X2JK14_DROME Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession X2JK14, Species DROME (Drosophila melanogaster, Fruit fly), Gene Dmel\CG44428, Length 95 aa.

						>X2JK14_DROME|X2JK14|Dmel\CG44428
MTANKQPLSAATNRQKLKTVGILLHVRDAAKAAPSSHIATNLVCPRWDAYTERKCGVKQKLGVLEWQIRAASTKSYNIYIYLLMLSNIVKDLMKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.3	Very low	50.8	Low	249 Å²	249	127.5 Å²	127.5	100%	1.227	74%	0.736	S	S	*	*				0	105.3	0	-83.1	176.5	171.2	0	0	108.7	A3	M1-A3 PolarHBondContact O-N 3.09Å
2	T	40.3	Very low	51.1	Low	146 Å²	146	121.5 Å²	121.5	90%	0.896	70%	0.704	S	S	*	*			trans	-84.1	107.2	175.9	26.8	0	0	0	0	109.1	N4	T2-N4 PolarHBondContact O-N 3.5Å; T2-N4 VanDerWaalsContact O-N 3.09Å
3	A	51.5	Low	51.2	Low	91 Å²	91	117.7 Å²	117.7	75%	0.752	68%	0.679	S	S	*	*			trans	-69.8	105	175.9	0	0	0	0	0	109.5	M1 K5	M1-A3 PolarHBondContact O-N 3.09Å; A3-K5 PolarHBondContact O-N 3.01Å
4	N	44	Very low	51.1	Low	145 Å²	145	122.9 Å²	122.9	78%	0.775	68%	0.682	S	S	*	*			trans	-67.9	97	177.3	-152	-6.3	0	0	0	108.8	T2 Q6	T2-N4 PolarHBondContact O-N 3.5Å; T2-N4 VanDerWaalsContact O-N 3.09Å; N4-Q6 PolarHBondContact O-N 2.86Å
5	K	49.1	Very low	51.2	Low	196 Å²	196	124 Å²	124	85%	0.852	68%	0.68	S	S	*	*			trans	-76.6	71.4	175.7	-67.1	-176.2	-177.5	178.3	0	109.3	A3	A3-K5 PolarHBondContact O-N 3.01Å
6	Q	59.7	Low	51	Low	155 Å²	155	123.6 Å²	123.6	72%	0.724	67%	0.669	S	S	*	*	P	Polyproline II helix	trans	-63.5	132.1	167.6	-81	-170.7	-33.8	0	0	109.3	N4 L8	N4-Q6 PolarHBondContact O-N 2.86Å; Q6-L8 PolarHBondContact O-N 3.2Å; Q6-L8 VanDerWaalsContact O-N 3.14Å
7	P	54.9	Low	50.8	Low	123 Å²	123	123.6 Å²	123.6	80%	0.799	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-63.9	118.6	174.7	25	-30.2	0	0	0	108.6	S9	P7-S9 PolarHBondContact O-N 3.49Å; P7-S9 VanDerWaalsContact O-N 3.14Å
8	L	53.4	Low	50.7	Low	94 Å²	94	125.5 Å²	125.5	49%	0.492	67%	0.669	S	S	.	*	P	Polyproline II helix	trans	-55.9	119.4	172.2	-77.8	156.9	0	0	0	108.5	Q6 A10 T12	Q6-L8 PolarHBondContact O-N 3.2Å; Q6-L8 VanDerWaalsContact O-N 3.14Å; L8-A10 PolarHBondContact O-N 3.14Å; L8-T12 HydrophobicContact CD2-CG2 4.06Å
9	S	54.9	Low	50.7	Low	74 Å²	74	123.4 Å²	123.4	52%	0.517	66%	0.661	S	S	.	*			trans	-45.6	139.3	176	170.9	0	0	0	0	111.2	P7 A11 T12 N13	P7-S9 PolarHBondContact O-N 3.49Å; P7-S9 VanDerWaalsContact O-N 3.14Å; S9-A11 PolarHBondContact O-N 2.95Å; S9-T12 WeakPolarHBondContact O-CA 3.42Å; S9-T12 WeakPolarHBondContact O-CB 3.49Å; S9-T12 PolarHBondContact O-N 3Å; S9-N13 PolarHBondContact O-N 3.14Å
10	A	54.8	Low	50.5	Low	67 Å²	67	121.2 Å²	121.2	55%	0.554	65%	0.653	S	S	*	*	H	α-helix	trans	-53.8	-27.3	-178.9	0	0	0	0	0	113.2	L8 R14	L8-A10 PolarHBondContact O-N 3.14Å; A10-R14 WeakPolarHBondContact O-CG 3.35Å; A10-R14 PolarHBondContact O-N 2.93Å; A10-R14 VanDerWaalsContact O-N 3.07Å
11	A	54.7	Low	50.4	Low	62 Å²	62	116.6 Å²	116.6	51%	0.512	63%	0.634	S	S	.	*	H	α-helix	trans	-65.8	-42.3	173.8	0	0	0	0	0	112.4	S9 R14 Q15	S9-A11 PolarHBondContact O-N 2.95Å; A11-R14 PolarHBondContact O-N 3.48Å; A11-Q15 PolarHBondContact O-N 2.94Å
12	T	54.6	Low	50.7	Low	56 Å²	56	110 Å²	110	34%	0.344	60%	0.602	S	S	.	*	H	α-helix	trans	-70	-36.5	179.2	-44.3	0	0	0	0	111.5	L8 S9 Q15 K16	L8-T12 HydrophobicContact CD2-CG2 4.06Å; S9-T12 WeakPolarHBondContact O-CA 3.42Å; S9-T12 WeakPolarHBondContact O-CB 3.49Å; S9-T12 PolarHBondContact O-N 3Å; T12-Q15 PolarHBondContact O-N 3.37Å; T12-K16 PolarHBondContact O-N 3.23Å
13	N	52.6	Low	51.2	Low	72 Å²	72	107.1 Å²	107.1	39%	0.385	58%	0.581	S	S	.	*	H	α-helix	trans	-67.9	-39	173.4	-87.7	-29.3	0	0	0	112.3	S9 K16 L17	S9-N13 PolarHBondContact O-N 3.14Å; N13-K16 PolarHBondContact O-N 3.4Å; N13-L17 WeakPolarHBondContact O-CB 3.39Å; N13-L17 WeakPolarHBondContact O-CD1 3.46Å; N13-L17 PolarHBondContact O-N 2.94Å
14	R	48.8	Very low	51.3	Low	190 Å²	190	106.9 Å²	106.9	72%	0.717	57%	0.566	S	S	*	*	H	α-helix	trans	-65.2	-37.7	174.5	-76.8	177.1	178.7	166.5	0.3	112.8	A10 A11 K18	A10-R14 WeakPolarHBondContact O-CG 3.35Å; A10-R14 PolarHBondContact O-N 2.93Å; A10-R14 VanDerWaalsContact O-N 3.07Å; A11-R14 PolarHBondContact O-N 3.48Å; R14-K18 WeakPolarHBondContact O-CG 3.49Å; R14-K18 PolarHBondContact O-N 3.06Å
15	Q	53.4	Low	51.8	Low	140 Å²	140	106.7 Å²	106.7	65%	0.654	56%	0.561	S	S	*	*	H	α-helix	trans	-66.3	-46.2	172.2	-93.5	-179.4	-16.4	0	0	111.7	A11 T12 L17 K18 T19	A11-Q15 PolarHBondContact O-N 2.94Å; T12-Q15 PolarHBondContact O-N 3.37Å; Q15-L17 VanDerWaalsContact C-N 3.33Å; Q15-L17 PolarHBondContact O-N 3.07Å; Q15-K18 PolarHBondContact O-N 2.82Å; Q15-T19 PolarHBondContact O-N 3.35Å; Q15-T19 PolarHBondContact O-OG1 2.94Å
