X5CT67_HUMAN Loading...

RUNX1/RUNX1T1 fusion protein

AlphaFold DB , UniProt , Accession X5CT67, Species HUMAN (Homo sapiens, Human), Gene RUNX1, Length 123 aa.

						>X5CT67_HUMAN|X5CT67|RUNX1
MAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.6	Very low	51.6	Low	246 Å²	246	165 Å²	165	100%	1.212	82%	0.818	S	S	*	*				0	114.5	0	-111.6	163.5	-171.5	0	0	107.7
2	A	46.7	Very low	52.3	Low	91 Å²	91	168.8 Å²	168.8	75%	0.752	82%	0.816	S	S	*	*			trans	-89.3	123.2	-170.7	0	0	0	0	0	111.1	A4	A2-A4 PolarHBondContact O-N 3.37Å
3	I	57.3	Low	52.6	Low	155 Å²	155	168.8 Å²	168.8	80%	0.795	81%	0.814	S	S	*	*			trans	-94.6	84.7	172.3	-53.8	174.3	0	0	0	106.8
4	A	54.4	Low	53.2	Low	80 Å²	80	163.6 Å²	163.6	66%	0.661	80%	0.8	S	S	*	*			trans	-129.8	21.5	-179.8	0	0	0	0	0	113.3	A2	A2-A4 PolarHBondContact O-N 3.37Å
5	H	53	Low	53	Low	151 Å²	151	157.5 Å²	157.5	70%	0.699	78%	0.78	S	S	*	*			trans	-111.5	-1.2	-174.6	-72.4	-68.9	0	0	0	115.9
6	H	58.6	Low	53.3	Low	165 Å²	165	156.6 Å²	156.6	76%	0.764	77%	0.773	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.8	-3.9	-176.5	-64.4	-56.1	0	0	0	115.7
7	Y	50.4	Low	53.5	Low	232 Å²	232	159.9 Å²	159.9	91%	0.91	78%	0.775	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.9	-8	179.6	-152	-97.1	0	0	0	113.9
8	R	52.4	Low	53.7	Low	231 Å²	231	157.1 Å²	157.1	87%	0.872	76%	0.764	S	S	*	*	S	Bend	trans	-106.7	-7	-170.8	-142.9	-168.7	177.7	177.6	0.9	116.1
9	D	49.8	Very low	53.9	Low	115 Å²	115	154.7 Å²	154.7	62%	0.615	76%	0.755	S	S	*	*			trans	-105.3	8.7	-171	-92.1	-36	0	0	0	115.6	Y11	D9-Y11 VanDerWaalsContact C-N 3.29Å; D9-Y11 PolarHBondContact O-N 3.1Å
10	S	51.7	Low	54.2	Low	115 Å²	115	156.9 Å²	156.9	80%	0.804	75%	0.754	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.7	-6.2	173.9	-60.3	0	0	0	0	114.4
11	Y	49.8	Very low	54.4	Low	234 Å²	234	156.2 Å²	156.2	92%	0.918	76%	0.755	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.2	6.3	178.8	-97.4	-86.6	0	0	0	114.4	D9 H13	D9-Y11 VanDerWaalsContact C-N 3.29Å; D9-Y11 PolarHBondContact O-N 3.1Å; Y11-H13 PolarHBondContact O-N 3.01Å
12	R	59.8	Low	55.1	Low	211 Å²	211	155.2 Å²	155.2	80%	0.796	74%	0.738	S	S	*	*			trans	-88.3	109.1	167.8	-97.2	-164.7	172	162.4	0.2	110.1
13	H	56.1	Low	55.3	Low	169 Å²	169	157.1 Å²	157.1	78%	0.782	74%	0.735	S	S	*	*	P	Polyproline II helix	trans	-49.2	135.3	165.9	-163.3	-72.8	0	0	0	109.8	Y11 S15	Y11-H13 PolarHBondContact O-N 3.01Å; H13-S15 PolarHBondContact O-N 2.81Å; H13-S15 VanDerWaalsContact O-N 3.13Å
14	P	60.5	Low	55.3	Low	96 Å²	96	160.2 Å²	160.2	62%	0.623	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-52.9	124.6	172.6	-23.2	32.1	0	0	0	109.2	H16	P14-H16 PolarHBondContact O-N 3.5Å
15	S	50.3	Low	55.2	Low	72 Å²	72	162 Å²	162	50%	0.503	74%	0.742	S	S	.	*	P	Polyproline II helix	trans	-60.7	125.6	178.3	20.3	0	0	0	0	109.6	H13 R17 D18	H13-S15 PolarHBondContact O-N 2.81Å; H13-S15 VanDerWaalsContact O-N 3.13Å; S15-R17 PolarHBondContact O-N 3.07Å; S15-D18 PolarHBondContact O-N 3.25Å; S15-D18 PolarHBondContact OG-OD2 3.36Å
16	H	58.6	Low	55.3	Low	142 Å²	142	163.9 Å²	163.9	66%	0.657	75%	0.753	S	S	*	*	H	α-helix	trans	-52.7	-15.1	178.1	-173.1	-79	0	0	0	114	P14	P14-H16 PolarHBondContact O-N 3.5Å
17	R	56.8	Low	54.9	Low	213 Å²	213	158.5 Å²	158.5	80%	0.804	74%	0.743	S	S	*	*	H	α-helix	trans	-67.8	-35.4	176.7	-155.2	176	-173.5	-158.4	0.5	112.5	S15 L19 R20	S15-R17 PolarHBondContact O-N 3.07Å; R17-L19 VanDerWaalsContact C-N 3.3Å; R17-L19 PolarHBondContact O-N 2.9Å; R17-R20 PolarHBondContact O-N 3.24Å
18	D	56.6	Low	55.2	Low	109 Å²	109	155.6 Å²	155.6	58%	0.583	74%	0.742	S	S	*	*	H	α-helix	trans	-75.4	-19.4	-179.2	-58.9	-67.4	0	0	0	112.8	S15	S15-D18 PolarHBondContact O-N 3.25Å; S15-D18 PolarHBondContact OG-OD2 3.36Å
19	L	57.9	Low	54.9	Low	113 Å²	113	154 Å²	154	59%	0.592	74%	0.744	S	S	*	*	H	α-helix	trans	-71.9	-33.5	173.2	-107.4	76	0	0	0	112.4	R17	R17-L19 VanDerWaalsContact C-N 3.3Å; R17-L19 PolarHBondContact O-N 2.9Å
20	R	60.4	Low	54.8	Low	197 Å²	197	151 Å²	151	74%	0.743	74%	0.74	S	S	*	*	H	α-helix	trans	-71.9	-32.2	-177.6	-88.5	-153.9	-168.6	-101.2	5.4	113.2	R17 R22 N23	R17-R20 PolarHBondContact O-N 3.24Å; R20-R22 VanDerWaalsContact C-N 3.3Å; R20-R22 PolarHBondContact O-N 3.35Å; R20-N23 WeakPolarHBondContact O-CB 3.43Å; R20-N23 PolarHBondContact O-N 3.14Å
21	D	57.1	Low	54.5	Low	143 Å²	143	152.5 Å²	152.5	77%	0.765	75%	0.745	S	S	*	*	H	α-helix	trans	-73.5	-20.9	-176.7	-104.8	-37.5	0	0	0	113.3	N23	D21-N23 VanDerWaalsContact C-N 3.27Å
