X2JL00_DROME Loading...

Uncoupling protein 4A, isoform C

AlphaFold DB , UniProt , Accession X2JL00, Species DROME (Drosophila melanogaster, Fruit fly), Gene Ucp4A, Length 128 aa.

						>X2JL00_DROME|X2JL00|Ucp4A
MAAKTDESSPAVASSTSSNPAPSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNRCEDLQLRPDAQGVHTERHPGSAGLEVGAVRRHGRSRCPVACLAR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	33.1	Very low	34.4	Very low	246 Å²	246	135.6 Å²	135.6	100%	1.212	82%	0.815	S	S	*	*				0	123.4	0	-74.1	-173.7	173.6	0	0	108.2
2	A	33.6	Very low	34.2	Very low	107 Å²	107	135.7 Å²	135.7	88%	0.884	82%	0.816	S	S	*	*			trans	46	136.7	160.8	0	0	0	0	0	119.3
3	A	32.7	Very low	34.2	Very low	88 Å²	88	132.5 Å²	132.5	73%	0.727	81%	0.813	S	S	*	*			cis	-157.3	146.9	28.4	0	0	0	0	0	108
4	K	33.4	Very low	34.5	Very low	190 Å²	190	130.7 Å²	130.7	83%	0.826	81%	0.808	S	S	*	*				48.4	113.5	59.3	-153	135.5	170.4	172.6	0	109.4
5	T	37	Very low	34.9	Very low	118 Å²	118	129.7 Å²	129.7	72%	0.724	81%	0.808	S	S	*	*				179.9	131.1	63.8	-14.3	0	0	0	0	105
6	D	39.7	Very low	34.8	Very low	146 Å²	146	130.1 Å²	130.1	78%	0.781	81%	0.81	S	S	*	*				52.9	110.5	111.5	-159.7	-94.8	0	0	0	115.4
7	E	33.1	Very low	35.2	Very low	181 Å²	181	128.7 Å²	128.7	85%	0.846	81%	0.806	S	S	*	*			trans	-167.5	111	138.1	-163.8	134	71.7	0	0	111.3
8	S	29.1	Very low	35.9	Very low	105 Å²	105	127.2 Å²	127.2	73%	0.734	80%	0.801	S	S	*	*			trans	46	114.2	139.6	-161.2	0	0	0	0	121.1
9	S	34.6	Very low	36.2	Very low	101 Å²	101	129 Å²	129	71%	0.706	80%	0.804	S	S	*	*			trans	-30.3	167.7	143.3	-77.6	0	0	0	0	116.3
10	P	42.7	Very low	37.1	Very low	121 Å²	121	128.2 Å²	128.2	79%	0.786	80%	0.8	S	S	*	*			cis	-135.5	136.7	26.9	20.6	6	0	0	0	116
11	A	29.4	Very low	37.4	Very low	89 Å²	89	126.6 Å²	126.6	74%	0.736	80%	0.799	S	S	*	*				82.8	78.7	83.7	0	0	0	0	0	113.3
12	V	31.6	Very low	38.3	Very low	136 Å²	136	120.2 Å²	120.2	82%	0.824	78%	0.777	S	S	*	*			trans	-86.1	102.3	155.6	-70.3	0	0	0	0	107	S14	V12-S14 PolarHBondContact O-N 3.13Å
13	A	35	Very low	38.8	Very low	94 Å²	94	120.1 Å²	120.1	78%	0.777	77%	0.77	S	S	*	*			trans	-85.2	91	178.5	0	0	0	0	0	109.7
14	S	37.9	Very low	39.1	Very low	108 Å²	108	121.8 Å²	121.8	76%	0.755	78%	0.776	S	S	*	*			trans	-79.9	117.5	159.9	-18.8	0	0	0	0	107.6	V12	V12-S14 PolarHBondContact O-N 3.13Å
15	S	40	Very low	39.6	Very low	115 Å²	115	116.3 Å²	116.3	80%	0.804	77%	0.773	S	S	*	*			trans	-107.9	100.8	177.8	-51.9	0	0	0	0	110.1
16	T	34.3	Very low	40.1	Very low	137 Å²	137	122 Å²	122	84%	0.84	78%	0.781	S	S	*	*			trans	-130.4	136.5	162.5	-45.1	0	0	0	0	108.2
17	S	41.3	Very low	40.2	Very low	106 Å²	106	123.5 Å²	123.5	74%	0.741	78%	0.783	S	S	*	*			trans	94.8	116.6	155.4	-171.2	0	0	0	0	120.2
18	S	47.2	Very low	41	Very low	101 Å²	101	123.9 Å²	123.9	71%	0.706	79%	0.785	S	S	*	*			trans	-24	152.7	150.6	48.5	0	0	0	0	121.8
19	N	42.8	Very low	42	Very low	162 Å²	162	125.9 Å²	125.9	87%	0.866	79%	0.787	S	S	*	*			trans	107.8	144.5	147.7	-97.3	6.5	0	0	0	121
20	P	54.3	Low	42.3	Very low	112 Å²	112	131.8 Å²	131.8	73%	0.727	79%	0.794	S	S	*	*			trans	-117.6	155.2	-146.1	39.4	-25.8	0	0	0	118.2
21	A	42.3	Very low	43	Very low	95 Å²	95	131.5 Å²	131.5	79%	0.785	79%	0.791	S	S	*	*			trans	73.3	159.7	151.1	0	0	0	0	0	119.7
22	P	52.8	Low	44.3	Very low	113 Å²	113	132.7 Å²	132.7	73%	0.734	79%	0.789	S	S	*	*			cis	-140.1	166	5.8	38.4	-18.2	0	0	0	118.6
23	S	42.9	Very low	45.3	Very low	105 Å²	105	134.4 Å²	134.4	73%	0.734	79%	0.786	S	S	*	*			trans	75.6	112	143.2	70.5	0	0	0	0	122.5
24	S	40	Very low	46.3	Very low	122 Å²	122	137.1 Å²	137.1	85%	0.853	78%	0.78	S	S	*	*				167.5	120.8	113.4	-83.5	0	0	0	0	113.8
25	G	44.1	Very low	47.4	Very low	75 Å²	75	138.2 Å²	138.2	77%	0.773	78%	0.778	S	S	*	*			trans	83.3	95	134.8	0	0	0	0	0	121.6
26	R	47.6	Very low	48.3	Very low	238 Å²	238	140.6 Å²	140.6	90%	0.898	77%	0.77	S	S	*	*			trans	62.5	80.7	140.1	-63.7	-175.8	-174.4	150.1	1.3	119.8
27	H	42	Very low	49.4	Very low	177 Å²	177	136.6 Å²	136.6	82%	0.819	75%	0.751	S	S	*	*				-160.3	100.3	119.2	-107.1	85.4	0	0	0	107.2	L29	H27-L29 VanDerWaalsContact C-N 3.25Å; H27-L29 PolarHBondContact O-N 3.38Å
28	Q	48.4	Very low	50.2	Low	190 Å²	190	138.7 Å²	138.7	89%	0.888	75%	0.754	S	S	*	*			trans	-73.5	76.2	179.4	-69.7	-83	75.8	0	0	109.7	R30	Q28-R30 PolarHBondContact O-N 3.16Å
29	L	50.8	Low	51.5	Low	146 Å²	146	136.5 Å²	136.5	76%	0.764	74%	0.738	S	S	*	*			trans	-74.8	114.6	152.1	-74.2	106.3	0	0	0	106	H27 P31	H27-L29 VanDerWaalsContact C-N 3.25Å; H27-L29 PolarHBondContact O-N 3.38Å; L29-P31 WeakPolarHBondContact O-CD 3.23Å; L29-P31 VanDerWaalsContact O-N 3.14Å