16	K	48	Very low	51.9	Low	117 Å²	117	101.8 Å²	101.8	51%	0.509	55%	0.547	S	S	.	.	H	α-helix	trans	-59.4	-41.8	174.7	-85.1	-175.9	174.3	-178.4	0	112.1	T12 N13 T19 V20	T12-K16 PolarHBondContact O-N 3.23Å; N13-K16 PolarHBondContact O-N 3.4Å; K16-T19 PolarHBondContact O-N 3.3Å; K16-V20 WeakPolarHBondContact O-CB 3.4Å; K16-V20 WeakPolarHBondContact O-CG2 3.49Å; K16-V20 PolarHBondContact O-N 3.43Å
17	L	47.7	Very low	51.5	Low	124 Å²	124	101.9 Å²	101.9	65%	0.649	54%	0.541	S	S	*	.	H	α-helix	trans	-67.1	-37.2	176.3	-95.9	138.3	0	0	0	112.9	N13 Q15 V20 G21	N13-L17 WeakPolarHBondContact O-CB 3.39Å; N13-L17 WeakPolarHBondContact O-CD1 3.46Å; N13-L17 PolarHBondContact O-N 2.94Å; Q15-L17 VanDerWaalsContact C-N 3.33Å; Q15-L17 PolarHBondContact O-N 3.07Å; L17-V20 PolarHBondContact O-N 2.98Å; L17-G21 PolarHBondContact O-N 2.85Å
18	K	49.6	Very low	51.4	Low	158 Å²	158	100.3 Å²	100.3	69%	0.687	53%	0.526	S	S	*	.	H	α-helix	trans	-63.4	-43.4	171.3	-79.9	-174.9	177.2	-173.7	0	111.2	R14 Q15 G21 I22	R14-K18 WeakPolarHBondContact O-CG 3.49Å; R14-K18 PolarHBondContact O-N 3.06Å; Q15-K18 PolarHBondContact O-N 2.82Å; K18-G21 PolarHBondContact O-N 2.87Å; K18-I22 WeakPolarHBondContact O-CD1 3.47Å; K18-I22 WeakPolarHBondContact O-CG1 3.34Å; K18-I22 PolarHBondContact O-N 3.38Å
19	T	50	Low	51.3	Low	85 Å²	85	99 Å²	99	52%	0.521	53%	0.529	S	S	.	.	H	α-helix	trans	-66.1	-38.2	177.4	-50.4	0	0	0	0	112.1	Q15 K16 L23	Q15-T19 PolarHBondContact O-N 3.35Å; Q15-T19 PolarHBondContact O-OG1 2.94Å; K16-T19 PolarHBondContact O-N 3.3Å; T19-L23 WeakPolarHBondContact O-CD1 3.34Å; T19-L23 WeakPolarHBondContact O-CG 3.48Å; T19-L23 PolarHBondContact O-N 3.02Å
20	V	47.3	Very low	51	Low	80 Å²	80	98.8 Å²	98.8	49%	0.485	53%	0.531	S	S	.	.	H	α-helix	trans	-73.3	-36.7	176.4	174.9	0	0	0	0	111.7	K16 L17 L23 L24	K16-V20 WeakPolarHBondContact O-CB 3.4Å; K16-V20 WeakPolarHBondContact O-CG2 3.49Å; K16-V20 PolarHBondContact O-N 3.43Å; L17-V20 PolarHBondContact O-N 2.98Å; V20-L23 WeakPolarHBondContact O-CB 3.24Å; V20-L23 PolarHBondContact O-N 3.41Å; V20-L24 PolarHBondContact O-N 2.79Å
21	G	48.1	Very low	50.9	Low	25 Å²	25	102.6 Å²	102.6	26%	0.258	54%	0.535	S	S	.	.	H	α-helix	trans	-66.2	-38.3	174.6	0	0	0	0	0	112.7	L17 K18 L23 L24 H25	L17-G21 PolarHBondContact O-N 2.85Å; K18-G21 PolarHBondContact O-N 2.87Å; G21-L23 VanDerWaalsContact C-N 3.32Å; G21-L23 PolarHBondContact O-N 2.98Å; G21-L24 PolarHBondContact O-N 3.28Å; G21-H25 PolarHBondContact O-CD2 3.34Å; G21-H25 PolarHBondContact O-N 3.42Å
22	I	47.6	Very low	50.7	Low	109 Å²	109	103.7 Å²	103.7	56%	0.559	54%	0.544	S	S	*	.	H	α-helix	trans	-62.1	-41.6	171.3	-67.8	161.5	0	0	0	110.4	K18 L24 H25 V26	K18-I22 WeakPolarHBondContact O-CD1 3.47Å; K18-I22 WeakPolarHBondContact O-CG1 3.34Å; K18-I22 PolarHBondContact O-N 3.38Å; I22-L24 VanDerWaalsContact C-N 3.31Å; I22-L24 PolarHBondContact O-N 2.89Å; I22-H25 PolarHBondContact O-N 2.75Å; I22-V26 HydrophobicContact CG2-CG2 4.45Å; I22-V26 VanDerWaalsContact O-CG2 3.25Å; I22-V26 WeakPolarHBondContact O-CG2 3.16Å; I22-V26 PolarHBondContact O-N 2.86Å
23	L	51.1	Low	50.3	Low	86 Å²	86	103.5 Å²	103.5	45%	0.45	55%	0.548	S	S	.	.	H	α-helix	trans	-63.5	-33.5	176.5	-81.1	158.7	0	0	0	113	T19 V20 G21 R27	T19-L23 WeakPolarHBondContact O-CD1 3.34Å; T19-L23 WeakPolarHBondContact O-CG 3.48Å; T19-L23 PolarHBondContact O-N 3.02Å; V20-L23 WeakPolarHBondContact O-CB 3.24Å; V20-L23 PolarHBondContact O-N 3.41Å; G21-L23 VanDerWaalsContact C-N 3.32Å; G21-L23 PolarHBondContact O-N 2.98Å; L23-R27 VanDerWaalsContact O-CB 3.32Å; L23-R27 WeakPolarHBondContact O-CB 3.32Å; L23-R27 PolarHBondContact O-N 3.33Å
24	L	53.1	Low	49.8	Very low	86 Å²	86	105.7 Å²	105.7	45%	0.45	57%	0.567	S	S	.	*	H	α-helix	trans	-68.7	-46.2	175.8	-72.8	169.4	0	0	0	112	V20 G21 I22 V26 R27 D28	V20-L24 PolarHBondContact O-N 2.79Å; G21-L24 PolarHBondContact O-N 3.28Å; I22-L24 VanDerWaalsContact C-N 3.31Å; I22-L24 PolarHBondContact O-N 2.89Å; L24-V26 VanDerWaalsContact C-N 3.3Å; L24-V26 PolarHBondContact O-N 2.98Å; L24-R27 WeakPolarHBondContact O-CB 3.33Å; L24-R27 PolarHBondContact O-N 3.44Å; L24-R27 VanDerWaalsContact O-N 3.13Å; L24-D28 PolarHBondContact O-N 2.86Å
25	H	55	Low	49.6	Very low	142 Å²	142	101.1 Å²	101.1	66%	0.657	56%	0.563	S	S	*	*	H	α-helix	trans	-63.7	-35.4	176.4	-69.8	-58.6	0	0	0	112.9	G21 I22 A29	G21-H25 PolarHBondContact O-CD2 3.34Å; G21-H25 PolarHBondContact O-N 3.42Å; I22-H25 PolarHBondContact O-N 2.75Å; H25-A29 VanDerWaalsContact O-CB 3.25Å; H25-A29 WeakPolarHBondContact O-CB 3.34Å; H25-A29 PolarHBondContact O-N 2.78Å
