2.64Å
69	P	52.4	Low	58.6	Low	118 Å²	118	87.1 Å²	87.1	77%	0.766	51%	0.506	S	S	*	.			trans	-58.9	124.7	169.4	23.7	-29.7	0	0	0	108.1	N67	N67-P69 WeakPolarHBondContact O-CD 3.36Å
70	Q	50.2	Low	57.5	Low	266 Å²	266	93.3 Å²	93.3	100%	1.243	54%	0.541	S	S	*	.			trans	-72.3	0	175.8	-64.9	-143.2	-31.7	0	0	111.5	I68	I68-Q70 PolarHBondContact O-N 2.64Å

Retrieved 70 of 70 residues in 12.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).