30	R	40.8	Very low	53.2	Low	226 Å²	226	137.6 Å²	137.6	85%	0.853	74%	0.736	S	S	*	*			trans	-39.3	121.8	172	-77.9	-83.2	-153.8	173.5	5.1	108.6	Q28 V32	Q28-R30 PolarHBondContact O-N 3.16Å; R30-V32 VanDerWaalsContact C-N 3.26Å; R30-V32 PolarHBondContact O-N 3.14Å
31	P	57.4	Low	54.3	Low	114 Å²	114	134.9 Å²	134.9	74%	0.74	72%	0.723	S	S	*	*			trans	-62.9	99.9	165.3	-12.4	26.4	0	0	0	105.3	L29 K33	L29-P31 WeakPolarHBondContact O-CD 3.23Å; L29-P31 VanDerWaalsContact O-N 3.14Å; P31-K33 VanDerWaalsContact C-N 3.31Å; P31-K33 PolarHBondContact O-N 2.83Å
32	V	55.8	Low	55.9	Low	114 Å²	114	130.7 Å²	130.7	69%	0.691	69%	0.688	S	S	*	*			trans	-60.5	108.3	165.3	-172.8	0	0	0	0	102.7	R30 F34	R30-V32 VanDerWaalsContact C-N 3.26Å; R30-V32 PolarHBondContact O-N 3.14Å; V32-F34 HydrophobicContact CB-CD2 4.47Å; V32-F34 HydrophobicContact CG1-CD2 4.41Å; V32-F34 HydrophobicContact CG1-CE2 4.37Å; V32-F34 PolarHBondContact O-N 3.29Å
33	K	54.4	Low	57.3	Low	173 Å²	173	128.4 Å²	128.4	75%	0.752	67%	0.672	S	S	*	*			trans	-57.9	91.4	-179.3	-75.6	-169	176.1	82.1	0	108.1	P31 D35	P31-K33 VanDerWaalsContact C-N 3.31Å; P31-K33 PolarHBondContact O-N 2.83Å; K33-D35 WeakPolarHBondContact CB-OD2 2.95Å; K33-D35 WeakPolarHBondContact CD-OD2 3.44Å; K33-D35 PolarHBondContact O-N 2.97Å
34	F	55.6	Low	59.4	Low	151 Å²	151	131.3 Å²	131.3	66%	0.662	67%	0.668	S	S	*	*			trans	-81.5	61.3	164.3	-94.6	-84.9	0	0	0	107.3	V32 Y36 A37	V32-F34 HydrophobicContact CB-CD2 4.47Å; V32-F34 HydrophobicContact CG1-CD2 4.41Å; V32-F34 HydrophobicContact CG1-CE2 4.37Å; V32-F34 PolarHBondContact O-N 3.29Å; F34-Y36 PolarHBondContact O-N 3.17Å; F34-A37 HydrophobicContact CB-CB 3.92Å; F34-A37 HydrophobicContact CD1-CB 4.35Å; F34-A37 PolarHBondContact O-N 3.44Å
35	D	60.6	Low	61.7	Low	131 Å²	131	129.7 Å²	129.7	70%	0.701	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62	-9.6	173.6	-94.3	-77.7	0	0	0	112	K33	K33-D35 WeakPolarHBondContact CB-OD2 2.95Å; K33-D35 WeakPolarHBondContact CD-OD2 3.44Å; K33-D35 PolarHBondContact O-N 2.97Å
36	Y	58.4	Low	63.6	Low	165 Å²	165	130.9 Å²	130.9	65%	0.647	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.3	-32.7	171.1	-169.6	-108.3	0	0	0	112.9	F34 D38 S39 C42	F34-Y36 PolarHBondContact O-N 3.17Å; Y36-D38 VanDerWaalsContact C-N 3.29Å; Y36-D38 PolarHBondContact O-N 3.43Å; Y36-S39 PolarHBondContact O-N 2.86Å; Y36-C42 HydrophobicContact CD1-CB 4.05Å; Y36-C42 WeakPolarHBondContact CD1-SG 3.28Å; Y36-C42 HydrophobicContact CE1-CB 3.92Å; Y36-C42 WeakPolarHBondContact CE1-SG 3.48Å; Y36-C42 WeakPolarHBondContact CE2-SG 3.25Å; Y36-C42 WeakPolarHBondContact O-CB 2.95Å; Y36-C42 PolarHBondContact O-SG 2.82Å
37	A	58	Low	65.5	Low	52 Å²	52	123.1 Å²	123.1	43%	0.43	62%	0.623	S	S	.	*	T	Hydrogen-bonded Turn	trans	-74.2	-17.8	-171.3	0	0	0	0	0	114	F34 T43	F34-A37 HydrophobicContact CB-CB 3.92Å; F34-A37 HydrophobicContact CD1-CB 4.35Å; F34-A37 PolarHBondContact O-N 3.44Å; A37-T43 WeakPolarHBondContact O-CG2 3.33Å
38	D	58	Low	67.6	Low	150 Å²	150	117.8 Å²	117.8	80%	0.802	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.4	-4.5	177.9	-158.7	42.1	0	0	0	113	Y36	Y36-D38 VanDerWaalsContact C-N 3.29Å; Y36-D38 PolarHBondContact O-N 3.43Å
39	S	73.8	Confident	69.5	Low	55 Å²	55	112.4 Å²	112.4	39%	0.385	58%	0.583	S	S	.	*	S	Bend	trans	-76	130	174.4	175.3	0	0	0	0	110.5	Y36 A41 C42 T43	Y36-S39 PolarHBondContact O-N 2.86Å; S39-A41 PolarHBondContact O-N 3.46Å; S39-C42 WeakPolarHBondContact O-CA 3.43Å; S39-C42 WeakPolarHBondContact O-CB 3.46Å; S39-C42 PolarHBondContact O-N 2.78Å; S39-T43 PolarHBondContact O-N 2.85Å; S39-T43 VanDerWaalsContact O-N 3.15Å
40	F	79.4	Confident	71.1	Confident	185 Å²	185	108.1 Å²	108.1	81%	0.811	57%	0.568	S	S	*	*	H	α-helix	trans	-50.7	-34.1	177.5	-73.3	-76	0	0	0	113.3	C42 T43 Y44	F40-C42 VanDerWaalsContact C-N 3.33Å; F40-T43 WeakPolarHBondContact CA-OG1 3.46Å; F40-T43 PolarHBondContact O-OG1 2.91Å; F40-Y44 VanDerWaalsContact O-CB 3.27Å; F40-Y44 WeakPolarHBondContact O-CB 3.47Å; F40-Y44 PolarHBondContact O-N 3.46Å
41	A	77.3	Confident	72.9	Confident	55 Å²	55	99.7 Å²	99.7	46%	0.455	55%	0.547	S	S	.	.	H	α-helix	trans	-65.7	-37.4	176.5	0	0	0	0	0	111.9	S39 Y44 I45	S39-A41 PolarHBondContact O-N 3.46Å; A41-Y44 PolarHBondContact O-N 3.16Å; A41-I45 WeakPolarHBondContact O-CB 3.39Å; A41-I45 WeakPolarHBondContact O-CD1 3.38Å; A41-I45 WeakPolarHBondContact O-CG1 3.18Å; A41-I45 PolarHBondContact O-N 2.87Å