26	V	51.6	Low	48.8	Very low	93 Å²	93	99.4 Å²	99.4	56%	0.564	57%	0.567	S	S	*	*	H	α-helix	trans	-69.1	-37.4	174.5	174.3	0	0	0	0	111.1	I22 L24 A30	I22-V26 HydrophobicContact CG2-CG2 4.45Å; I22-V26 VanDerWaalsContact O-CG2 3.25Å; I22-V26 WeakPolarHBondContact O-CG2 3.16Å; I22-V26 PolarHBondContact O-N 2.86Å; L24-V26 VanDerWaalsContact C-N 3.3Å; L24-V26 PolarHBondContact O-N 2.98Å; V26-A30 VanDerWaalsContact O-CB 3.31Å; V26-A30 WeakPolarHBondContact O-CB 3.48Å; V26-A30 PolarHBondContact O-N 3.44Å
27	R	50.4	Low	48.5	Very low	156 Å²	156	101.4 Å²	101.4	59%	0.589	58%	0.578	S	S	*	*	H	α-helix	trans	-65.9	-42.9	174.6	-174.9	-175.1	-176.9	-171.6	1.1	111.8	L23 L24 A30 K31	L23-R27 VanDerWaalsContact O-CB 3.32Å; L23-R27 WeakPolarHBondContact O-CB 3.32Å; L23-R27 PolarHBondContact O-N 3.33Å; L24-R27 WeakPolarHBondContact O-CB 3.33Å; L24-R27 PolarHBondContact O-N 3.44Å; L24-R27 VanDerWaalsContact O-N 3.13Å; R27-A30 PolarHBondContact O-N 3.44Å; R27-K31 WeakPolarHBondContact O-CB 3.39Å; R27-K31 PolarHBondContact O-N 3.42Å
28	D	52.6	Low	48.1	Very low	91 Å²	91	101.5 Å²	101.5	49%	0.487	58%	0.578	S	S	.	*	H	α-helix	trans	-70.5	-38.9	179.8	-69	-24.1	0	0	0	111.4	L24 A30 K31 A32	L24-D28 PolarHBondContact O-N 2.86Å; D28-A30 VanDerWaalsContact C-N 3.34Å; D28-A30 PolarHBondContact O-N 2.91Å; D28-K31 PolarHBondContact O-N 3.37Å; D28-A32 WeakPolarHBondContact O-CB 3.47Å; D28-A32 PolarHBondContact O-N 3.23Å
29	A	51.4	Low	47.8	Very low	67 Å²	67	97.4 Å²	97.4	55%	0.554	57%	0.573	S	S	*	*	H	α-helix	trans	-64.2	-36.5	172.3	0	0	0	0	0	112.6	H25	H25-A29 VanDerWaalsContact O-CB 3.25Å; H25-A29 WeakPolarHBondContact O-CB 3.34Å; H25-A29 PolarHBondContact O-N 2.78Å
30	A	49.8	Very low	47.4	Very low	69 Å²	69	98.1 Å²	98.1	57%	0.57	58%	0.578	S	S	*	*	H	α-helix	trans	-73	-31.5	174.8	0	0	0	0	0	112.8	V26 R27 D28	V26-A30 VanDerWaalsContact O-CB 3.31Å; V26-A30 WeakPolarHBondContact O-CB 3.48Å; V26-A30 PolarHBondContact O-N 3.44Å; R27-A30 PolarHBondContact O-N 3.44Å; D28-A30 VanDerWaalsContact C-N 3.34Å; D28-A30 PolarHBondContact O-N 2.91Å
31	K	51	Low	47	Very low	147 Å²	147	98.4 Å²	98.4	64%	0.639	58%	0.576	S	S	*	*	H	α-helix	trans	-72.9	-32.1	173.9	-111.9	-177.9	174.8	-171.9	0	112.9	R27 D28 A33	R27-K31 WeakPolarHBondContact O-CB 3.39Å; R27-K31 PolarHBondContact O-N 3.42Å; D28-K31 PolarHBondContact O-N 3.37Å; K31-A33 PolarHBondContact O-N 3.32Å
32	A	52.2	Low	46.8	Very low	85 Å²	85	103.9 Å²	103.9	70%	0.702	60%	0.599	S	S	*	*	S	Bend	trans	-72.6	-13.3	179.1	0	0	0	0	0	113.6	D28	D28-A32 WeakPolarHBondContact O-CB 3.47Å; D28-A32 PolarHBondContact O-N 3.23Å
33	A	45.6	Very low	46.7	Very low	52 Å²	52	104.4 Å²	104.4	43%	0.43	61%	0.607	S	S	.	*			trans	-129.2	76	179.5	0	0	0	0	0	112	K31 S35	K31-A33 PolarHBondContact O-N 3.32Å; A33-S35 PolarHBondContact O-N 3.46Å
34	P	41.4	Very low	46.2	Very low	118 Å²	118	102.9 Å²	102.9	77%	0.766	60%	0.603	S	S	*	*			trans	-80.7	6.6	180	4.9	12.4	0	0	0	114.3
35	S	43.8	Very low	45.7	Very low	93 Å²	93	103.4 Å²	103.4	65%	0.65	61%	0.611	S	S	*	*	S	Bend	trans	-142.9	102.2	177.9	53.8	0	0	0	0	112.4	A33 H37	A33-S35 PolarHBondContact O-N 3.46Å; S35-H37 PolarHBondContact O-N 3.47Å
36	S	37.3	Very low	45.3	Very low	105 Å²	105	107.5 Å²	107.5	73%	0.734	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-4	101.3	145.5	53.2	0	0	0	0	114.6
37	H	42.1	Very low	45	Very low	158 Å²	158	108.5 Å²	108.5	73%	0.731	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn		-152.4	1.8	82.6	-83.9	-65.9	0	0	0	113.8	S35	S35-H37 PolarHBondContact O-N 3.47Å
38	I	40	Very low	44.7	Very low	127 Å²	127	104.7 Å²	104.7	65%	0.651	61%	0.606	S	S	*	*	S	Bend	trans	-92.2	-24.6	-166.2	-61.3	173.5	0	0	0	112.8	T40 N41 L42	I38-T40 VanDerWaalsContact C-N 3.25Å; I38-T40 PolarHBondContact O-N 2.66Å; I38-N41 PolarHBondContact O-N 2.94Å; I38-L42 HydrophobicContact CG2-CD1 4.41Å
39	A	43	Very low	44.4	Very low	71 Å²	71	103.1 Å²	103.1	59%	0.587	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.1	-15.7	-178	0	0	0	0	0	114.5
40	T	41.9	Very low	44.1	Very low	100 Å²	100	107.2 Å²	107.2	61%	0.613	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.5	-25.5	174.4	-40.2	0	0	0	0	112	I38	I38-T40 VanDerWaalsContact C-N 3.25Å; I38-T40 PolarHBondContact O-N 2.66Å