22	R	57.8	Low	54.3	Low	225 Å²	225	152.4 Å²	152.4	85%	0.849	74%	0.743	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.6	-18.9	169	-163.6	68.7	70.9	175.9	4.3	112.6	R20 R24	R20-R22 VanDerWaalsContact C-N 3.3Å; R20-R22 PolarHBondContact O-N 3.35Å; R22-R24 VanDerWaalsContact C-N 3.34Å; R22-R24 PolarHBondContact O-N 2.95Å
23	N	52.9	Low	53.8	Low	131 Å²	131	150 Å²	150	70%	0.701	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.7	19.3	-171.7	-100.1	74.1	0	0	0	114.2	R20 D21 P25	R20-N23 WeakPolarHBondContact O-CB 3.43Å; R20-N23 PolarHBondContact O-N 3.14Å; D21-N23 VanDerWaalsContact C-N 3.27Å; N23-P25 VanDerWaalsContact O-CD 3.27Å; N23-P25 WeakPolarHBondContact O-CD 3.4Å
24	R	56	Low	53.6	Low	220 Å²	220	150.1 Å²	150.1	83%	0.83	74%	0.741	S	S	*	*			trans	-77.1	115	169.4	-153.6	174	-168.2	-171.4	2.6	108.6	R22 M26	R22-R24 VanDerWaalsContact C-N 3.34Å; R22-R24 PolarHBondContact O-N 2.95Å; R24-M26 PolarHBondContact O-N 2.9Å
25	P	53.2	Low	53.5	Low	118 Å²	118	152.7 Å²	152.7	77%	0.766	75%	0.745	S	S	*	*			trans	-71.2	101.1	175.9	29	-29.6	0	0	0	107.3	N23 G27	N23-P25 VanDerWaalsContact O-CD 3.27Å; N23-P25 WeakPolarHBondContact O-CD 3.4Å; P25-G27 PolarHBondContact O-N 3.31Å
26	M	54.6	Low	54.3	Low	190 Å²	190	158.2 Å²	158.2	94%	0.936	77%	0.765	S	S	*	*			trans	-58.2	119.3	160	-83.6	172	120.9	0	0	106.7	R24	R24-M26 PolarHBondContact O-N 2.9Å
27	G	50.4	Low	55.2	Low	53 Å²	53	157.5 Å²	157.5	55%	0.546	77%	0.765	S	S	.	*			trans	-66.4	167.5	-167	0	0	0	0	0	114.3	P25	P25-G27 PolarHBondContact O-N 3.31Å
28	L	56	Low	56.2	Low	170 Å²	170	153 Å²	153	89%	0.89	76%	0.757	S	S	*	*			trans	54.7	71.7	154.8	-71.4	88.9	0	0	0	115.1
29	H	46.8	Very low	57.6	Low	197 Å²	197	155.7 Å²	155.7	91%	0.912	77%	0.765	S	S	*	*			trans	-109.2	112.4	136.1	-80.2	-55.5	0	0	0	107.7
30	G	46.9	Very low	59.1	Low	52 Å²	52	160.1 Å²	160.1	54%	0.536	77%	0.774	S	S	.	*			trans	-65.4	164	-161.1	0	0	0	0	0	114.4	R32	G30-R32 PolarHBondContact O-N 2.9Å
31	T	45.8	Very low	60.6	Low	148 Å²	148	154.1 Å²	154.1	91%	0.908	76%	0.756	S	S	*	*			trans	38.1	43.1	143.3	62.8	0	0	0	0	115.3	Q33	T31-Q33 PolarHBondContact O-N 3.14Å
32	R	46.8	Very low	62.3	Low	232 Å²	232	150.9 Å²	150.9	88%	0.875	74%	0.742	S	S	*	*			trans	-74.6	89.6	168.3	-158.9	178.1	-167.7	-95.3	0.2	103.1	G30 E34	G30-R32 PolarHBondContact O-N 2.9Å; R32-E34 VanDerWaalsContact C-N 3.26Å; R32-E34 PolarHBondContact O-N 3.06Å
33	Q	47.8	Very low	64.1	Low	159 Å²	159	147.3 Å²	147.3	74%	0.743	74%	0.74	S	S	*	*			trans	-40.8	106.1	157.7	-168.2	176.2	10.9	0	0	104.6	T31 E35	T31-Q33 PolarHBondContact O-N 3.14Å; Q33-E35 PolarHBondContact O-N 3.31Å
34	E	51.8	Low	66.1	Low	172 Å²	172	149.3 Å²	149.3	80%	0.804	74%	0.738	S	S	*	*			trans	-62.1	92.1	163.7	-174	170.5	-170.9	0	0	102.3	R32 M36	R32-E34 VanDerWaalsContact C-N 3.26Å; R32-E34 PolarHBondContact O-N 3.06Å; E34-M36 PolarHBondContact O-N 3.3Å
35	E	58.2	Low	68	Low	151 Å²	151	142.3 Å²	142.3	71%	0.706	71%	0.714	S	S	*	*			trans	-51.4	112.8	171.5	-74.6	-179.2	160.7	0	0	104.1	Q33 I37	Q33-E35 PolarHBondContact O-N 3.31Å; E35-I37 WeakPolarHBondContact O-CG1 3.44Å; E35-I37 PolarHBondContact O-N 3.31Å
36	M	66.9	Low	70.1	Confident	188 Å²	188	142.7 Å²	142.7	93%	0.926	70%	0.701	S	S	*	*			trans	-62.3	94.1	172.5	-73.7	179.9	162.6	0	0	104.9	E34 D38	E34-M36 PolarHBondContact O-N 3.3Å; M36-D38 PolarHBondContact O-N 3.48Å
37	I	78.2	Confident	72.1	Confident	127 Å²	127	136.5 Å²	136.5	65%	0.651	68%	0.68	S	S	*	*			trans	-62.8	114.1	-179.4	-59.9	179.5	0	0	0	105.3	E35 H39	E35-I37 WeakPolarHBondContact O-CG1 3.44Å; E35-I37 PolarHBondContact O-N 3.31Å; I37-H39 PolarHBondContact O-CE1 3.29Å; I37-H39 VanDerWaalsContact O-CE1 3.31Å; I37-H39 PolarHBondContact O-N 3.22Å; I37-H39 PolarHBondContact O-ND1 2.88Å
38	D	78.7	Confident	74.3	Confident	117 Å²	117	139.1 Å²	139.1	63%	0.626	68%	0.678	S	S	*	*			trans	-69.2	116.6	170.5	-169.7	-0	0	0	0	107.3	M36 R40	M36-D38 PolarHBondContact O-N 3.48Å; D38-R40 PolarHBondContact O-N 3.09Å; D38-R40 VanDerWaalsContact OD1-CB 3.3Å; D38-R40 WeakPolarHBondContact OD1-CB 3.45Å; D38-R40 VanDerWaalsContact OD1-CG 3.24Å; D38-R40 WeakPolarHBondContact OD1-CG 3.41Å; D38-R40 PolarHBondContact OD1-N 3.47Å
39	H	86.3	Confident	76.3	Confident	166 Å²	166	135.7 Å²	135.7	77%	0.769	66%	0.657	S	S	*	*			trans	-81.1	-1.3	-179.9	-66	66.2	0	0	0	111.6	I37 L41	I37-H39 PolarHBondContact O-CE1 3.29Å; I37-H39 VanDerWaalsContact O-CE1 3.31Å; I37-H39 PolarHBondContact O-N 3.22Å; I37-H39 PolarHBondContact O-ND1 2.88Å; H39-L41 PolarHBondContact O-N 2.95Å