42	C	76.5	Confident	74.1	Confident	7 Å²	7	96.9 Å²	96.9	5%	0.047	53%	0.53	C	S	.	.	H	α-helix	trans	-76.2	-43	-176.1	-55.3	0	0	0	0	110.9	Y36 S39 F40 Y44 I45 V46	Y36-C42 HydrophobicContact CD1-CB 4.05Å; Y36-C42 WeakPolarHBondContact CD1-SG 3.28Å; Y36-C42 HydrophobicContact CE1-CB 3.92Å; Y36-C42 WeakPolarHBondContact CE1-SG 3.48Å; Y36-C42 WeakPolarHBondContact CE2-SG 3.25Å; Y36-C42 WeakPolarHBondContact O-CB 2.95Å; Y36-C42 PolarHBondContact O-SG 2.82Å; S39-C42 WeakPolarHBondContact O-CA 3.43Å; S39-C42 WeakPolarHBondContact O-CB 3.46Å; S39-C42 PolarHBondContact O-N 2.78Å; F40-C42 VanDerWaalsContact C-N 3.33Å; C42-Y44 VanDerWaalsContact C-N 3.26Å; C42-Y44 PolarHBondContact O-N 3.41Å; C42-I45 PolarHBondContact O-N 3.18Å; C42-V46 WeakPolarHBondContact O-CB 3.39Å; C42-V46 VanDerWaalsContact O-CG2 3.24Å; C42-V46 WeakPolarHBondContact O-CG2 3.16Å; C42-V46 PolarHBondContact O-N 3.12Å
43	T	82.4	Confident	75.3	Confident	66 Å²	66	96.5 Å²	96.5	41%	0.405	52%	0.523	S	S	.	.	H	α-helix	trans	-60.9	-38.5	172.2	56.2	0	0	0	0	111.3	A37 S39 F40 S47	A37-T43 WeakPolarHBondContact O-CG2 3.33Å; S39-T43 PolarHBondContact O-N 2.85Å; S39-T43 VanDerWaalsContact O-N 3.15Å; F40-T43 WeakPolarHBondContact CA-OG1 3.46Å; F40-T43 PolarHBondContact O-OG1 2.91Å; T43-S47 VanDerWaalsContact O-CB 3.29Å; T43-S47 WeakPolarHBondContact O-CB 3.27Å; T43-S47 PolarHBondContact O-N 3.08Å; T43-S47 PolarHBondContact O-OG 2.64Å
44	Y	86.1	Confident	76.5	Confident	165 Å²	165	90.7 Å²	90.7	65%	0.647	51%	0.507	S	S	*	.	H	α-helix	trans	-64.5	-51	176.3	-177.8	-99.2	0	0	0	111.9	F40 A41 C42 V46 S47 V48	F40-Y44 VanDerWaalsContact O-CB 3.27Å; F40-Y44 WeakPolarHBondContact O-CB 3.47Å; F40-Y44 PolarHBondContact O-N 3.46Å; A41-Y44 PolarHBondContact O-N 3.16Å; C42-Y44 VanDerWaalsContact C-N 3.26Å; C42-Y44 PolarHBondContact O-N 3.41Å; Y44-V46 PolarHBondContact O-N 3.48Å; Y44-S47 WeakPolarHBondContact O-CB 3.33Å; Y44-S47 PolarHBondContact O-N 3.43Å; Y44-V48 HydrophobicContact CD1-CG2 4.34Å; Y44-V48 HydrophobicContact CE1-CG2 3.98Å; Y44-V48 HydrophobicContact CE2-CG2 4.38Å; Y44-V48 WeakPolarHBondContact O-CG2 2.8Å; Y44-V48 PolarHBondContact O-N 3.4Å
45	I	88.3	Confident	77.4	Confident	89 Å²	89	88 Å²	88	46%	0.456	50%	0.497	S	S	.	.	H	α-helix	trans	-61.5	-46.2	-179.9	-68	163.7	0	0	0	110.8	A41 C42 S47 V48 V49	A41-I45 WeakPolarHBondContact O-CB 3.39Å; A41-I45 WeakPolarHBondContact O-CD1 3.38Å; A41-I45 WeakPolarHBondContact O-CG1 3.18Å; A41-I45 PolarHBondContact O-N 2.87Å; C42-I45 PolarHBondContact O-N 3.18Å; I45-S47 VanDerWaalsContact C-N 3.28Å; I45-S47 PolarHBondContact O-N 3.28Å; I45-V48 PolarHBondContact O-N 3.46Å; I45-V49 HydrophobicContact CG2-CG2 4.36Å; I45-V49 VanDerWaalsContact O-CG2 3.3Å; I45-V49 WeakPolarHBondContact O-CG2 3.06Å; I45-V49 PolarHBondContact O-N 3.23Å
46	V	84.4	Confident	78	Confident	100 Å²	100	88 Å²	88	61%	0.606	50%	0.496	S	S	*	.	H	α-helix	trans	-62.1	-38	178.1	171.7	0	0	0	0	111.1	C42 Y44 A50	C42-V46 WeakPolarHBondContact O-CB 3.39Å; C42-V46 VanDerWaalsContact O-CG2 3.24Å; C42-V46 WeakPolarHBondContact O-CG2 3.16Å; C42-V46 PolarHBondContact O-N 3.12Å; Y44-V46 PolarHBondContact O-N 3.48Å; V46-A50 WeakPolarHBondContact O-CB 3.35Å; V46-A50 PolarHBondContact O-N 3.42Å
47	S	86.6	Confident	78.6	Confident	74 Å²	74	82.5 Å²	82.5	52%	0.517	48%	0.484	S	S	.	.	H	α-helix	trans	-65.3	-44.4	176.6	-60	0	0	0	0	112.3	T43 Y44 I45 A50 A51	T43-S47 VanDerWaalsContact O-CB 3.29Å; T43-S47 WeakPolarHBondContact O-CB 3.27Å; T43-S47 PolarHBondContact O-N 3.08Å; T43-S47 PolarHBondContact O-OG 2.64Å; Y44-S47 WeakPolarHBondContact O-CB 3.33Å; Y44-S47 PolarHBondContact O-N 3.43Å; I45-S47 VanDerWaalsContact C-N 3.28Å; I45-S47 PolarHBondContact O-N 3.28Å; S47-A50 PolarHBondContact O-N 3.1Å; S47-A51 WeakPolarHBondContact O-CB 3.35Å; S47-A51 PolarHBondContact O-N 2.83Å
48	V	87.4	Confident	79.2	Confident	66 Å²	66	83.3 Å²	83.3	40%	0.4	48%	0.484	S	S	.	.	H	α-helix	trans	-64.1	-46.1	178.2	173.8	0	0	0	0	110.7	Y44 I45 A50 A51 S52	Y44-V48 HydrophobicContact CD1-CG2 4.34Å; Y44-V48 HydrophobicContact CE1-CG2 3.98Å; Y44-V48 HydrophobicContact CE2-CG2 4.38Å; Y44-V48 WeakPolarHBondContact O-CG2 2.8Å; Y44-V48 PolarHBondContact O-N 3.4Å; I45-V48 PolarHBondContact O-N 3.46Å; V48-A50 PolarHBondContact O-N 3.24Å; V48-A51 PolarHBondContact O-N 3.42Å; V48-S52 PolarHBondContact O-N 3.02Å; V48-S52 PolarHBondContact O-OG 3.46Å; V48-S52 VanDerWaalsContact O-OG 3.12Å