41	N	38.9	Very low	43.9	Very low	86 Å²	86	104.7 Å²	104.7	46%	0.46	59%	0.586	S	S	.	*	T	Hydrogen-bonded Turn	trans	-90.4	-10.7	-174.7	-75.8	-11.7	0	0	0	114.6	I38 P45	I38-N41 PolarHBondContact O-N 2.94Å; N41-P45 VanDerWaalsContact O-CD 3.31Å; N41-P45 WeakPolarHBondContact O-CD 3.14Å
42	L	44	Very low	43.9	Very low	140 Å²	140	105 Å²	105	73%	0.733	59%	0.589	S	S	*	*	S	Bend	trans	-82.2	-15.7	178	-79.6	160.7	0	0	0	113.6	I38	I38-L42 HydrophobicContact CG2-CD1 4.41Å
43	V	43.9	Very low	44	Very low	120 Å²	120	111.5 Å²	111.5	73%	0.727	60%	0.596	S	S	*	*	S	Bend	trans	-96.7	-10.2	178.3	-172.9	0	0	0	0	112
44	C	41	Very low	44.2	Very low	54 Å²	54	117 Å²	117	37%	0.365	61%	0.61	S	S	.	*			trans	-155.7	44.2	-172.5	-99	0	0	0	0	117	R46 W47	C44-R46 PolarHBondContact O-N 3.18Å; C44-W47 HydrophobicContact CB-CB 3.64Å; C44-W47 PolarHBondContact O-N 3.3Å
45	P	41.9	Very low	44.4	Very low	97 Å²	97	112.5 Å²	112.5	63%	0.63	58%	0.581	S	S	*	*	H	α-helix	trans	-64.3	-14.7	175.7	26.4	-30.5	0	0	0	113.3	N41	N41-P45 VanDerWaalsContact O-CD 3.31Å; N41-P45 WeakPolarHBondContact O-CD 3.14Å
46	R	47.5	Very low	44.3	Very low	228 Å²	228	110.7 Å²	110.7	86%	0.86	58%	0.577	S	S	*	*	H	α-helix	trans	-90.6	-11.9	171.7	-83	-176.6	175.4	173.9	-1.2	114.8	C44 Y50	C44-R46 PolarHBondContact O-N 3.18Å; R46-Y50 WeakPolarHBondContact O-CB 3.44Å; R46-Y50 PolarHBondContact O-N 3Å
47	W	44.3	Very low	44.7	Very low	114 Å²	114	111.6 Å²	111.6	43%	0.432	58%	0.578	S	S	.	*	H	α-helix	trans	-82.4	-42.4	-178.6	-170.9	-93.4	0	0	0	111.5	C44 A49 Y50 T51 V63	C44-W47 HydrophobicContact CB-CB 3.64Å; C44-W47 PolarHBondContact O-N 3.3Å; W47-A49 PolarHBondContact O-N 2.82Å; W47-Y50 PolarHBondContact O-N 3.32Å; W47-T51 PolarHBondContact NE1-OG1 3.44Å; W47-T51 WeakPolarHBondContact O-CB 3.37Å; W47-T51 PolarHBondContact O-N 3.3Å; W47-T51 PolarHBondContact O-OG1 3.39Å; W47-V63 HydrophobicContact CZ2-CG2 4.18Å
48	D	45.6	Very low	45	Very low	76 Å²	76	113.5 Å²	113.5	41%	0.406	58%	0.584	S	S	.	*	H	α-helix	trans	-62.9	-43.5	177.8	-69.4	-25.8	0	0	0	111.4	Y50 T51 E52	D48-Y50 VanDerWaalsContact C-N 3.31Å; D48-Y50 PolarHBondContact O-N 3.2Å; D48-T51 PolarHBondContact O-N 2.84Å; D48-E52 WeakPolarHBondContact O-CB 3.41Å; D48-E52 WeakPolarHBondContact O-CG 3.34Å; D48-E52 PolarHBondContact O-N 3.35Å
49	A	45.9	Very low	45.3	Very low	58 Å²	58	113.1 Å²	113.1	48%	0.479	58%	0.58	S	S	.	*	H	α-helix	trans	-65.8	-28.7	177.1	0	0	0	0	0	114.1	W47	W47-A49 PolarHBondContact O-N 2.82Å
50	Y	46	Very low	45.4	Very low	154 Å²	154	115 Å²	115	60%	0.604	58%	0.575	S	S	*	*	H	α-helix	trans	-83.5	-36	178.4	-170.6	-98.1	0	0	0	111.9	R46 W47 D48	R46-Y50 WeakPolarHBondContact O-CB 3.44Å; R46-Y50 PolarHBondContact O-N 3Å; W47-Y50 PolarHBondContact O-N 3.32Å; D48-Y50 VanDerWaalsContact C-N 3.31Å; D48-Y50 PolarHBondContact O-N 3.2Å
51	T	45.5	Very low	45.8	Very low	16 Å²	16	115.2 Å²	115.2	10%	0.098	57%	0.571	C	S	.	*	H	α-helix	trans	-81.6	-30.6	-175.3	-43.7	0	0	0	0	112	W47 D48 R53 C55	W47-T51 PolarHBondContact NE1-OG1 3.44Å; W47-T51 WeakPolarHBondContact O-CB 3.37Å; W47-T51 PolarHBondContact O-N 3.3Å; W47-T51 PolarHBondContact O-OG1 3.39Å; D48-T51 PolarHBondContact O-N 2.84Å; T51-R53 VanDerWaalsContact C-N 3.34Å; T51-R53 PolarHBondContact O-N 2.79Å; T51-C55 HydrophobicContact CG2-CB 3.82Å; T51-C55 WeakPolarHBondContact O-CB 3.15Å; T51-C55 PolarHBondContact O-N 3.27Å
52	E	50.8	Low	46.3	Very low	152 Å²	152	112.9 Å²	112.9	71%	0.71	57%	0.568	S	S	*	*	H	α-helix	trans	-68.8	-26.5	176.5	-79	-172.6	153.1	0	0	114.2	D48	D48-E52 WeakPolarHBondContact O-CB 3.41Å; D48-E52 WeakPolarHBondContact O-CG 3.34Å; D48-E52 PolarHBondContact O-N 3.35Å
53	R	52.8	Low	46.8	Very low	222 Å²	222	107.9 Å²	107.9	84%	0.838	54%	0.543	S	S	*	.	H	α-helix	trans	-93.1	-16.1	-176.2	-67	-166.4	-162.3	-170.5	5	115.4	T51	T51-R53 VanDerWaalsContact C-N 3.34Å; T51-R53 PolarHBondContact O-N 2.79Å
54	K	51.1	Low	47.3	Very low	167 Å²	167	106.5 Å²	106.5	73%	0.726	53%	0.531	S	S	*	.	H	α-helix	trans	-137.4	-7.6	-169	-77.5	-164.3	174.3	-173.8	0	116.8
55	C	44.2	Very low	47.8	Very low	24 Å²	24	109.7 Å²	109.7	16%	0.162	54%	0.54	C	S	.	.			trans	-115.8	101.6	-169.3	-62.5	0	0	0	0	111.1	T51 Q59	T51-C55 HydrophobicContact CG2-CB 3.82Å; T51-C55 WeakPolarHBondContact O-CB 3.15Å; T51-C55 PolarHBondContact O-N 3.27Å; C55-Q59 HydrophobicContact CB-CB 3.93Å; C55-Q59 PolarHBondContact SG-OE1 2.78Å
56	G	42.2	Very low	48.6	Very low	55 Å²	55	113.9 Å²	113.9	57%	0.567	54%	0.544	S	S	*	.			trans	-54.7	156.3	172.6	0	0	0	0	0	112.6	K58 Q59	G56-K58 PolarHBondContact O-N 3.43Å; G56-Q59 PolarHBondContact O-N 2.89Å