40	R	89.4	Confident	78.7	Confident	207 Å²	207	134 Å²	134	78%	0.781	64%	0.643	S	S	*	*			trans	-80.3	103.8	177.6	-62.2	-178.9	71.9	-179.2	1.5	109.8	D38	D38-R40 PolarHBondContact O-N 3.09Å; D38-R40 VanDerWaalsContact OD1-CB 3.3Å; D38-R40 WeakPolarHBondContact OD1-CB 3.45Å; D38-R40 VanDerWaalsContact OD1-CG 3.24Å; D38-R40 WeakPolarHBondContact OD1-CG 3.41Å; D38-R40 PolarHBondContact OD1-N 3.47Å
41	L	90.7	Very high	81.2	Confident	70 Å²	70	139 Å²	139	37%	0.366	65%	0.65	S	S	.	*			trans	-75.5	138.6	170.5	-60.3	172.5	0	0	0	110.2	H39 E45 W46 E49	H39-L41 PolarHBondContact O-N 2.95Å; L41-E45 HydrophobicContact CB-CB 4.13Å; L41-E45 HydrophobicContact CD2-CB 4.01Å; L41-W46 VanDerWaalsContact CB-CD1 3.4Å; L41-W46 HydrophobicContact CB-CD2 4.5Å; L41-W46 HydrophobicContact CB-CG 3.99Å; L41-W46 HydrophobicContact CD1-CD2 4.16Å; L41-W46 HydrophobicContact CD1-CG 4.31Å; L41-E49 HydrophobicContact CD1-CG 4.17Å
42	T	93.7	Very high	83.7	Confident	75 Å²	75	136.4 Å²	136.4	46%	0.46	63%	0.627	S	S	.	*			trans	-68.6	161.1	165.4	62	0	0	0	0	110.6	R44 E45 W46	T42-R44 PolarHBondContact O-N 3.25Å; T42-R44 VanDerWaalsContact O-N 3.11Å; T42-E45 WeakPolarHBondContact CB-OE2 3.37Å; T42-E45 WeakPolarHBondContact CG2-OE2 3.48Å; T42-E45 PolarHBondContact N-OE2 3.09Å; T42-E45 PolarHBondContact O-N 3.41Å; T42-E45 VanDerWaalsContact O-N 3.08Å; T42-E45 WeakPolarHBondContact OG1-CG 3.48Å; T42-E45 PolarHBondContact OG1-N 3.07Å; T42-E45 PolarHBondContact OG1-OE2 3.02Å; T42-W46 PolarHBondContact O-N 3.48Å
43	D	95.1	Very high	86.1	Confident	151 Å²	151	129.3 Å²	129.3	81%	0.807	61%	0.606	S	S	*	*	H	α-helix	trans	-56.2	-31.8	178.8	-65.8	-34.9	0	0	0	112.9	A47	D43-A47 PolarHBondContact O-N 2.97Å; D43-A47 VanDerWaalsContact O-N 3.14Å
44	R	95.6	Very high	88.6	Confident	173 Å²	173	126.1 Å²	126.1	65%	0.653	59%	0.594	S	S	*	*	H	α-helix	trans	-69.9	-48.2	175.8	-178.1	178.6	64.8	136.8	2.4	111.9	T42 W46 A47 E48	T42-R44 PolarHBondContact O-N 3.25Å; T42-R44 VanDerWaalsContact O-N 3.11Å; R44-W46 VanDerWaalsContact C-N 3.3Å; R44-W46 PolarHBondContact O-N 3.32Å; R44-A47 PolarHBondContact O-N 3.12Å; R44-E48 WeakPolarHBondContact O-CG 3.42Å; R44-E48 PolarHBondContact O-N 3.47Å
45	E	95.3	Very high	90.8	Very high	73 Å²	73	123.2 Å²	123.2	34%	0.341	58%	0.581	S	S	.	*	H	α-helix	trans	-65	-37.5	178.7	-68.7	159.6	152.1	0	0	110.8	L41 T42 A47 E48 E49	L41-E45 HydrophobicContact CB-CB 4.13Å; L41-E45 HydrophobicContact CD2-CB 4.01Å; T42-E45 WeakPolarHBondContact CB-OE2 3.37Å; T42-E45 WeakPolarHBondContact CG2-OE2 3.48Å; T42-E45 PolarHBondContact N-OE2 3.09Å; T42-E45 PolarHBondContact O-N 3.41Å; T42-E45 VanDerWaalsContact O-N 3.08Å; T42-E45 WeakPolarHBondContact OG1-CG 3.48Å; T42-E45 PolarHBondContact OG1-N 3.07Å; T42-E45 PolarHBondContact OG1-OE2 3.02Å; E45-A47 VanDerWaalsContact C-N 3.35Å; E45-A47 PolarHBondContact O-N 3.3Å; E45-E48 PolarHBondContact O-N 3.19Å; E45-E49 WeakPolarHBondContact O-CB 3.49Å; E45-E49 WeakPolarHBondContact O-CG 3.36Å; E45-E49 PolarHBondContact O-N 3.36Å
46	W	96.9	Very high	92.7	Very high	125 Å²	125	119.7 Å²	119.7	47%	0.473	57%	0.566	S	S	.	*	H	α-helix	trans	-56.3	-47.2	170.6	-97.3	109.6	0	0	0	112.3	L41 T42 R44 E48 E49 W50	L41-W46 VanDerWaalsContact CB-CD1 3.4Å; L41-W46 HydrophobicContact CB-CD2 4.5Å; L41-W46 HydrophobicContact CB-CG 3.99Å; L41-W46 HydrophobicContact CD1-CD2 4.16Å; L41-W46 HydrophobicContact CD1-CG 4.31Å; T42-W46 PolarHBondContact O-N 3.48Å; R44-W46 VanDerWaalsContact C-N 3.3Å; R44-W46 PolarHBondContact O-N 3.32Å; W46-E48 VanDerWaalsContact C-N 3.33Å; W46-E48 PolarHBondContact O-N 2.99Å; W46-E49 PolarHBondContact O-N 3.33Å; W46-W50 AromaticContact CE3-CD1 3.68Å; W46-W50 AromaticContact CE3-NE1 3.23Å; W46-W50 AromaticContact CZ3-CE2 3.95Å; W46-W50 HydrophobicContact CZ3-CZ2 4.18Å; W46-W50 AromaticContact CZ3-NE1 3.38Å; W46-W50 PolarHBondContact O-N 2.9Å
47	A	97.1	Very high	94.2	Very high	61 Å²	61	115.8 Å²	115.8	50%	0.504	55%	0.548	S	S	.	.	H	α-helix	trans	-64.3	-38.1	178.9	0	0	0	0	0	112.4	D43 R44 E45 K51	D43-A47 PolarHBondContact O-N 2.97Å; D43-A47 VanDerWaalsContact O-N 3.14Å; R44-A47 PolarHBondContact O-N 3.12Å; E45-A47 VanDerWaalsContact C-N 3.35Å; E45-A47 PolarHBondContact O-N 3.3Å; A47-K51 WeakPolarHBondContact O-CB 3.34Å; A47-K51 PolarHBondContact O-N 2.87Å
48	E	97.1	Very high	95.2	Very high	108 Å²	108	113.1 Å²	113.1	51%	0.505	54%	0.536	S	S	.	.	H	α-helix	trans	-67.2	-43.5	176.9	-72.1	175.3	-168.5	0	0	111.9	R44 E45 W46 K51 H52	R44-E48 WeakPolarHBondContact O-CG 3.42Å; R44-E48 PolarHBondContact O-N 3.47Å; E45-E48 PolarHBondContact O-N 3.19Å; W46-E48 VanDerWaalsContact C-N 3.33Å; W46-E48 PolarHBondContact O-N 2.99Å; E48-K51 CarbonylContact O-C 3.6Å; E48-K51 WeakPolarHBondContact O-CB 3.46Å; E48-K51 PolarHBondContact O-N 2.87Å; E48-H52 WeakPolarHBondContact O-CB 3.47Å; E48-H52 PolarHBondContact O-N 3.23Å