49	V	88.8	Confident	79.4	Confident	77 Å²	77	84.2 Å²	84.2	47%	0.467	48%	0.478	S	S	.	.	H	α-helix	trans	-62.5	-43.2	177.8	173.4	0	0	0	0	111.1	I45 A51 S52 I53	I45-V49 HydrophobicContact CG2-CG2 4.36Å; I45-V49 VanDerWaalsContact O-CG2 3.3Å; I45-V49 WeakPolarHBondContact O-CG2 3.06Å; I45-V49 PolarHBondContact O-N 3.23Å; V49-A51 VanDerWaalsContact C-N 3.34Å; V49-A51 PolarHBondContact O-N 3.36Å; V49-S52 PolarHBondContact O-N 2.93Å; V49-I53 HydrophobicContact CG1-CD1 3.94Å; V49-I53 WeakPolarHBondContact O-CG1 3.47Å; V49-I53 PolarHBondContact O-N 3.26Å
50	A	82.4	Confident	78.7	Confident	55 Å²	55	84.7 Å²	84.7	46%	0.455	48%	0.479	S	S	.	.	H	α-helix	trans	-61.6	-41.5	175.9	0	0	0	0	0	112.1	V46 S47 V48 I53 A54	V46-A50 WeakPolarHBondContact O-CB 3.35Å; V46-A50 PolarHBondContact O-N 3.42Å; S47-A50 PolarHBondContact O-N 3.1Å; V48-A50 PolarHBondContact O-N 3.24Å; A50-I53 PolarHBondContact O-N 2.84Å; A50-A54 WeakPolarHBondContact O-CB 3.44Å; A50-A54 PolarHBondContact O-N 2.9Å
51	A	80.1	Confident	77.8	Confident	49 Å²	49	81.1 Å²	81.1	41%	0.405	47%	0.468	S	S	.	.	H	α-helix	trans	-63.2	-45	176.5	0	0	0	0	0	112	S47 V48 V49 I53 A54 E55	S47-A51 WeakPolarHBondContact O-CB 3.35Å; S47-A51 PolarHBondContact O-N 2.83Å; V48-A51 PolarHBondContact O-N 3.42Å; V49-A51 VanDerWaalsContact C-N 3.34Å; V49-A51 PolarHBondContact O-N 3.36Å; A51-I53 VanDerWaalsContact C-N 3.35Å; A51-I53 PolarHBondContact O-N 3.42Å; A51-A54 WeakPolarHBondContact O-CB 3.2Å; A51-A54 PolarHBondContact O-N 3.26Å; A51-E55 PolarHBondContact O-N 2.97Å
52	S	82.9	Confident	76.9	Confident	55 Å²	55	82.2 Å²	82.2	39%	0.385	47%	0.467	S	S	.	.	H	α-helix	trans	-62.6	-40	177.4	-57.3	0	0	0	0	112.6	V48 V49 E55 L56	V48-S52 PolarHBondContact O-N 3.02Å; V48-S52 PolarHBondContact O-OG 3.46Å; V48-S52 VanDerWaalsContact O-OG 3.12Å; V49-S52 PolarHBondContact O-N 2.93Å; S52-E55 PolarHBondContact O-N 3.43Å; S52-L56 WeakPolarHBondContact O-CB 3.23Å; S52-L56 VanDerWaalsContact O-CG 3.3Å; S52-L56 WeakPolarHBondContact O-CG 3.43Å; S52-L56 PolarHBondContact O-N 3.19Å
53	I	80.4	Confident	75.9	Confident	106 Å²	106	87.1 Å²	87.1	54%	0.544	49%	0.492	S	S	.	.	H	α-helix	trans	-66.9	-39.2	175.8	-66.4	168.6	0	0	0	110.7	V49 A50 A51 L56 A57	V49-I53 HydrophobicContact CG1-CD1 3.94Å; V49-I53 WeakPolarHBondContact O-CG1 3.47Å; V49-I53 PolarHBondContact O-N 3.26Å; A50-I53 PolarHBondContact O-N 2.84Å; A51-I53 VanDerWaalsContact C-N 3.35Å; A51-I53 PolarHBondContact O-N 3.42Å; I53-L56 PolarHBondContact O-N 3.41Å; I53-A57 VanDerWaalsContact O-CB 3.27Å; I53-A57 WeakPolarHBondContact O-CB 3.37Å; I53-A57 PolarHBondContact O-N 2.98Å
54	A	78.4	Confident	74.6	Confident	52 Å²	52	87.7 Å²	87.7	43%	0.43	50%	0.495	S	S	.	.	H	α-helix	trans	-62.8	-41.8	176.5	0	0	0	0	0	111.9	A50 A51 A57 T58	A50-A54 WeakPolarHBondContact O-CB 3.44Å; A50-A54 PolarHBondContact O-N 2.9Å; A51-A54 WeakPolarHBondContact O-CB 3.2Å; A51-A54 PolarHBondContact O-N 3.26Å; A54-A57 PolarHBondContact O-N 3.36Å; A54-T58 VanDerWaalsContact O-CB 3.23Å; A54-T58 WeakPolarHBondContact O-CB 3.47Å; A54-T58 PolarHBondContact O-N 3.43Å; A54-T58 PolarHBondContact O-OG1 2.89Å
55	E	75.8	Confident	73.1	Confident	94 Å²	94	85.9 Å²	85.9	44%	0.439	49%	0.491	S	S	.	.	H	α-helix	trans	-65	-45.6	174.2	-73.9	176.5	-177.1	0	0	111.5	A51 S52 A57 T58 Y59	A51-E55 PolarHBondContact O-N 2.97Å; S52-E55 PolarHBondContact O-N 3.43Å; E55-A57 VanDerWaalsContact C-N 3.29Å; E55-A57 PolarHBondContact O-N 3.43Å; E55-T58 PolarHBondContact O-N 3.05Å; E55-Y59 WeakPolarHBondContact O-CB 3.36Å; E55-Y59 WeakPolarHBondContact O-CD2 3.21Å; E55-Y59 PolarHBondContact O-N 2.69Å
56	L	72	Confident	71.5	Confident	132 Å²	132	84.8 Å²	84.8	69%	0.691	49%	0.488	S	S	*	.	H	α-helix	trans	-65.8	-27	176.5	-73.2	175.1	0	0	0	113.8	S52 I53 P60	S52-L56 WeakPolarHBondContact O-CB 3.23Å; S52-L56 VanDerWaalsContact O-CG 3.3Å; S52-L56 WeakPolarHBondContact O-CG 3.43Å; S52-L56 PolarHBondContact O-N 3.19Å; I53-L56 PolarHBondContact O-N 3.41Å; L56-P60 WeakPolarHBondContact O-CD 3.42Å; L56-P60 WeakPolarHBondContact O-CG 3.3Å
57	A	71.3	Confident	69.9	Low	48 Å²	48	88.1 Å²	88.1	40%	0.397	49%	0.49	S	S	.	.	H	α-helix	trans	-80.8	-37	175.1	0	0	0	0	0	111.4	I53 A54 E55 L61	I53-A57 VanDerWaalsContact O-CB 3.27Å; I53-A57 WeakPolarHBondContact O-CB 3.37Å; I53-A57 PolarHBondContact O-N 2.98Å; A54-A57 PolarHBondContact O-N 3.36Å; E55-A57 VanDerWaalsContact C-N 3.29Å; E55-A57 PolarHBondContact O-N 3.43Å; A57-L61 WeakPolarHBondContact O-CB 3.41Å; A57-L61 WeakPolarHBondContact O-CD1 3.48Å; A57-L61 PolarHBondContact O-N 2.94Å