57	V	47.2	Very low	48.9	Very low	125 Å²	125	107 Å²	107	76%	0.758	52%	0.522	S	S	*	.	H	α-helix	trans	-43.1	-34	-167.8	-177.2	0	0	0	0	114.8	Q59 K60 L61	V57-Q59 PolarHBondContact O-N 3.44Å; V57-K60 PolarHBondContact O-N 3.37Å; V57-L61 PolarHBondContact O-N 3.39Å
58	K	48.3	Very low	49.5	Very low	198 Å²	198	106.7 Å²	106.7	86%	0.861	53%	0.527	S	S	*	.	H	α-helix	trans	-64.5	-32.5	177.9	-72.6	-174.2	175.6	-178.3	0	114.6	G56	G56-K58 PolarHBondContact O-N 3.43Å
59	Q	44.6	Very low	50	Low	119 Å²	119	112 Å²	112	56%	0.556	54%	0.542	S	S	*	.	H	α-helix	trans	-77.1	-30.9	176.9	-74.9	-175.3	15.3	0	0	112.1	C55 G56 V57 L61 G62 V63	C55-Q59 HydrophobicContact CB-CB 3.93Å; C55-Q59 PolarHBondContact SG-OE1 2.78Å; G56-Q59 PolarHBondContact O-N 2.89Å; V57-Q59 PolarHBondContact O-N 3.44Å; Q59-L61 VanDerWaalsContact C-N 3.27Å; Q59-L61 PolarHBondContact O-N 2.84Å; Q59-G62 PolarHBondContact O-N 2.77Å; Q59-V63 WeakPolarHBondContact O-CG2 3.3Å; Q59-V63 PolarHBondContact O-N 3.5Å
60	K	45	Very low	50.4	Low	111 Å²	111	110.5 Å²	110.5	48%	0.483	53%	0.529	S	S	.	.	H	α-helix	trans	-60.1	-38.1	174	-69.3	-170.4	175.8	-171.2	0	111.8	V57 L64	V57-K60 PolarHBondContact O-N 3.37Å; K60-L64 WeakPolarHBondContact O-CB 3.44Å; K60-L64 PolarHBondContact O-N 2.76Å
61	L	50.2	Low	50.6	Low	103 Å²	103	105.4 Å²	105.4	54%	0.539	52%	0.519	S	S	.	.	H	α-helix	trans	-66.6	-45.4	176.9	-170.6	65.3	0	0	0	112.1	V57 Q59 V63 L64 E65	V57-L61 PolarHBondContact O-N 3.39Å; Q59-L61 VanDerWaalsContact C-N 3.27Å; Q59-L61 PolarHBondContact O-N 2.84Å; L61-V63 VanDerWaalsContact C-N 3.33Å; L61-V63 PolarHBondContact O-N 3.23Å; L61-L64 PolarHBondContact O-N 2.96Å; L61-E65 WeakPolarHBondContact O-CG 3.47Å; L61-E65 PolarHBondContact O-N 2.85Å
62	G	51.3	Low	51.1	Low	38 Å²	38	108.1 Å²	108.1	39%	0.392	54%	0.539	S	S	.	.	H	α-helix	trans	-63.8	-36.1	177.3	0	0	0	0	0	113.4	Q59 W66	Q59-G62 PolarHBondContact O-N 2.77Å; G62-W66 WeakPolarHBondContact O-CB 3.32Å; G62-W66 PolarHBondContact O-N 3.34Å
63	V	54.6	Low	51.3	Low	35 Å²	35	104.3 Å²	104.3	21%	0.212	53%	0.526	C	S	.	.	H	α-helix	trans	-67.1	-42	173.6	173.5	0	0	0	0	111	W47 Q59 L61 W66 Q67	W47-V63 HydrophobicContact CZ2-CG2 4.18Å; Q59-V63 WeakPolarHBondContact O-CG2 3.3Å; Q59-V63 PolarHBondContact O-N 3.5Å; L61-V63 VanDerWaalsContact C-N 3.33Å; L61-V63 PolarHBondContact O-N 3.23Å; V63-W66 PolarHBondContact O-N 2.89Å; V63-Q67 HydrophobicContact CG1-CG 4.43Å; V63-Q67 WeakPolarHBondContact O-CB 3.27Å; V63-Q67 WeakPolarHBondContact O-CG 3.24Å; V63-Q67 PolarHBondContact O-N 3.45Å
64	L	53.5	Low	51.4	Low	90 Å²	90	100.3 Å²	100.3	47%	0.471	52%	0.515	S	S	.	.	H	α-helix	trans	-63.4	-44.6	176.6	-174.3	66.1	0	0	0	111.5	K60 L61 W66 Q67 I68	K60-L64 WeakPolarHBondContact O-CB 3.44Å; K60-L64 PolarHBondContact O-N 2.76Å; L61-L64 PolarHBondContact O-N 2.96Å; L64-W66 VanDerWaalsContact C-N 3.33Å; L64-W66 PolarHBondContact O-N 3.43Å; L64-Q67 PolarHBondContact O-N 2.87Å; L64-I68 HydrophobicContact CD1-CD1 4.44Å; L64-I68 HydrophobicContact CG-CD1 3.98Å; L64-I68 WeakPolarHBondContact O-CB 3.37Å; L64-I68 VanDerWaalsContact O-CG1 3.24Å; L64-I68 WeakPolarHBondContact O-CG1 3.42Å; L64-I68 PolarHBondContact O-N 2.93Å
65	E	51.8	Low	51.7	Low	121 Å²	121	95.9 Å²	95.9	57%	0.565	50%	0.504	S	S	*	.	H	α-helix	trans	-60.8	-41.2	174.4	-74.1	-174.5	170.2	0	0	112.1	L61 I68 R69	L61-E65 WeakPolarHBondContact O-CG 3.47Å; L61-E65 PolarHBondContact O-N 2.85Å; E65-I68 PolarHBondContact O-N 3.2Å; E65-R69 WeakPolarHBondContact O-CB 3.46Å; E65-R69 PolarHBondContact O-N 2.83Å
66	W	58.3	Low	52.3	Low	186 Å²	186	101.4 Å²	101.4	71%	0.705	52%	0.523	S	S	*	.	H	α-helix	trans	-66.3	-40.9	176.2	-169.9	86.4	0	0	0	111.8	G62 V63 L64 R69 A70	G62-W66 WeakPolarHBondContact O-CB 3.32Å; G62-W66 PolarHBondContact O-N 3.34Å; V63-W66 PolarHBondContact O-N 2.89Å; L64-W66 VanDerWaalsContact C-N 3.33Å; L64-W66 PolarHBondContact O-N 3.43Å; W66-R69 PolarHBondContact O-N 3.39Å; W66-A70 HydrophobicContact CE3-CB 4.5Å; W66-A70 HydrophobicContact CZ3-CB 4.49Å; W66-A70 VanDerWaalsContact O-CB 3.24Å; W66-A70 WeakPolarHBondContact O-CB 3.24Å; W66-A70 PolarHBondContact O-N 2.91Å
67	Q	54	Low	53	Low	84 Å²	84	103.4 Å²	103.4	39%	0.393	52%	0.52	S	S	.	.	H	α-helix	trans	-63.6	-43	174.4	-76.5	-178.9	-12	0	0	111.8	V63 L64 A70 A71	V63-Q67 HydrophobicContact CG1-CG 4.43Å; V63-Q67 WeakPolarHBondContact O-CB 3.27Å; V63-Q67 WeakPolarHBondContact O-CG 3.24Å; V63-Q67 PolarHBondContact O-N 3.45Å; L64-Q67 PolarHBondContact O-N 2.87Å; Q67-A70 PolarHBondContact O-N 3.33Å; Q67-A71 WeakPolarHBondContact O-CB 3.23Å; Q67-A71 PolarHBondContact O-N 2.9Å