49	E	96.8	Very high	96.2	Very high	98 Å²	98	110 Å²	110	46%	0.458	52%	0.522	S	S	.	.	H	α-helix	trans	-63.8	-42.7	176.2	-75.4	-65.1	103.8	0	0	111.9	L41 E45 W46 K51 H52 L53	L41-E49 HydrophobicContact CD1-CG 4.17Å; E45-E49 WeakPolarHBondContact O-CB 3.49Å; E45-E49 WeakPolarHBondContact O-CG 3.36Å; E45-E49 PolarHBondContact O-N 3.36Å; W46-E49 PolarHBondContact O-N 3.33Å; E49-K51 VanDerWaalsContact C-N 3.32Å; E49-K51 PolarHBondContact O-N 3.12Å; E49-H52 WeakPolarHBondContact O-CB 3.33Å; E49-H52 PolarHBondContact O-N 2.93Å; E49-H52 VanDerWaalsContact O-N 3.14Å; E49-L53 WeakPolarHBondContact O-CG 3.35Å; E49-L53 PolarHBondContact O-N 3.27Å
50	W	98.1	Very high	96.8	Very high	161 Å²	161	107 Å²	107	61%	0.61	51%	0.511	S	S	*	.	H	α-helix	trans	-60.8	-42.4	174.1	-83.6	116.4	0	0	0	112.3	W46 H52 L53 D54	W46-W50 AromaticContact CE3-CD1 3.68Å; W46-W50 AromaticContact CE3-NE1 3.23Å; W46-W50 AromaticContact CZ3-CE2 3.95Å; W46-W50 HydrophobicContact CZ3-CZ2 4.18Å; W46-W50 AromaticContact CZ3-NE1 3.38Å; W46-W50 PolarHBondContact O-N 2.9Å; W50-H52 VanDerWaalsContact C-N 3.32Å; W50-L53 HydrophobicContact CE3-CD1 4.16Å; W50-L53 HydrophobicContact CZ3-CD1 4.31Å; W50-L53 PolarHBondContact O-N 2.92Å; W50-D54 PolarHBondContact O-N 3.37Å
51	K	98.3	Very high	97.2	Very high	158 Å²	158	102.6 Å²	102.6	69%	0.687	50%	0.5	S	S	*	.	H	α-helix	trans	-64.7	-37.9	174.3	-178.3	-176.5	174.9	-174.6	0	111.5	A47 E48 E49 D54 H55	A47-K51 WeakPolarHBondContact O-CB 3.34Å; A47-K51 PolarHBondContact O-N 2.87Å; E48-K51 CarbonylContact O-C 3.6Å; E48-K51 WeakPolarHBondContact O-CB 3.46Å; E48-K51 PolarHBondContact O-N 2.87Å; E49-K51 VanDerWaalsContact C-N 3.32Å; E49-K51 PolarHBondContact O-N 3.12Å; K51-D54 PolarHBondContact O-N 3.34Å; K51-H55 WeakPolarHBondContact O-CB 3.29Å; K51-H55 PolarHBondContact O-N 3.47Å
52	H	98.3	Very high	97.6	Very high	93 Å²	93	102.3 Å²	102.3	43%	0.431	50%	0.499	S	S	.	.	H	α-helix	trans	-64.3	-45	176.7	-174.1	63.6	0	0	0	111.1	E48 E49 W50 H55 L56	E48-H52 WeakPolarHBondContact O-CB 3.47Å; E48-H52 PolarHBondContact O-N 3.23Å; E49-H52 WeakPolarHBondContact O-CB 3.33Å; E49-H52 PolarHBondContact O-N 2.93Å; E49-H52 VanDerWaalsContact O-N 3.14Å; W50-H52 VanDerWaalsContact C-N 3.32Å; H52-H55 PolarHBondContact O-N 2.81Å; H52-L56 WeakPolarHBondContact NE2-CD1 3.45Å; H52-L56 WeakPolarHBondContact O-CG 3.32Å; H52-L56 PolarHBondContact O-N 3.12Å
53	L	98.7	Very high	97.8	Very high	82 Å²	82	104.1 Å²	104.1	43%	0.429	50%	0.504	S	S	.	.	H	α-helix	trans	-59.6	-47.1	174.4	-71.9	174.7	0	0	0	111.9	E49 W50 H55 L56 L57	E49-L53 WeakPolarHBondContact O-CG 3.35Å; E49-L53 PolarHBondContact O-N 3.27Å; W50-L53 HydrophobicContact CE3-CD1 4.16Å; W50-L53 HydrophobicContact CZ3-CD1 4.31Å; W50-L53 PolarHBondContact O-N 2.92Å; L53-H55 VanDerWaalsContact C-N 3.31Å; L53-H55 PolarHBondContact O-N 3.36Å; L53-L56 PolarHBondContact O-N 2.7Å; L53-L57 WeakPolarHBondContact O-CG 3.49Å; L53-L57 PolarHBondContact O-N 3.31Å
54	D	98.6	Very high	98	Very high	93 Å²	93	101.4 Å²	101.4	50%	0.497	49%	0.493	S	S	.	.	H	α-helix	trans	-57.8	-45.3	175.3	179.8	76.7	0	0	0	111.4	W50 K51 L56 L57 N58	W50-D54 PolarHBondContact O-N 3.37Å; K51-D54 PolarHBondContact O-N 3.34Å; D54-L56 PolarHBondContact O-N 3.5Å; D54-L57 PolarHBondContact O-N 3.02Å; D54-N58 WeakPolarHBondContact O-CB 3.4Å; D54-N58 VanDerWaalsContact O-CG 3.31Å; D54-N58 PolarHBondContact O-N 2.97Å; D54-N58 PolarHBondContact O-ND2 3.19Å; D54-N58 PolarHBondContact OD2-ND2 3.11Å
55	H	98.6	Very high	98.2	Very high	111 Å²	111	95.2 Å²	95.2	51%	0.514	47%	0.471	S	S	.	.	H	α-helix	trans	-62.6	-42.2	177.2	-175.8	64.5	0	0	0	112.9	K51 H52 L53 N58 C59	K51-H55 WeakPolarHBondContact O-CB 3.29Å; K51-H55 PolarHBondContact O-N 3.47Å; H52-H55 PolarHBondContact O-N 2.81Å; L53-H55 VanDerWaalsContact C-N 3.31Å; L53-H55 PolarHBondContact O-N 3.36Å; H55-N58 PolarHBondContact O-N 2.73Å; H55-C59 PolarHBondContact O-N 3.29Å; H55-C59 PolarHBondContact O-SG 3.38Å
56	L	98.8	Very high	98.3	Very high	76 Å²	76	96.8 Å²	96.8	40%	0.398	48%	0.477	S	S	.	.	H	α-helix	trans	-62.8	-44.5	176.8	-74.1	177.7	0	0	0	111.8	H52 L53 D54 N58 C59 I60	H52-L56 WeakPolarHBondContact NE2-CD1 3.45Å; H52-L56 WeakPolarHBondContact O-CG 3.32Å; H52-L56 PolarHBondContact O-N 3.12Å; L53-L56 PolarHBondContact O-N 2.7Å; D54-L56 PolarHBondContact O-N 3.5Å; L56-N58 VanDerWaalsContact C-N 3.32Å; L56-N58 PolarHBondContact O-N 3.24Å; L56-C59 WeakPolarHBondContact O-CB 3.27Å; L56-C59 PolarHBondContact O-N 3.22Å; L56-I60 WeakPolarHBondContact O-CG1 3.44Å; L56-I60 PolarHBondContact O-N 2.97Å