58	T	71.3	Confident	68.6	Low	70 Å²	70	90.5 Å²	90.5	43%	0.429	50%	0.496	S	S	.	.	H	α-helix	trans	-79.1	-38	-175.5	-54.9	0	0	0	0	111.7	A54 E55 L61 D62	A54-T58 VanDerWaalsContact O-CB 3.23Å; A54-T58 WeakPolarHBondContact O-CB 3.47Å; A54-T58 PolarHBondContact O-N 3.43Å; A54-T58 PolarHBondContact O-OG1 2.89Å; E55-T58 PolarHBondContact O-N 3.05Å; T58-L61 PolarHBondContact O-N 3.28Å; T58-D62 WeakPolarHBondContact CG2-OD2 3.24Å; T58-D62 WeakPolarHBondContact O-CB 3.4Å; T58-D62 PolarHBondContact O-N 2.94Å
59	Y	61	Low	66.8	Low	168 Å²	168	93.4 Å²	93.4	66%	0.659	51%	0.505	S	S	*	.	H	α-helix	trans	-54.8	-54	176.1	-103.2	-84.5	0	0	0	114.1	E55 D62 L63	E55-Y59 WeakPolarHBondContact O-CB 3.36Å; E55-Y59 WeakPolarHBondContact O-CD2 3.21Å; E55-Y59 PolarHBondContact O-N 2.69Å; Y59-D62 PolarHBondContact O-N 2.9Å; Y59-L63 WeakPolarHBondContact O-CB 3.41Å; Y59-L63 WeakPolarHBondContact O-CG 3.36Å; Y59-L63 PolarHBondContact O-N 2.8Å
60	P	60.4	Low	65.4	Low	65 Å²	65	95.2 Å²	95.2	42%	0.422	51%	0.511	S	S	.	.	H	α-helix	trans	-70.8	-30.8	177.9	27.9	-34	0	0	0	112.4	L56 D62 T64	L56-P60 WeakPolarHBondContact O-CD 3.42Å; L56-P60 WeakPolarHBondContact O-CG 3.3Å; P60-D62 VanDerWaalsContact C-N 3.35Å; P60-T64 WeakPolarHBondContact O-CB 3.17Å; P60-T64 PolarHBondContact O-N 3.47Å; P60-T64 PolarHBondContact O-OG1 2.91Å
61	L	60	Low	63.7	Low	111 Å²	111	98.3 Å²	98.3	58%	0.581	52%	0.516	S	S	*	.	H	α-helix	trans	-66.5	-37.1	174.6	-112.8	95.1	0	0	0	112.1	A57 T58 T64 K65	A57-L61 WeakPolarHBondContact O-CB 3.41Å; A57-L61 WeakPolarHBondContact O-CD1 3.48Å; A57-L61 PolarHBondContact O-N 2.94Å; T58-L61 PolarHBondContact O-N 3.28Å; L61-T64 PolarHBondContact O-N 2.93Å; L61-K65 PolarHBondContact O-N 3.42Å
62	D	59.2	Low	62.6	Low	78 Å²	78	97.9 Å²	97.9	42%	0.417	52%	0.517	S	S	.	.	H	α-helix	trans	-79.8	-35.3	178.7	-73.2	-19.2	0	0	0	111.9	T58 Y59 P60 T64 K65 T66	T58-D62 WeakPolarHBondContact CG2-OD2 3.24Å; T58-D62 WeakPolarHBondContact O-CB 3.4Å; T58-D62 PolarHBondContact O-N 2.94Å; Y59-D62 PolarHBondContact O-N 2.9Å; P60-D62 VanDerWaalsContact C-N 3.35Å; D62-T64 PolarHBondContact O-N 3.24Å; D62-K65 PolarHBondContact O-N 3.47Å; D62-T66 PolarHBondContact O-N 3.12Å; D62-T66 VanDerWaalsContact O-N 3.08Å; D62-T66 PolarHBondContact O-OG1 3.41Å
63	L	55.4	Low	61.2	Low	110 Å²	110	101.5 Å²	101.5	58%	0.576	53%	0.528	S	S	*	.	H	α-helix	trans	-65.3	-27.9	168.4	-68.5	178.4	0	0	0	112.4	Y59 T66 R67	Y59-L63 WeakPolarHBondContact O-CB 3.41Å; Y59-L63 WeakPolarHBondContact O-CG 3.36Å; Y59-L63 PolarHBondContact O-N 2.8Å; L63-T66 PolarHBondContact O-OG1 2.73Å; L63-T66 VanDerWaalsContact O-OG1 3.1Å; L63-R67 WeakPolarHBondContact O-CB 3.47Å; L63-R67 PolarHBondContact O-N 2.96Å; L63-R67 VanDerWaalsContact O-N 3.12Å
64	T	55.5	Low	59.9	Low	78 Å²	78	98.4 Å²	98.4	48%	0.479	52%	0.522	S	S	.	.	H	α-helix	trans	-77.3	-37.3	173.4	-53.3	0	0	0	0	111.6	P60 L61 D62 T66 R67 L68	P60-T64 WeakPolarHBondContact O-CB 3.17Å; P60-T64 PolarHBondContact O-N 3.47Å; P60-T64 PolarHBondContact O-OG1 2.91Å; L61-T64 PolarHBondContact O-N 2.93Å; D62-T64 PolarHBondContact O-N 3.24Å; T64-T66 VanDerWaalsContact C-N 3.35Å; T64-T66 PolarHBondContact O-N 2.97Å; T64-R67 PolarHBondContact O-N 3.2Å; T64-L68 PolarHBondContact O-N 3.37Å
65	K	53.6	Low	58.4	Low	127 Å²	127	98.8 Å²	98.8	55%	0.552	53%	0.525	S	S	*	.	H	α-helix	trans	-59.8	-42.5	172.8	-90.9	-165.9	-176.6	75.1	0	112.2	L61 D62 Q69	L61-K65 PolarHBondContact O-N 3.42Å; D62-K65 PolarHBondContact O-N 3.47Å; K65-Q69 PolarHBondContact O-N 3.37Å
66	T	53.9	Low	57.1	Low	66 Å²	66	97.3 Å²	97.3	41%	0.405	53%	0.529	S	S	.	.	H	α-helix	trans	-73	-30.6	176.2	58.8	0	0	0	0	112.2	D62 L63 T64 L68 Q69 I70	D62-T66 PolarHBondContact O-N 3.12Å; D62-T66 VanDerWaalsContact O-N 3.08Å; D62-T66 PolarHBondContact O-OG1 3.41Å; L63-T66 PolarHBondContact O-OG1 2.73Å; L63-T66 VanDerWaalsContact O-OG1 3.1Å; T64-T66 VanDerWaalsContact C-N 3.35Å; T64-T66 PolarHBondContact O-N 2.97Å; T66-L68 PolarHBondContact O-N 2.98Å; T66-Q69 PolarHBondContact O-N 2.95Å; T66-I70 WeakPolarHBondContact O-CB 3.46Å; T66-I70 WeakPolarHBondContact O-CD1 3.39Å; T66-I70 WeakPolarHBondContact O-CG1 3.17Å; T66-I70 PolarHBondContact O-N 3.06Å