68	I	56.5	Low	53.7	Low	107 Å²	107	102.3 Å²	102.3	55%	0.549	51%	0.509	S	S	.	.	H	α-helix	trans	-62.6	-43.4	174.8	-68.5	165.3	0	0	0	110.3	L64 E65 A71 S72	L64-I68 HydrophobicContact CD1-CD1 4.44Å; L64-I68 HydrophobicContact CG-CD1 3.98Å; L64-I68 WeakPolarHBondContact O-CB 3.37Å; L64-I68 VanDerWaalsContact O-CG1 3.24Å; L64-I68 WeakPolarHBondContact O-CG1 3.42Å; L64-I68 PolarHBondContact O-N 2.93Å; E65-I68 PolarHBondContact O-N 3.2Å; I68-A71 PolarHBondContact O-N 3.29Å; I68-S72 VanDerWaalsContact O-CB 3.24Å; I68-S72 WeakPolarHBondContact O-CB 3.49Å; I68-S72 PolarHBondContact O-N 3.46Å
69	R	55.4	Low	54.2	Low	187 Å²	187	99.5 Å²	99.5	71%	0.706	49%	0.494	S	S	*	.	H	α-helix	trans	-67	-42.6	178	-170.3	-179.7	-69.8	-151.9	0.2	112.2	E65 W66 S72 T73	E65-R69 WeakPolarHBondContact O-CB 3.46Å; E65-R69 PolarHBondContact O-N 2.83Å; W66-R69 PolarHBondContact O-N 3.39Å; R69-S72 PolarHBondContact O-N 3.4Å; R69-T73 WeakPolarHBondContact O-CB 3.35Å; R69-T73 PolarHBondContact O-N 3.42Å; R69-T73 PolarHBondContact O-OG1 3.33Å
70	A	54.8	Low	55.1	Low	26 Å²	26	96.8 Å²	96.8	22%	0.215	48%	0.483	C	S	.	.	H	α-helix	trans	-66.3	-40.4	176.1	0	0	0	0	0	111.3	W66 Q67 T73 K74	W66-A70 HydrophobicContact CE3-CB 4.5Å; W66-A70 HydrophobicContact CZ3-CB 4.49Å; W66-A70 VanDerWaalsContact O-CB 3.24Å; W66-A70 WeakPolarHBondContact O-CB 3.24Å; W66-A70 PolarHBondContact O-N 2.91Å; Q67-A70 PolarHBondContact O-N 3.33Å; A70-T73 PolarHBondContact O-N 3.24Å; A70-K74 WeakPolarHBondContact O-CB 3.44Å; A70-K74 VanDerWaalsContact O-CG 3.3Å; A70-K74 WeakPolarHBondContact O-CG 3.23Å; A70-K74 PolarHBondContact O-N 2.94Å
71	A	51.4	Low	55.8	Low	48 Å²	48	97.9 Å²	97.9	40%	0.397	49%	0.485	S	S	.	.	H	α-helix	trans	-64.6	-42.5	172.9	0	0	0	0	0	111.1	Q67 I68 T73 K74 S75	Q67-A71 WeakPolarHBondContact O-CB 3.23Å; Q67-A71 PolarHBondContact O-N 2.9Å; I68-A71 PolarHBondContact O-N 3.29Å; A71-T73 VanDerWaalsContact C-N 3.33Å; A71-T73 PolarHBondContact O-N 3.32Å; A71-K74 PolarHBondContact O-N 3.45Å; A71-S75 WeakPolarHBondContact O-CB 3.31Å; A71-S75 PolarHBondContact O-N 2.96Å; A71-S75 PolarHBondContact O-OG 3.38Å
72	S	54.2	Low	56.3	Low	73 Å²	73	97.9 Å²	97.9	51%	0.51	49%	0.485	S	S	.	.	H	α-helix	trans	-62	-40.9	175.3	179.2	0	0	0	0	111.6	I68 R69 S75 Y76	I68-S72 VanDerWaalsContact O-CB 3.24Å; I68-S72 WeakPolarHBondContact O-CB 3.49Å; I68-S72 PolarHBondContact O-N 3.46Å; R69-S72 PolarHBondContact O-N 3.4Å; S72-S75 PolarHBondContact O-N 3.21Å; S72-Y76 VanDerWaalsContact O-CB 3.23Å; S72-Y76 WeakPolarHBondContact O-CB 3.43Å; S72-Y76 PolarHBondContact O-N 3.02Å
73	T	54.9	Low	57	Low	72 Å²	72	99.8 Å²	99.8	44%	0.442	49%	0.486	S	S	.	.	H	α-helix	trans	-67.6	-39.6	175.9	-49.2	0	0	0	0	111.1	R69 A70 A71 Y76 N77	R69-T73 WeakPolarHBondContact O-CB 3.35Å; R69-T73 PolarHBondContact O-N 3.42Å; R69-T73 PolarHBondContact O-OG1 3.33Å; A70-T73 PolarHBondContact O-N 3.24Å; A71-T73 VanDerWaalsContact C-N 3.33Å; A71-T73 PolarHBondContact O-N 3.32Å; T73-Y76 PolarHBondContact O-N 3.03Å; T73-N77 WeakPolarHBondContact O-CB 3.25Å; T73-N77 PolarHBondContact O-N 3.05Å; T73-N77 PolarHBondContact O-ND2 3.4Å
74	K	56.5	Low	57.5	Low	138 Å²	138	103.7 Å²	103.7	60%	0.6	50%	0.503	S	S	*	.	H	α-helix	trans	-63.9	-45.8	173	-75.6	177.3	-178.1	-178.5	0	111.5	A70 A71 N77 I78	A70-K74 WeakPolarHBondContact O-CB 3.44Å; A70-K74 VanDerWaalsContact O-CG 3.3Å; A70-K74 WeakPolarHBondContact O-CG 3.23Å; A70-K74 PolarHBondContact O-N 2.94Å; A71-K74 PolarHBondContact O-N 3.45Å; K74-N77 PolarHBondContact O-N 3.04Å; K74-I78 WeakPolarHBondContact O-CB 3.4Å; K74-I78 WeakPolarHBondContact O-CD1 3.32Å; K74-I78 WeakPolarHBondContact O-CG1 3.4Å; K74-I78 PolarHBondContact O-N 3.26Å
75	S	56.5	Low	58	Low	73 Å²	73	103.4 Å²	103.4	51%	0.51	50%	0.502	S	S	.	.	H	α-helix	trans	-63.8	-40.3	176.9	-61.8	0	0	0	0	111.8	A71 S72 I78 Y79	A71-S75 WeakPolarHBondContact O-CB 3.31Å; A71-S75 PolarHBondContact O-N 2.96Å; A71-S75 PolarHBondContact O-OG 3.38Å; S72-S75 PolarHBondContact O-N 3.21Å; S75-I78 PolarHBondContact O-N 3.19Å; S75-Y79 WeakPolarHBondContact O-CB 3.44Å; S75-Y79 PolarHBondContact O-N 3.26Å