57	L	98.8	Very high	98.4	Very high	106 Å²	106	94.7 Å²	94.7	56%	0.555	48%	0.478	S	S	*	.	H	α-helix	trans	-62.4	-42.5	176.5	-68.4	175.7	0	0	0	111.1	L53 D54 C59 I60 M61	L53-L57 WeakPolarHBondContact O-CG 3.49Å; L53-L57 PolarHBondContact O-N 3.31Å; D54-L57 PolarHBondContact O-N 3.02Å; L57-C59 VanDerWaalsContact C-N 3.33Å; L57-C59 PolarHBondContact O-N 3.41Å; L57-I60 PolarHBondContact O-N 3.26Å; L57-M61 WeakPolarHBondContact O-CG 3.46Å; L57-M61 PolarHBondContact O-N 3.13Å
58	N	98.6	Very high	98.5	Very high	72 Å²	72	99 Å²	99	39%	0.385	48%	0.481	S	S	.	.	H	α-helix	trans	-61	-40.6	173.9	-76	-43.5	0	0	0	112.3	D54 H55 L56 M61 D62	D54-N58 WeakPolarHBondContact O-CB 3.4Å; D54-N58 VanDerWaalsContact O-CG 3.31Å; D54-N58 PolarHBondContact O-N 2.97Å; D54-N58 PolarHBondContact O-ND2 3.19Å; D54-N58 PolarHBondContact OD2-ND2 3.11Å; H55-N58 PolarHBondContact O-N 2.73Å; L56-N58 VanDerWaalsContact C-N 3.32Å; L56-N58 PolarHBondContact O-N 3.24Å; N58-M61 PolarHBondContact O-N 3.09Å; N58-M61 WeakPolarHBondContact OD1-CE 3.45Å; N58-D62 WeakPolarHBondContact O-CB 3.38Å; N58-D62 PolarHBondContact O-N 3.34Å
59	C	98.8	Very high	98.6	Very high	50 Å²	50	100.6 Å²	100.6	34%	0.338	48%	0.483	S	S	.	.	H	α-helix	trans	-63.3	-42.7	174.6	-70.8	0	0	0	0	112.1	H55 L56 L57 D62 M63	H55-C59 PolarHBondContact O-N 3.29Å; H55-C59 PolarHBondContact O-SG 3.38Å; L56-C59 WeakPolarHBondContact O-CB 3.27Å; L56-C59 PolarHBondContact O-N 3.22Å; L57-C59 VanDerWaalsContact C-N 3.33Å; L57-C59 PolarHBondContact O-N 3.41Å; C59-D62 PolarHBondContact O-N 2.96Å; C59-M63 VanDerWaalsContact O-CG 3.28Å; C59-M63 WeakPolarHBondContact O-CG 3.41Å; C59-M63 PolarHBondContact O-N 3.49Å
60	I	98.8	Very high	98.7	Very high	103 Å²	103	99 Å²	99	53%	0.528	48%	0.482	S	S	.	.	H	α-helix	trans	-61.4	-48.6	176.6	-68.6	165.2	0	0	0	110.1	L56 L57 D62 M63 V64	L56-I60 WeakPolarHBondContact O-CG1 3.44Å; L56-I60 PolarHBondContact O-N 2.97Å; L57-I60 PolarHBondContact O-N 3.26Å; I60-D62 VanDerWaalsContact C-N 3.32Å; I60-D62 PolarHBondContact O-N 2.94Å; I60-M63 PolarHBondContact O-N 3.09Å; I60-V64 WeakPolarHBondContact O-CG2 3.42Å; I60-V64 PolarHBondContact O-N 2.73Å
61	M	98.7	Very high	98.7	Very high	115 Å²	115	95.4 Å²	95.4	57%	0.567	47%	0.474	S	S	*	.	H	α-helix	trans	-59.2	-42.8	177.9	-70.8	-169.5	-62.1	0	0	112	L57 N58 V64 E65	L57-M61 WeakPolarHBondContact O-CG 3.46Å; L57-M61 PolarHBondContact O-N 3.13Å; N58-M61 PolarHBondContact O-N 3.09Å; N58-M61 WeakPolarHBondContact OD1-CE 3.45Å; M61-V64 PolarHBondContact O-N 2.82Å; M61-E65 WeakPolarHBondContact O-CB 3.07Å; M61-E65 PolarHBondContact O-N 3.5Å
62	D	98.8	Very high	98.7	Very high	65 Å²	65	91.1 Å²	91.1	35%	0.348	46%	0.461	S	S	.	.	H	α-helix	trans	-64.2	-40.8	177.2	-179.6	56.8	0	0	0	112.3	N58 C59 I60 E65 K66	N58-D62 WeakPolarHBondContact O-CB 3.38Å; N58-D62 PolarHBondContact O-N 3.34Å; C59-D62 PolarHBondContact O-N 2.96Å; I60-D62 VanDerWaalsContact C-N 3.32Å; I60-D62 PolarHBondContact O-N 2.94Å; D62-E65 PolarHBondContact O-N 2.94Å; D62-K66 WeakPolarHBondContact O-CB 3.35Å; D62-K66 VanDerWaalsContact O-CG 3.3Å; D62-K66 WeakPolarHBondContact O-CG 3.43Å; D62-K66 PolarHBondContact O-N 3.36Å; D62-K66 WeakPolarHBondContact OD2-CE 3.3Å; D62-K66 IonicContact OD2-NZ 3.5Å; D62-K66 PolarHBondContact OD2-NZ 2.91Å
63	M	98.9	Very high	98.8	Very high	113 Å²	113	90.9 Å²	90.9	56%	0.557	47%	0.466	S	S	*	.	H	α-helix	trans	-64.4	-40.7	175.4	-69.4	-63.5	170.3	0	0	112.1	C59 I60 E65 K66 T67	C59-M63 VanDerWaalsContact O-CG 3.28Å; C59-M63 WeakPolarHBondContact O-CG 3.41Å; C59-M63 PolarHBondContact O-N 3.49Å; I60-M63 PolarHBondContact O-N 3.09Å; M63-E65 VanDerWaalsContact C-N 3.34Å; M63-K66 PolarHBondContact O-N 3Å; M63-K66 HydrophobicContact SD-CD 4.44Å; M63-T67 WeakPolarHBondContact O-CB 3.49Å; M63-T67 PolarHBondContact O-N 3.46Å; M63-T67 PolarHBondContact O-OG1 3.44Å
64	V	98.9	Very high	98.8	Very high	94 Å²	94	91.9 Å²	91.9	57%	0.57	47%	0.471	S	S	*	.	H	α-helix	trans	-62.4	-44.3	174.3	171.1	0	0	0	0	110.4	I60 M61 T67 R68	I60-V64 WeakPolarHBondContact O-CG2 3.42Å; I60-V64 PolarHBondContact O-N 2.73Å; M61-V64 PolarHBondContact O-N 2.82Å; V64-T67 WeakPolarHBondContact O-CB 3.46Å; V64-T67 PolarHBondContact O-N 2.94Å; V64-R68 PolarHBondContact O-N 2.9Å