67	R	52.5	Low	55.9	Low	170 Å²	170	98.6 Å²	98.6	64%	0.642	53%	0.531	S	S	*	.	H	α-helix	trans	-64.2	-37.1	175.7	-119.4	-168.5	-174.6	-85.4	1.1	113.9	L63 T64 Q71	L63-R67 WeakPolarHBondContact O-CB 3.47Å; L63-R67 PolarHBondContact O-N 2.96Å; L63-R67 VanDerWaalsContact O-N 3.12Å; T64-R67 PolarHBondContact O-N 3.2Å; R67-Q71 PolarHBondContact O-N 3.09Å
68	L	57.7	Low	54.6	Low	123 Å²	123	101 Å²	101	64%	0.644	55%	0.545	S	S	*	.	H	α-helix	trans	-75.1	-33.9	178.6	-70	172.4	0	0	0	112.2	T64 T66 G72	T64-L68 PolarHBondContact O-N 3.37Å; T66-L68 PolarHBondContact O-N 2.98Å; L68-G72 PolarHBondContact O-N 3.05Å
69	Q	50.7	Low	53.5	Low	128 Å²	128	101.8 Å²	101.8	60%	0.598	56%	0.558	S	S	*	*	H	α-helix	trans	-73.3	-36.3	174.6	-71.5	-179.3	-21.4	0	0	112.3	K65 T66 Q71 G72 E73	K65-Q69 PolarHBondContact O-N 3.37Å; T66-Q69 PolarHBondContact O-N 2.95Å; Q69-Q71 VanDerWaalsContact C-N 3.32Å; Q69-Q71 PolarHBondContact O-N 3.06Å; Q69-G72 PolarHBondContact O-N 3.45Å; Q69-G72 VanDerWaalsContact O-N 3.17Å; Q69-E73 WeakPolarHBondContact O-CB 3.41Å; Q69-E73 PolarHBondContact O-N 2.95Å
70	I	58.6	Low	52.6	Low	115 Å²	115	96.6 Å²	96.6	59%	0.59	56%	0.557	S	S	*	*	H	α-helix	trans	-69.1	-30.3	177.3	-69.7	165.2	0	0	0	111.8	T66 G74	T66-I70 WeakPolarHBondContact O-CB 3.46Å; T66-I70 WeakPolarHBondContact O-CD1 3.39Å; T66-I70 WeakPolarHBondContact O-CG1 3.17Å; T66-I70 PolarHBondContact O-N 3.06Å; I70-G74 VanDerWaalsContact O-CA 3.25Å; I70-G74 WeakPolarHBondContact O-CA 3.19Å; I70-G74 PolarHBondContact O-N 2.98Å
71	Q	47.2	Very low	51.8	Low	119 Å²	119	102.2 Å²	102.2	56%	0.556	57%	0.574	S	S	*	*	H	α-helix	trans	-77.8	-34.1	169.1	-74.2	-178.5	3.2	0	0	112.4	R67 Q69 A75	R67-Q71 PolarHBondContact O-N 3.09Å; Q69-Q71 VanDerWaalsContact C-N 3.32Å; Q69-Q71 PolarHBondContact O-N 3.06Å; Q71-A75 WeakPolarHBondContact O-CA 3.4Å; Q71-A75 WeakPolarHBondContact O-CB 3.48Å; Q71-A75 PolarHBondContact O-N 2.89Å
72	G	56.5	Low	50.9	Low	41 Å²	41	102.6 Å²	102.6	42%	0.423	59%	0.586	S	S	.	*	H	α-helix	trans	-65.5	-46.1	174.9	0	0	0	0	0	112.8	L68 Q69 A76	L68-G72 PolarHBondContact O-N 3.05Å; Q69-G72 PolarHBondContact O-N 3.45Å; Q69-G72 VanDerWaalsContact O-N 3.17Å; G72-A76 WeakPolarHBondContact O-CA 3.49Å; G72-A76 WeakPolarHBondContact O-CB 3.48Å; G72-A76 PolarHBondContact O-N 2.96Å
73	E	54	Low	50.2	Low	130 Å²	130	105.8 Å²	105.8	61%	0.607	60%	0.603	S	S	*	*	H	α-helix	trans	-78.5	-39.9	176.4	-66.1	-175.4	178.2	0	0	111.6	Q69 A75 A76 H77	Q69-E73 WeakPolarHBondContact O-CB 3.41Å; Q69-E73 PolarHBondContact O-N 2.95Å; E73-A75 PolarHBondContact O-N 2.99Å; E73-A76 PolarHBondContact O-N 3.28Å; E73-H77 VanDerWaalsContact O-CB 3.28Å; E73-H77 WeakPolarHBondContact O-CB 3.3Å; E73-H77 PolarHBondContact O-CD2 3.19Å; E73-H77 PolarHBondContact O-N 3.38Å
74	G	52.2	Low	49.4	Very low	42 Å²	42	111.5 Å²	111.5	43%	0.433	62%	0.617	S	S	.	*	H	α-helix	trans	-64.3	-35.6	174.3	0	0	0	0	0	113.5	I70 S78	I70-G74 VanDerWaalsContact O-CA 3.25Å; I70-G74 WeakPolarHBondContact O-CA 3.19Å; I70-G74 PolarHBondContact O-N 2.98Å; G74-S78 PolarHBondContact O-OG 2.97Å
75	A	47.4	Very low	48.7	Very low	59 Å²	59	113.4 Å²	113.4	49%	0.488	63%	0.633	S	S	.	*	H	α-helix	trans	-84.8	-32.1	173.8	0	0	0	0	0	112.9	Q71 E73 S78 A79	Q71-A75 WeakPolarHBondContact O-CA 3.4Å; Q71-A75 WeakPolarHBondContact O-CB 3.48Å; Q71-A75 PolarHBondContact O-N 2.89Å; E73-A75 PolarHBondContact O-N 2.99Å; A75-S78 CarbonylContact O-C 3.52Å; A75-S78 PolarHBondContact O-N 3.46Å; A75-S78 VanDerWaalsContact O-N 3.16Å; A75-A79 VanDerWaalsContact O-CB 3.23Å; A75-A79 WeakPolarHBondContact O-CB 3.29Å; A75-A79 PolarHBondContact O-N 2.92Å
76	A	49.1	Very low	48.5	Very low	63 Å²	63	115.5 Å²	115.5	52%	0.521	64%	0.644	S	S	.	*	H	α-helix	trans	-70.9	-31.5	174.6	0	0	0	0	0	112.7	G72 E73 S78	G72-A76 WeakPolarHBondContact O-CA 3.49Å; G72-A76 WeakPolarHBondContact O-CB 3.48Å; G72-A76 PolarHBondContact O-N 2.96Å; E73-A76 PolarHBondContact O-N 3.28Å; A76-S78 PolarHBondContact O-N 3.38Å
77	H	46.3	Very low	48.1	Very low	160 Å²	160	119.1 Å²	119.1	74%	0.741	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69	-19.9	169.7	-86.3	-101.3	0	0	0	112.9	E73	E73-H77 VanDerWaalsContact O-CB 3.28Å; E73-H77 WeakPolarHBondContact O-CB 3.3Å; E73-H77 PolarHBondContact O-CD2 3.19Å; E73-H77 PolarHBondContact O-N 3.38Å
78	S	44.9	Very low	47.9	Very low	99 Å²	99	117.4 Å²	117.4	69%	0.692	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.4	-18.1	175.8	-56.7	0	0	0	0	114.1	G74 A75 A76	G74-S78 PolarHBondContact O-OG 2.97Å; A75-S78 CarbonylContact O-C 3.52Å; A75-S78 PolarHBondContact O-N 3.46Å; A75-S78 VanDerWaalsContact O-N 3.16Å; A76-S78 PolarHBondContact O-N 3.38Å