76	Y	56.8	Low	58.6	Low	141 Å²	141	100.1 Å²	100.1	55%	0.553	49%	0.492	S	S	*	.	H	α-helix	trans	-65.1	-45.4	174.9	-173.6	-98.4	0	0	0	111.4	S72 T73 I78 Y79 I80	S72-Y76 VanDerWaalsContact O-CB 3.23Å; S72-Y76 WeakPolarHBondContact O-CB 3.43Å; S72-Y76 PolarHBondContact O-N 3.02Å; T73-Y76 PolarHBondContact O-N 3.03Å; Y76-I78 VanDerWaalsContact C-N 3.32Å; Y76-I78 PolarHBondContact O-N 3.41Å; Y76-Y79 WeakPolarHBondContact O-CB 3.31Å; Y76-Y79 PolarHBondContact O-N 3.04Å; Y76-I80 HydrophobicContact CD1-CG1 4.06Å; Y76-I80 HydrophobicContact CE1-CD1 4.19Å; Y76-I80 HydrophobicContact CE1-CG1 3.72Å; Y76-I80 VanDerWaalsContact O-CG1 3.32Å; Y76-I80 WeakPolarHBondContact O-CG1 3.49Å; Y76-I80 PolarHBondContact O-N 3.37Å
77	N	57.7	Low	59	Low	96 Å²	96	94.9 Å²	94.9	51%	0.513	48%	0.478	S	S	.	.	H	α-helix	trans	-63.9	-38.1	175.8	-73.1	-21.1	0	0	0	112	T73 K74 Y81	T73-N77 WeakPolarHBondContact O-CB 3.25Å; T73-N77 PolarHBondContact O-N 3.05Å; T73-N77 PolarHBondContact O-ND2 3.4Å; K74-N77 PolarHBondContact O-N 3.04Å; N77-Y81 VanDerWaalsContact O-CB 3.27Å; N77-Y81 WeakPolarHBondContact O-CB 3.42Å; N77-Y81 PolarHBondContact O-N 3.07Å
78	I	61.2	Low	59.6	Low	102 Å²	102	95.5 Å²	95.5	52%	0.523	48%	0.483	S	S	.	.	H	α-helix	trans	-64.5	-44.4	173.3	-69.8	163	0	0	0	110.4	K74 S75 Y76 Y81 L82	K74-I78 WeakPolarHBondContact O-CB 3.4Å; K74-I78 WeakPolarHBondContact O-CD1 3.32Å; K74-I78 WeakPolarHBondContact O-CG1 3.4Å; K74-I78 PolarHBondContact O-N 3.26Å; S75-I78 PolarHBondContact O-N 3.19Å; Y76-I78 VanDerWaalsContact C-N 3.32Å; Y76-I78 PolarHBondContact O-N 3.41Å; I78-Y81 PolarHBondContact O-N 2.96Å; I78-L82 HydrophobicContact CG2-CD1 3.93Å; I78-L82 HydrophobicContact CG2-CG 4.35Å; I78-L82 WeakPolarHBondContact O-CB 3.41Å; I78-L82 WeakPolarHBondContact O-CG 3.35Å; I78-L82 PolarHBondContact O-N 2.98Å
79	Y	59.3	Low	60	Low	139 Å²	139	93.3 Å²	93.3	55%	0.545	47%	0.474	S	S	.	.	H	α-helix	trans	-59.5	-48.8	176.6	174.1	-98.4	0	0	0	111.7	S75 Y76 Y81 L82 L83	S75-Y79 WeakPolarHBondContact O-CB 3.44Å; S75-Y79 PolarHBondContact O-N 3.26Å; Y76-Y79 WeakPolarHBondContact O-CB 3.31Å; Y76-Y79 PolarHBondContact O-N 3.04Å; Y79-Y81 VanDerWaalsContact C-N 3.31Å; Y79-Y81 PolarHBondContact O-N 2.86Å; Y79-L82 PolarHBondContact O-N 3.49Å; Y79-L83 WeakPolarHBondContact O-CB 3.43Å; Y79-L83 PolarHBondContact O-N 3.41Å
80	I	64	Low	60.6	Low	63 Å²	63	90 Å²	90	32%	0.323	47%	0.465	S	S	.	.	H	α-helix	trans	-60.3	-42.2	175.7	-65.9	-64.9	0	0	0	110.8	Y76 L83 M84	Y76-I80 HydrophobicContact CD1-CG1 4.06Å; Y76-I80 HydrophobicContact CE1-CD1 4.19Å; Y76-I80 HydrophobicContact CE1-CG1 3.72Å; Y76-I80 VanDerWaalsContact O-CG1 3.32Å; Y76-I80 WeakPolarHBondContact O-CG1 3.49Å; Y76-I80 PolarHBondContact O-N 3.37Å; I80-L83 PolarHBondContact O-N 3.45Å; I80-M84 HydrophobicContact CG2-CG 4.41Å; I80-M84 WeakPolarHBondContact O-CB 3.17Å; I80-M84 VanDerWaalsContact O-CG 3.23Å; I80-M84 WeakPolarHBondContact O-CG 3.34Å; I80-M84 PolarHBondContact O-N 3.23Å
81	Y	59.6	Low	61.2	Low	134 Å²	134	94 Å²	94	53%	0.525	48%	0.483	S	S	.	.	H	α-helix	trans	-63.1	-44.2	177.7	-173.2	-95.7	0	0	0	112.3	N77 I78 Y79 M84 L85	N77-Y81 VanDerWaalsContact O-CB 3.27Å; N77-Y81 WeakPolarHBondContact O-CB 3.42Å; N77-Y81 PolarHBondContact O-N 3.07Å; I78-Y81 PolarHBondContact O-N 2.96Å; Y79-Y81 VanDerWaalsContact C-N 3.31Å; Y79-Y81 PolarHBondContact O-N 2.86Å; Y81-M84 PolarHBondContact O-N 2.88Å; Y81-L85 WeakPolarHBondContact O-CB 3.32Å; Y81-L85 PolarHBondContact O-N 3.29Å
82	L	60.7	Low	61.6	Low	102 Å²	102	97.3 Å²	97.3	53%	0.534	49%	0.493	S	S	.	.	H	α-helix	trans	-64.5	-38.9	175.9	-72.2	171.5	0	0	0	112	I78 Y79 L85 S86	I78-L82 HydrophobicContact CG2-CD1 3.93Å; I78-L82 HydrophobicContact CG2-CG 4.35Å; I78-L82 WeakPolarHBondContact O-CB 3.41Å; I78-L82 WeakPolarHBondContact O-CG 3.35Å; I78-L82 PolarHBondContact O-N 2.98Å; Y79-L82 PolarHBondContact O-N 3.49Å; L82-L85 PolarHBondContact O-N 2.97Å; L82-S86 WeakPolarHBondContact O-CB 3.39Å; L82-S86 PolarHBondContact O-N 3.34Å
83	L	65.3	Low	62.1	Low	79 Å²	79	100.9 Å²	100.9	41%	0.414	50%	0.503	S	S	.	.	H	α-helix	trans	-63.6	-45.6	176.4	-168.3	73.6	0	0	0	111.2	Y79 I80 S86 N87	Y79-L83 WeakPolarHBondContact O-CB 3.43Å; Y79-L83 PolarHBondContact O-N 3.41Å; I80-L83 PolarHBondContact O-N 3.45Å; L83-S86 PolarHBondContact O-N 2.97Å; L83-N87 PolarHBondContact O-N 3.47Å; L83-N87 PolarHBondContact O-ND2 2.87Å
84	M	66	Low	62.1	Low	116 Å²	116	105.9 Å²	105.9	57%	0.571	52%	0.519	S	S	*	.	H	α-helix	trans	-61.1	-44.8	175.3	-70	-73	-86.3	0	0	111.3	I80 Y81 S86 N87 I88	I80-M84 HydrophobicContact CG2-CG 4.41Å; I80-M84 WeakPolarHBondContact O-CB 3.17Å; I80-M84 VanDerWaalsContact O-CG 3.23Å; I80-M84 WeakPolarHBondContact O-CG 3.34Å; I80-M84 PolarHBondContact O-N 3.23Å; Y81-M84 PolarHBondContact O-N 2.88Å; M84-S86 VanDerWaalsContact C-N 3.34Å; M84-S86 PolarHBondContact O-N 2.98Å; M84-N87 PolarHBondContact O-N 3.45Å; M84-I88 VanDerWaalsContact O-CG1 3.31Å; M84-I88 WeakPolarHBondContact O-CG1 3.43Å; M84-I88 PolarHBondContact O-N 3.33Å