65	E	98.8	Very high	98.8	Very high	43 Å²	43	95.2 Å²	95.2	20%	0.201	48%	0.477	C	S	.	.	H	α-helix	trans	-67.8	-40.3	-179.6	179.3	58.9	-166.1	0	0	112.3	M61 D62 M63 T67 R68 R69	M61-E65 WeakPolarHBondContact O-CB 3.07Å; M61-E65 PolarHBondContact O-N 3.5Å; D62-E65 PolarHBondContact O-N 2.94Å; M63-E65 VanDerWaalsContact C-N 3.34Å; E65-T67 VanDerWaalsContact C-N 3.3Å; E65-T67 PolarHBondContact O-N 3.23Å; E65-R68 VanDerWaalsContact CD-NH2 3.3Å; E65-R68 WeakPolarHBondContact O-CB 3.06Å; E65-R68 PolarHBondContact O-N 3.23Å; E65-R68 IonicContact OE1-CZ 3.09Å; E65-R68 IonicContact OE1-NE 2.64Å; E65-R68 PolarHBondContact OE1-NE 2.91Å; E65-R68 IonicContact OE1-NH2 2.73Å; E65-R68 PolarHBondContact OE1-NH2 3.39Å; E65-R68 IonicContact OE2-CZ 3.91Å; E65-R68 VanDerWaalsContact OE2-CZ 3.24Å; E65-R68 IonicContact OE2-NE 2.7Å; E65-R68 PolarHBondContact OE2-NE 2.86Å; E65-R68 IonicContact OE2-NH2 3.52Å; E65-R68 PolarHBondContact OE2-NH2 2.64Å; E65-R68 VanDerWaalsContact OE2-NH2 3.09Å; E65-R69 WeakPolarHBondContact O-CG 3.4Å; E65-R69 PolarHBondContact O-N 2.99Å; E65-R69 IonicContact OE1-CZ 3.04Å; E65-R69 IonicContact OE1-NE 3.12Å; E65-R69 PolarHBondContact OE1-NE 3.4Å; E65-R69 VanDerWaalsContact OE1-NE 3.12Å; E65-R69 IonicContact OE1-NH1 3.24Å; E65-R69 IonicContact OE1-NH2 2.73Å; E65-R69 PolarHBondContact OE1-NH2 3.4Å
66	K	98.6	Very high	98.8	Very high	105 Å²	105	98 Å²	98	46%	0.457	48%	0.483	S	S	.	.	H	α-helix	trans	-59.2	-43.5	171.1	-78	169.4	174.4	164.9	0	111.2	D62 M63 R69 S70	D62-K66 WeakPolarHBondContact O-CB 3.35Å; D62-K66 VanDerWaalsContact O-CG 3.3Å; D62-K66 WeakPolarHBondContact O-CG 3.43Å; D62-K66 PolarHBondContact O-N 3.36Å; D62-K66 WeakPolarHBondContact OD2-CE 3.3Å; D62-K66 IonicContact OD2-NZ 3.5Å; D62-K66 PolarHBondContact OD2-NZ 2.91Å; M63-K66 PolarHBondContact O-N 3Å; M63-K66 HydrophobicContact SD-CD 4.44Å; K66-R69 PolarHBondContact O-N 2.94Å; K66-S70 WeakPolarHBondContact O-CB 3.4Å; K66-S70 PolarHBondContact O-N 2.96Å
67	T	98.9	Very high	98.8	Very high	81 Å²	81	97.5 Å²	97.5	50%	0.497	49%	0.485	S	S	.	.	H	α-helix	trans	-62.1	-45.1	176.2	-57.5	0	0	0	0	111	M63 V64 E65 R69 S70 L71	M63-T67 WeakPolarHBondContact O-CB 3.49Å; M63-T67 PolarHBondContact O-N 3.46Å; M63-T67 PolarHBondContact O-OG1 3.44Å; V64-T67 WeakPolarHBondContact O-CB 3.46Å; V64-T67 PolarHBondContact O-N 2.94Å; E65-T67 VanDerWaalsContact C-N 3.3Å; E65-T67 PolarHBondContact O-N 3.23Å; T67-R69 VanDerWaalsContact C-N 3.34Å; T67-R69 PolarHBondContact O-N 2.94Å; T67-S70 WeakPolarHBondContact O-CB 3.38Å; T67-S70 PolarHBondContact O-N 3.24Å; T67-L71 HydrophobicContact CG2-CD1 4.24Å; T67-L71 HydrophobicContact CG2-CG 4.46Å; T67-L71 WeakPolarHBondContact O-CG 3.4Å; T67-L71 PolarHBondContact O-N 3.26Å
68	R	98.8	Very high	98.8	Very high	153 Å²	153	98.5 Å²	98.5	58%	0.577	49%	0.487	S	S	*	.	H	α-helix	trans	-56.8	-46.3	176.6	-172.1	178.9	74	127.3	0.7	112	V64 E65 L71 T72	V64-R68 PolarHBondContact O-N 2.9Å; E65-R68 VanDerWaalsContact CD-NH2 3.3Å; E65-R68 WeakPolarHBondContact O-CB 3.06Å; E65-R68 PolarHBondContact O-N 3.23Å; E65-R68 IonicContact OE1-CZ 3.09Å; E65-R68 IonicContact OE1-NE 2.64Å; E65-R68 PolarHBondContact OE1-NE 2.91Å; E65-R68 IonicContact OE1-NH2 2.73Å; E65-R68 PolarHBondContact OE1-NH2 3.39Å; E65-R68 IonicContact OE2-CZ 3.91Å; E65-R68 VanDerWaalsContact OE2-CZ 3.24Å; E65-R68 IonicContact OE2-NE 2.7Å; E65-R68 PolarHBondContact OE2-NE 2.86Å; E65-R68 IonicContact OE2-NH2 3.52Å; E65-R68 PolarHBondContact OE2-NH2 2.64Å; E65-R68 VanDerWaalsContact OE2-NH2 3.09Å; R68-L71 PolarHBondContact O-N 3.28Å; R68-T72 PolarHBondContact O-N 2.78Å; R68-T72 PolarHBondContact O-OG1 2.97Å
69	R	98.8	Very high	98.7	Very high	141 Å²	141	99.7 Å²	99.7	53%	0.532	49%	0.49	S	S	.	.	H	α-helix	trans	-64.7	-44.7	177	-69.7	177.9	-175.4	131.1	7	112	E65 K66 T67 L71 T72 V73	E65-R69 WeakPolarHBondContact O-CG 3.4Å; E65-R69 PolarHBondContact O-N 2.99Å; E65-R69 IonicContact OE1-CZ 3.04Å; E65-R69 IonicContact OE1-NE 3.12Å; E65-R69 PolarHBondContact OE1-NE 3.4Å; E65-R69 VanDerWaalsContact OE1-NE 3.12Å; E65-R69 IonicContact OE1-NH1 3.24Å; E65-R69 IonicContact OE1-NH2 2.73Å; E65-R69 PolarHBondContact OE1-NH2 3.4Å; K66-R69 PolarHBondContact O-N 2.94Å; T67-R69 VanDerWaalsContact C-N 3.34Å; T67-R69 PolarHBondContact O-N 2.94Å; R69-L71 VanDerWaalsContact C-N 3.32Å; R69-L71 PolarHBondContact O-N 3.36Å; R69-T72 WeakPolarHBondContact O-CB 3.44Å; R69-T72 PolarHBondContact O-N 2.93Å; R69-T72 VanDerWaalsContact O-N 3.11Å; R69-V73 PolarHBondContact O-N 3.46Å