79	A	46.7	Very low	47.3	Very low	85 Å²	85	119.3 Å²	119.3	70%	0.702	67%	0.669	S	S	*	*	S	Bend	trans	-90.7	-0.6	-177.6	0	0	0	0	0	114.4	A75	A75-A79 VanDerWaalsContact O-CB 3.23Å; A75-A79 WeakPolarHBondContact O-CB 3.29Å; A75-A79 PolarHBondContact O-N 2.92Å
80	G	43.5	Very low	47	Very low	60 Å²	60	120.1 Å²	120.1	62%	0.619	68%	0.677	S	S	*	*	S	Bend	trans	-102.4	1.6	-174.9	0	0	0	0	0	117.2
81	K	41.8	Very low	46.2	Very low	182 Å²	182	125.4 Å²	125.4	79%	0.791	69%	0.69	S	S	*	*			trans	-142.8	58.9	175.6	-82.3	115.8	172.4	-176	0	111.7	N83	K81-N83 PolarHBondContact O-N 2.65Å; K81-N83 VanDerWaalsContact O-N 3.13Å
82	S	41.8	Very low	46.8	Very low	119 Å²	119	124.2 Å²	124.2	83%	0.832	69%	0.693	S	S	*	*			trans	-84	74.5	165.5	-169.8	0	0	0	0	109.9
83	N	45.6	Very low	46.1	Very low	145 Å²	145	129.5 Å²	129.5	78%	0.775	71%	0.711	S	S	*	*			trans	-167.7	47.8	161.8	44.4	-32.7	0	0	0	111.5	K81	K81-N83 PolarHBondContact O-N 2.65Å; K81-N83 VanDerWaalsContact O-N 3.13Å
84	R	37.7	Very low	45.7	Very low	230 Å²	230	128.3 Å²	128.3	87%	0.868	72%	0.724	S	S	*	*			trans	-145.7	118.5	148.6	-122.1	-171.5	-67.4	167.1	-1.2	112.2	E86	R84-E86 PolarHBondContact O-N 3.15Å
85	C	40.9	Very low	45.1	Very low	119 Å²	119	135.8 Å²	135.8	80%	0.804	75%	0.747	S	S	*	*			trans	-64.3	108.7	169.8	173.9	0	0	0	0	110.1
86	E	48.6	Very low	44.6	Very low	171 Å²	171	136.5 Å²	136.5	80%	0.799	76%	0.76	S	S	*	*			trans	-157.7	104.9	151.1	-76.3	-160.9	87.4	0	0	103.6	R84	R84-E86 PolarHBondContact O-N 3.15Å
87	D	45.6	Very low	44	Very low	141 Å²	141	140.2 Å²	140.2	75%	0.754	78%	0.776	S	S	*	*				47.5	64.3	52.2	-148.8	-115.2	0	0	0	113.7
88	L	49.5	Very low	43.7	Very low	135 Å²	135	140.7 Å²	140.7	71%	0.707	78%	0.778	S	S	*	*			trans	-173.2	108.2	135.9	-124.6	57.2	0	0	0	108.5
89	Q	44	Very low	43.5	Very low	162 Å²	162	142.4 Å²	142.4	76%	0.757	79%	0.785	S	S	*	*				66.4	123.6	97.5	-119.1	168.7	-102.5	0	0	112
90	L	44.3	Very low	43.1	Very low	146 Å²	146	144.6 Å²	144.6	76%	0.764	78%	0.78	S	S	*	*			cis	-164.7	148.6	37.8	-95.6	106.2	0	0	0	110.6
91	R	41.5	Very low	42.6	Very low	225 Å²	225	151.2 Å²	151.2	85%	0.849	79%	0.787	S	S	*	*			trans	-98.3	171.1	136.4	-69.4	-162.6	80	164.1	5.3	107.4
92	P	60	Low	42.6	Very low	95 Å²	95	151.2 Å²	151.2	62%	0.617	79%	0.789	S	S	*	*			cis	-130.4	-165.8	-16.2	25	0.7	0	0	0	112.2
93	D	41.7	Very low	42.7	Very low	152 Å²	152	150.9 Å²	150.9	81%	0.813	78%	0.784	S	S	*	*			trans	97.5	108.1	161.1	-55.4	-44.3	0	0	0	119.9
94	A	46.3	Very low	42.3	Very low	105 Å²	105	146.6 Å²	146.6	87%	0.868	77%	0.774	S	S	*	*			trans	-160.5	137.2	139.6	0	0	0	0	0	111.2
95	Q	40.5	Very low	42.8	Very low	199 Å²	199	141.9 Å²	141.9	93%	0.93	78%	0.776	S	S	*	*			trans	-72.8	149.9	-169.7	-70.3	157.1	-40.8	0	0	115.9
96	G	35.8	Very low	43.1	Very low	74 Å²	74	141.1 Å²	141.1	76%	0.763	78%	0.779	S	S	*	*			trans	33.4	123.9	136.2	0	0	0	0	0	122.1
97	V	37.1	Very low	42.8	Very low	140 Å²	140	136.5 Å²	136.5	85%	0.848	78%	0.777	S	S	*	*			trans	-142.2	126.7	142.4	163.4	0	0	0	0	109.9
98	H	39.3	Very low	42.8	Very low	171 Å²	171	135.9 Å²	135.9	79%	0.792	77%	0.773	S	S	*	*			trans	-58.2	132.8	170.4	-146.5	-110.6	0	0	0	110.6
99	T	41.3	Very low	42.4	Very low	134 Å²	134	137.8 Å²	137.8	82%	0.822	78%	0.778	S	S	*	*			trans	-131.2	93.2	156.9	-73.8	0	0	0	0	107.4
100	E	37.2	Very low	42.8	Very low	132 Å²	132	136.3 Å²	136.3	62%	0.617	78%	0.78	S	S	*	*			trans	-69	128.3	155.1	-155.1	-89.3	101.6	0	0	106.4
101	R	34.4	Very low	43.1	Very low	199 Å²	199	131.8 Å²	131.8	75%	0.751	77%	0.768	S	S	*	*			trans	158	103.2	142.3	-83.1	-78.5	-158.4	164.1	7.2	110.2	P103	R101-P103 WeakPolarHBondContact O-CD 3.27Å
102	H	42.3	Very low	43.2	Very low	182 Å²	182	125.2 Å²	125.2	84%	0.843	76%	0.762	S	S	*	*			trans	-61	130.6	144.9	-104.9	-86.9	0	0	0	108.8
103	P	42.1	Very low	42.6	Very low	112 Å²	112	127.2 Å²	127.2	73%	0.727	77%	0.772	S	S	*	*				-131.4	134	119.6	32.2	-19.4	0	0	0	108.5	R101	R101-P103 WeakPolarHBondContact O-CD 3.27Å
104	G	38	Very low	42.6	Very low	54 Å²	54	131 Å²	131	56%	0.557	78%	0.775	S	S	*	*				71.4	101.2	70.1	0	0	0	0	0	109.1
105	S	49	Very low	42.4	Very low	131 Å²	131	136.8 Å²	136.8	92%	0.916	78%	0.775	S	S	*	*			trans	56.4	93.7	163.6	53.1	0	0	0	0	117.8
106	A	45.8	Very low	42.4	Very low	104 Å²	104	135.6 Å²	135.6	86%	0.86	77%	0.769	S	S	*	*			trans	-119.1	120.3	150.4	0	0	0	0	0	107.5