85	L	63.5	Low	61.7	Low	85 Å²	85	109.1 Å²	109.1	45%	0.445	54%	0.542	S	S	.	.	H	α-helix	trans	-61.2	-42.9	176.6	-159.6	87.8	0	0	0	111.6	Y81 L82 N87 I88 V89	Y81-L85 WeakPolarHBondContact O-CB 3.32Å; Y81-L85 PolarHBondContact O-N 3.29Å; L82-L85 PolarHBondContact O-N 2.97Å; L85-N87 PolarHBondContact O-N 3.38Å; L85-I88 PolarHBondContact O-N 3.13Å; L85-V89 WeakPolarHBondContact O-CG2 3.44Å; L85-V89 PolarHBondContact O-N 3.25Å
86	S	63.1	Low	62	Low	51 Å²	51	110.9 Å²	110.9	36%	0.357	54%	0.543	S	S	.	.	H	α-helix	trans	-61.3	-42.5	177.8	-174.7	0	0	0	0	112.1	L82 L83 M84 V89 K90	L82-S86 WeakPolarHBondContact O-CB 3.39Å; L82-S86 PolarHBondContact O-N 3.34Å; L83-S86 PolarHBondContact O-N 2.97Å; M84-S86 VanDerWaalsContact C-N 3.34Å; M84-S86 PolarHBondContact O-N 2.98Å; S86-V89 PolarHBondContact O-N 3.38Å; S86-K90 WeakPolarHBondContact O-CG 3.31Å; S86-K90 PolarHBondContact O-N 3.47Å
87	N	67.9	Low	62.2	Low	76 Å²	76	109.3 Å²	109.3	41%	0.406	54%	0.543	S	S	.	.	H	α-helix	trans	-65.9	-42.2	177.4	-70.7	-23.7	0	0	0	111.9	L83 M84 L85 V89 K90 D91	L83-N87 PolarHBondContact O-N 3.47Å; L83-N87 PolarHBondContact O-ND2 2.87Å; M84-N87 PolarHBondContact O-N 3.45Å; L85-N87 PolarHBondContact O-N 3.38Å; N87-V89 PolarHBondContact O-N 3Å; N87-K90 PolarHBondContact O-N 3.32Å; N87-D91 PolarHBondContact O-N 2.94Å
88	I	66.6	Low	62.5	Low	97 Å²	97	110.1 Å²	110.1	50%	0.497	55%	0.545	S	S	.	.	H	α-helix	trans	-60.9	-44.2	175.7	-67.2	165.6	0	0	0	111.2	M84 L85 D91 L92	M84-I88 VanDerWaalsContact O-CG1 3.31Å; M84-I88 WeakPolarHBondContact O-CG1 3.43Å; M84-I88 PolarHBondContact O-N 3.33Å; L85-I88 PolarHBondContact O-N 3.13Å; I88-D91 PolarHBondContact O-N 3.18Å; I88-L92 HydrophobicContact CG2-CD1 4.03Å; I88-L92 WeakPolarHBondContact O-CG 3.47Å; I88-L92 PolarHBondContact O-N 2.93Å
89	V	65.5	Low	62.6	Low	62 Å²	62	110.5 Å²	110.5	38%	0.376	55%	0.546	S	S	.	.	H	α-helix	trans	-64.6	-40.5	178	172.6	0	0	0	0	111.2	L85 S86 N87 L92 M93	L85-V89 WeakPolarHBondContact O-CG2 3.44Å; L85-V89 PolarHBondContact O-N 3.25Å; S86-V89 PolarHBondContact O-N 3.38Å; N87-V89 PolarHBondContact O-N 3Å; V89-L92 PolarHBondContact O-N 3.27Å; V89-M93 HydrophobicContact CG1-CE 3.76Å; V89-M93 HydrophobicContact CG1-CG 4.48Å; V89-M93 HydrophobicContact CG1-SD 4.17Å; V89-M93 WeakPolarHBondContact O-CG 3.25Å; V89-M93 PolarHBondContact O-N 3.22Å
90	K	66.7	Low	62.8	Low	118 Å²	118	108.8 Å²	108.8	51%	0.513	55%	0.546	S	S	.	.	H	α-helix	trans	-62.9	-40.1	175.4	-76.6	176.1	-179.1	177.1	0	112.4	S86 N87 M93 K94	S86-K90 WeakPolarHBondContact O-CG 3.31Å; S86-K90 PolarHBondContact O-N 3.47Å; N87-K90 PolarHBondContact O-N 3.32Å; K90-M93 PolarHBondContact O-N 3.32Å; K90-K94 WeakPolarHBondContact O-CG 3.39Å; K90-K94 PolarHBondContact O-N 2.93Å
91	D	67.3	Low	62.7	Low	109 Å²	109	111.8 Å²	111.8	58%	0.583	56%	0.561	S	S	*	*	H	α-helix	trans	-68.4	-38	176.8	-78.6	-8.7	0	0	0	111.6	N87 I88 K94	N87-D91 PolarHBondContact O-N 2.94Å; I88-D91 PolarHBondContact O-N 3.18Å; D91-K94 PolarHBondContact O-N 3.39Å
92	L	60.3	Low	62.9	Low	117 Å²	117	110.2 Å²	110.2	61%	0.613	56%	0.563	S	S	*	*	H	α-helix	trans	-66.6	-34	174.7	-76.7	168.2	0	0	0	113.3	I88 V89 K94	I88-L92 HydrophobicContact CG2-CD1 4.03Å; I88-L92 WeakPolarHBondContact O-CG 3.47Å; I88-L92 PolarHBondContact O-N 2.93Å; V89-L92 PolarHBondContact O-N 3.27Å; L92-K94 VanDerWaalsContact C-N 3.31Å
93	M	63.8	Low	63.1	Low	148 Å²	148	110.8 Å²	110.8	73%	0.729	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79	-11.5	178.2	-73.4	-177.7	177.8	0	0	113.9	V89 K90	V89-M93 HydrophobicContact CG1-CE 3.76Å; V89-M93 HydrophobicContact CG1-CG 4.48Å; V89-M93 HydrophobicContact CG1-SD 4.17Å; V89-M93 WeakPolarHBondContact O-CG 3.25Å; V89-M93 PolarHBondContact O-N 3.22Å; K90-M93 PolarHBondContact O-N 3.32Å
94	K	56.4	Low	62.9	Low	178 Å²	178	113.5 Å²	113.5	77%	0.774	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.1	4.8	176.5	-76.3	-178.9	177.8	-177.8	0	113.4	K90 D91 L92	K90-K94 WeakPolarHBondContact O-CG 3.39Å; K90-K94 PolarHBondContact O-N 2.93Å; D91-K94 PolarHBondContact O-N 3.39Å; L92-K94 VanDerWaalsContact C-N 3.31Å
95	L	47.4	Very low	62.6	Low	205 Å²	205	113.3 Å²	113.3	100%	1.073	58%	0.579	S	S	*	*			trans	-108.2	0	173.1	-88.4	150.7	0	0	0	109.7

Retrieved 95 of 95 residues in 40.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).