70	S	98.8	Very high	98.7	Very high	63 Å²	63	99.7 Å²	99.7	44%	0.441	49%	0.494	S	S	.	.	H	α-helix	trans	-57.3	-44.9	176	-177.9	0	0	0	0	111.8	K66 T67 T72 V73 L74	K66-S70 WeakPolarHBondContact O-CB 3.4Å; K66-S70 PolarHBondContact O-N 2.96Å; T67-S70 WeakPolarHBondContact O-CB 3.38Å; T67-S70 PolarHBondContact O-N 3.24Å; S70-T72 VanDerWaalsContact C-N 3.27Å; S70-T72 PolarHBondContact O-N 3.23Å; S70-V73 WeakPolarHBondContact O-CB 3.28Å; S70-V73 PolarHBondContact O-N 2.88Å; S70-V73 VanDerWaalsContact O-N 3.09Å; S70-L74 PolarHBondContact O-N 3.25Å
71	L	98.8	Very high	98.7	Very high	87 Å²	87	99.8 Å²	99.8	46%	0.455	50%	0.495	S	S	.	.	H	α-helix	trans	-62.2	-32.5	177	-71.2	174	0	0	0	113.1	T67 R68 R69 L74 R75	T67-L71 HydrophobicContact CG2-CD1 4.24Å; T67-L71 HydrophobicContact CG2-CG 4.46Å; T67-L71 WeakPolarHBondContact O-CG 3.4Å; T67-L71 PolarHBondContact O-N 3.26Å; R68-L71 PolarHBondContact O-N 3.28Å; R69-L71 VanDerWaalsContact C-N 3.32Å; R69-L71 PolarHBondContact O-N 3.36Å; L71-L74 HydrophobicContact CD2-CD1 4.32Å; L71-L74 PolarHBondContact O-N 3.24Å; L71-R75 WeakPolarHBondContact O-CB 3.36Å; L71-R75 VanDerWaalsContact O-CG 3.27Å; L71-R75 WeakPolarHBondContact O-CG 3.4Å; L71-R75 PolarHBondContact O-N 2.93Å
72	T	98.7	Very high	98.7	Very high	67 Å²	67	100.5 Å²	100.5	41%	0.411	49%	0.492	S	S	.	.	H	α-helix	trans	-65.9	-41.3	174.6	-59.9	0	0	0	0	111.3	R68 R69 S70 R76	R68-T72 PolarHBondContact O-N 2.78Å; R68-T72 PolarHBondContact O-OG1 2.97Å; R69-T72 WeakPolarHBondContact O-CB 3.44Å; R69-T72 PolarHBondContact O-N 2.93Å; R69-T72 VanDerWaalsContact O-N 3.11Å; S70-T72 VanDerWaalsContact C-N 3.27Å; S70-T72 PolarHBondContact O-N 3.23Å; T72-R76 WeakPolarHBondContact O-CG 3.49Å; T72-R76 PolarHBondContact O-N 3.34Å
73	V	98.8	Very high	98.7	Very high	89 Å²	89	103.1 Å²	103.1	54%	0.539	50%	0.502	S	S	.	.	H	α-helix	trans	-63.9	-48.2	175.2	177.8	0	0	0	0	110.4	R69 S70 R75 R76 C77	R69-V73 PolarHBondContact O-N 3.46Å; S70-V73 WeakPolarHBondContact O-CB 3.28Å; S70-V73 PolarHBondContact O-N 2.88Å; S70-V73 VanDerWaalsContact O-N 3.09Å; V73-R75 VanDerWaalsContact C-N 3.31Å; V73-R75 PolarHBondContact O-N 2.93Å; V73-R76 PolarHBondContact O-N 2.88Å; V73-R76 VanDerWaalsContact O-N 3.13Å; V73-C77 PolarHBondContact O-N 3.34Å; V73-C77 PolarHBondContact O-SG 2.96Å; V73-C77 VanDerWaalsContact O-SG 3.36Å
74	L	98.8	Very high	98.7	Very high	102 Å²	102	102.9 Å²	102.9	53%	0.534	50%	0.5	S	S	.	.	H	α-helix	trans	-59.1	-40.5	179.2	-71.5	172	0	0	0	112.7	S70 L71 C77 Q78	S70-L74 PolarHBondContact O-N 3.25Å; L71-L74 HydrophobicContact CD2-CD1 4.32Å; L71-L74 PolarHBondContact O-N 3.24Å; L74-C77 PolarHBondContact O-N 2.97Å; L74-Q78 WeakPolarHBondContact O-CB 3.34Å; L74-Q78 PolarHBondContact O-N 3.42Å
75	R	98.7	Very high	98.6	Very high	163 Å²	163	103.5 Å²	103.5	62%	0.615	50%	0.499	S	S	*	.	H	α-helix	trans	-62.3	-43.5	175.6	-76.2	177	-176.2	-144.5	1.8	112.2	L71 V73 Q78 E79	L71-R75 WeakPolarHBondContact O-CB 3.36Å; L71-R75 VanDerWaalsContact O-CG 3.27Å; L71-R75 WeakPolarHBondContact O-CG 3.4Å; L71-R75 PolarHBondContact O-N 2.93Å; V73-R75 VanDerWaalsContact C-N 3.31Å; V73-R75 PolarHBondContact O-N 2.93Å; R75-Q78 WeakPolarHBondContact O-CB 3.36Å; R75-Q78 PolarHBondContact O-N 3.36Å; R75-E79 WeakPolarHBondContact O-CG 3.42Å; R75-E79 PolarHBondContact O-N 3.2Å
76	R	98.7	Very high	98.6	Very high	171 Å²	171	104 Å²	104	65%	0.645	50%	0.503	S	S	*	.	H	α-helix	trans	-64.2	-41.5	176.9	-70.8	177.3	-179.8	-177.9	-0	112.1	T72 V73 Q78 E79 A80	T72-R76 WeakPolarHBondContact O-CG 3.49Å; T72-R76 PolarHBondContact O-N 3.34Å; V73-R76 PolarHBondContact O-N 2.88Å; V73-R76 VanDerWaalsContact O-N 3.13Å; R76-Q78 VanDerWaalsContact C-N 3.35Å; R76-E79 PolarHBondContact O-N 3.2Å; R76-A80 PolarHBondContact O-N 3.45Å
77	C	98.6	Very high	98.6	Very high	65 Å²	65	104.4 Å²	104.4	44%	0.439	50%	0.503	S	S	.	.	H	α-helix	trans	-59.4	-47.6	173.6	-66	0	0	0	0	110.9	V73 L74 E79 A80 D81	V73-C77 PolarHBondContact O-N 3.34Å; V73-C77 PolarHBondContact O-SG 2.96Å; V73-C77 VanDerWaalsContact O-SG 3.36Å; L74-C77 PolarHBondContact O-N 2.97Å; C77-E79 VanDerWaalsContact C-N 3.32Å; C77-E79 PolarHBondContact O-N 3.48Å; C77-A80 PolarHBondContact O-N 3.14Å; C77-D81 VanDerWaalsContact O-CG 3.23Å; C77-D81 PolarHBondContact O-N 3.41Å
78	Q	98.6	Very high	98.5	Very high	127 Å²	127	107 Å²	107	59%	0.593	50%	0.503	S	S	*	.	H	α-helix	trans	-59.8	-40.8	177.3	-171.4	-147.1	-14.9	0	0	112.6	L74 R75 R76 R82	L74-Q78 WeakPolarHBondContact O-CB 3.34Å; L74-Q78 PolarHBondContact O-N 3.42Å; R75-Q78 WeakPolarHBondContact O-CB 3.36Å; R75-Q78 PolarHBondContact O-N 3.36Å; R76-Q78 VanDerWaalsContact C-N 3.35Å; Q78-R82 WeakPolarHBondContact O-CB 3.42Å; Q78-R82 PolarHBondContact O-N 2.92Å