107	G	43.9	Very low	42.5	Very low	74 Å²	74	135.6 Å²	135.6	76%	0.763	77%	0.769	S	S	*	*			trans	-58.1	143.7	-168.9	0	0	0	0	0	113.3	E109	G107-E109 PolarHBondContact O-N 3.4Å
108	L	44	Very low	43.1	Very low	127 Å²	127	139.7 Å²	139.7	67%	0.665	77%	0.769	S	S	*	*			trans	-58.2	84.2	156.9	-159.9	81.2	0	0	0	107.7	V110	L108-V110 HydrophobicContact CD2-CG2 3.88Å; L108-V110 HydrophobicContact CG-CG2 4.03Å; L108-V110 PolarHBondContact O-N 2.9Å
109	E	41.7	Very low	43.1	Very low	176 Å²	176	136.5 Å²	136.5	82%	0.822	77%	0.766	S	S	*	*			trans	-72.9	88.4	167.1	-159.1	-157.3	108	0	0	107.4	G107 G111	G107-E109 PolarHBondContact O-N 3.4Å; E109-G111 PolarHBondContact O-N 2.94Å
110	V	52.5	Low	43.6	Very low	131 Å²	131	140.5 Å²	140.5	79%	0.794	77%	0.766	S	S	*	*			trans	-64.7	88.2	164.9	179.1	0	0	0	0	106.9	L108	L108-V110 HydrophobicContact CD2-CG2 3.88Å; L108-V110 HydrophobicContact CG-CG2 4.03Å; L108-V110 PolarHBondContact O-N 2.9Å
111	G	49.8	Very low	43.4	Very low	50 Å²	50	140.3 Å²	140.3	52%	0.515	78%	0.778	S	S	.	*			trans	-146.7	26	-163	0	0	0	0	0	116.9	E109	E109-G111 PolarHBondContact O-N 2.94Å
112	A	44.2	Very low	44	Very low	88 Å²	88	135.6 Å²	135.6	73%	0.727	77%	0.773	S	S	*	*			trans	-156.8	78.7	165.4	0	0	0	0	0	113.7	R114	A112-R114 PolarHBondContact O-N 3.3Å
113	V	47.7	Very low	44.4	Very low	136 Å²	136	134 Å²	134	82%	0.824	78%	0.776	S	S	*	*			trans	-70.5	77.7	155.4	100.9	0	0	0	0	107.8	R115	V113-R115 VanDerWaalsContact C-N 3.26Å; V113-R115 PolarHBondContact O-N 2.85Å
114	R	41.7	Very low	44.7	Very low	232 Å²	232	132.8 Å²	132.8	88%	0.875	78%	0.775	S	S	*	*			trans	-74.9	89.3	163.8	-89.2	-139.2	-147.6	171.3	10	107.7	A112 H116	A112-R114 PolarHBondContact O-N 3.3Å; R114-H116 PolarHBondContact O-N 3.32Å
115	R	42.6	Very low	44.9	Very low	227 Å²	227	136.2 Å²	136.2	86%	0.857	79%	0.789	S	S	*	*			trans	-52	104.5	162.5	-72.4	-99	-159	-158.3	2.5	108.3	V113 G117	V113-R115 VanDerWaalsContact C-N 3.26Å; V113-R115 PolarHBondContact O-N 2.85Å; R115-G117 VanDerWaalsContact C-N 3.31Å; R115-G117 PolarHBondContact O-N 2.98Å
116	H	39.3	Very low	44.8	Very low	173 Å²	173	136.8 Å²	136.8	80%	0.801	78%	0.781	S	S	*	*			trans	-76	85.7	174.1	-146.3	-71.5	0	0	0	108.7	R114 R118	R114-H116 PolarHBondContact O-N 3.32Å; H116-R118 PolarHBondContact O-N 2.82Å; H116-R118 VanDerWaalsContact O-N 3.09Å
117	G	38.9	Very low	44.9	Very low	74 Å²	74	136.9 Å²	136.9	76%	0.763	78%	0.781	S	S	*	*			trans	-66.9	97.8	159.3	0	0	0	0	0	108.3	R115 S119	R115-G117 VanDerWaalsContact C-N 3.31Å; R115-G117 PolarHBondContact O-N 2.98Å; G117-S119 PolarHBondContact O-N 3.06Å
118	R	50.1	Low	44.7	Very low	227 Å²	227	147.8 Å²	147.8	86%	0.857	80%	0.799	S	S	*	*			trans	-78.4	109.6	-179	-166.2	176.1	173.6	-174.9	-1.8	109.2	H116	H116-R118 PolarHBondContact O-N 2.82Å; H116-R118 VanDerWaalsContact O-N 3.09Å
119	S	39.2	Very low	44.7	Very low	103 Å²	103	148.8 Å²	148.8	72%	0.72	81%	0.806	S	S	*	*			trans	-148.1	97.4	151.6	-160.6	0	0	0	0	106.8	G117	G117-S119 PolarHBondContact O-N 3.06Å
120	R	50.8	Low	44.9	Very low	219 Å²	219	147.4 Å²	147.4	83%	0.826	81%	0.805	S	S	*	*				48.9	112.1	112.9	-61.4	-177.3	-177.7	-131.3	2.7	110.7
121	C	34.4	Very low	44.4	Very low	128 Å²	128	148.3 Å²	148.3	87%	0.865	81%	0.806	S	S	*	*				-142.1	147.2	78.5	-68	0	0	0	0	113.8
122	P	46.3	Very low	44.1	Very low	100 Å²	100	154.1 Å²	154.1	65%	0.649	82%	0.823	S	S	*	*			trans	-85.5	148.1	171.3	38.6	-32.9	0	0	0	110.4	A124	P122-A124 PolarHBondContact O-N 3.06Å
123	V	50.2	Low	44.1	Very low	149 Å²	149	158.2 Å²	158.2	90%	0.903	83%	0.829	S	S	*	*	S	Bend	trans	42.1	62.6	145.9	-53.5	0	0	0	0	118.3
124	A	48.3	Very low	43.9	Very low	86 Å²	86	159.7 Å²	159.7	71%	0.711	83%	0.829	S	S	*	*			trans	-161.6	136.8	156.6	0	0	0	0	0	109.7	P122	P122-A124 PolarHBondContact O-N 3.06Å
125	C	42.3	Very low	44.1	Very low	125 Å²	125	154.5 Å²	154.5	85%	0.845	83%	0.826	S	S	*	*	S	Bend	trans	77.6	118.6	-174.1	-61.4	0	0	0	0	114
126	L	47.7	Very low	44.2	Very low	143 Å²	143	148.9 Å²	148.9	75%	0.749	82%	0.824	S	S	*	*			cis	-164.1	113.3	6.8	-162.1	67.7	0	0	0	107.7	R128	L126-R128 PolarHBondContact O-N 2.98Å
127	A	46.5	Very low	44.6	Very low	106 Å²	106	146.9 Å²	146.9	88%	0.876	83%	0.826	S	S	*	*			trans	-61.4	110.1	147.7	0	0	0	0	0	107.1
128	R	40.2	Very low	45.1	Very low	303 Å²	303	153.5 Å²	153.5	100%	1.143	83%	0.831	S	S	*	*			trans	-165.2	0	143.4	-160.6	163.3	177.9	-136.7	-1.8	111.5	L126	L126-R128 PolarHBondContact O-N 2.98Å

Retrieved 128 of 128 residues in 26 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).