79	E	98.6	Very high	98.4	Very high	97 Å²	97	104.3 Å²	104.3	45%	0.453	50%	0.499	S	S	.	.	H	α-helix	trans	-63.5	-45.1	176.9	-75.5	166.7	-174.6	0	0	111.5	R75 R76 C77 R82 E83	R75-E79 WeakPolarHBondContact O-CG 3.42Å; R75-E79 PolarHBondContact O-N 3.2Å; R76-E79 PolarHBondContact O-N 3.2Å; C77-E79 VanDerWaalsContact C-N 3.32Å; C77-E79 PolarHBondContact O-N 3.48Å; E79-R82 PolarHBondContact O-N 3.05Å; E79-E83 WeakPolarHBondContact O-CG 3.42Å; E79-E83 PolarHBondContact O-N 2.79Å
80	A	98.5	Very high	98.3	Very high	50 Å²	50	104.9 Å²	104.9	41%	0.413	50%	0.502	S	S	.	.	H	α-helix	trans	-62.3	-46.3	176.5	0	0	0	0	0	112	R76 C77 R82 E83 E84	R76-A80 PolarHBondContact O-N 3.45Å; C77-A80 PolarHBondContact O-N 3.14Å; A80-R82 VanDerWaalsContact C-N 3.27Å; A80-R82 PolarHBondContact O-N 3.46Å; A80-E83 PolarHBondContact O-N 3.26Å; A80-E83 VanDerWaalsContact O-N 3.12Å; A80-E84 PolarHBondContact O-N 3.43Å
81	D	98.6	Very high	98.1	Very high	104 Å²	104	108.5 Å²	108.5	56%	0.556	51%	0.506	S	S	*	.	H	α-helix	trans	-59.8	-40.5	177.3	-66.6	-15	0	0	0	111.2	C77 E84 L85	C77-D81 VanDerWaalsContact O-CG 3.23Å; C77-D81 PolarHBondContact O-N 3.41Å; D81-E84 PolarHBondContact O-N 3.26Å; D81-L85 WeakPolarHBondContact O-CB 3.38Å; D81-L85 PolarHBondContact O-N 3.48Å
82	R	98.4	Very high	97.8	Very high	130 Å²	130	111.8 Å²	111.8	49%	0.491	51%	0.513	S	S	.	.	H	α-helix	trans	-65.9	-40.3	176.2	-176.5	-176.7	63.9	82	8.6	111.6	Q78 E79 A80 N86	Q78-R82 WeakPolarHBondContact O-CB 3.42Å; Q78-R82 PolarHBondContact O-N 2.92Å; E79-R82 PolarHBondContact O-N 3.05Å; A80-R82 VanDerWaalsContact C-N 3.27Å; A80-R82 PolarHBondContact O-N 3.46Å; R82-N86 WeakPolarHBondContact O-CB 3.44Å; R82-N86 PolarHBondContact O-N 3.44Å; R82-N86 VanDerWaalsContact O-N 3.09Å; R82-N86 PolarHBondContact O-ND2 3.01Å
83	E	98.5	Very high	97.5	Very high	120 Å²	120	111.3 Å²	111.3	56%	0.561	51%	0.512	S	S	*	.	H	α-helix	trans	-66.2	-42.2	176.6	-75.3	174.1	-172.9	0	0	111.7	E79 A80 N86 Y87	E79-E83 WeakPolarHBondContact O-CG 3.42Å; E79-E83 PolarHBondContact O-N 2.79Å; A80-E83 PolarHBondContact O-N 3.26Å; A80-E83 VanDerWaalsContact O-N 3.12Å; E83-N86 WeakPolarHBondContact O-CB 3.39Å; E83-N86 PolarHBondContact O-N 2.85Å; E83-Y87 WeakPolarHBondContact O-CB 3.49Å; E83-Y87 PolarHBondContact O-N 3.11Å
84	E	98.2	Very high	97.1	Very high	109 Å²	109	112.1 Å²	112.1	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-62.3	-47.2	176	-178.4	170.6	-176.6	0	0	111.5	A80 D81 N86 Y87 W88	A80-E84 PolarHBondContact O-N 3.43Å; D81-E84 PolarHBondContact O-N 3.26Å; E84-N86 VanDerWaalsContact C-N 3.3Å; E84-N86 PolarHBondContact O-N 2.9Å; E84-Y87 WeakPolarHBondContact O-CB 3.37Å; E84-Y87 PolarHBondContact O-N 3.19Å; E84-Y87 VanDerWaalsContact O-N 3.12Å; E84-W88 PolarHBondContact O-N 2.88Å; E84-W88 PolarHBondContact OE1-NE1 3.04Å
85	L	98.1	Very high	96.4	Very high	106 Å²	106	110 Å²	110	56%	0.555	51%	0.511	S	S	*	.	H	α-helix	trans	-57.2	-45.5	175.3	177.6	61.7	0	0	0	111.5	D81 Y87 W88 I89	D81-L85 WeakPolarHBondContact O-CB 3.38Å; D81-L85 PolarHBondContact O-N 3.48Å; L85-Y87 VanDerWaalsContact C-N 3.29Å; L85-Y87 PolarHBondContact O-N 3.48Å; L85-W88 PolarHBondContact O-N 2.69Å; L85-I89 HydrophobicContact CD1-CD1 4.21Å; L85-I89 HydrophobicContact CD1-CG1 4.4Å; L85-I89 HydrophobicContact CG-CD1 3.95Å; L85-I89 VanDerWaalsContact O-CG1 3.29Å; L85-I89 WeakPolarHBondContact O-CG1 3.5Å; L85-I89 PolarHBondContact O-N 2.81Å
86	N	98.1	Very high	95.8	Very high	55 Å²	55	106.4 Å²	106.4	29%	0.294	50%	0.501	S	S	.	.	H	α-helix	trans	-64.1	-32.9	177.9	-85.1	-50.5	0	0	0	113.2	R82 E83 E84 R90	R82-N86 WeakPolarHBondContact O-CB 3.44Å; R82-N86 PolarHBondContact O-N 3.44Å; R82-N86 VanDerWaalsContact O-N 3.09Å; R82-N86 PolarHBondContact O-ND2 3.01Å; E83-N86 WeakPolarHBondContact O-CB 3.39Å; E83-N86 PolarHBondContact O-N 2.85Å; E84-N86 VanDerWaalsContact C-N 3.3Å; E84-N86 PolarHBondContact O-N 2.9Å; N86-R90 WeakPolarHBondContact O-CG 3.47Å; N86-R90 PolarHBondContact O-N 3.39Å; N86-R90 PolarHBondContact O-NH1 3.08Å
87	Y	98.1	Very high	94.5	Very high	113 Å²	113	102.8 Å²	102.8	44%	0.443	50%	0.495	S	S	.	.	H	α-helix	trans	-66	-47.7	172.8	165.4	-98.8	0	0	0	110.8	E83 E84 L85 I89 R90 R91	E83-Y87 WeakPolarHBondContact O-CB 3.49Å; E83-Y87 PolarHBondContact O-N 3.11Å; E84-Y87 WeakPolarHBondContact O-CB 3.37Å; E84-Y87 PolarHBondContact O-N 3.19Å; E84-Y87 VanDerWaalsContact O-N 3.12Å; L85-Y87 VanDerWaalsContact C-N 3.29Å; L85-Y87 PolarHBondContact O-N 3.48Å; Y87-I89 PolarHBondContact O-N 3.26Å; Y87-R90 PolarHBondContact O-N 3.44Å; Y87-R91 WeakPolarHBondContact O-CB 3.33Å; Y87-R91 PolarHBondContact O-N 3.03Å; Y87-R91 PolarHBondContact OH-NH1 3.14Å
88	W	97.8	Very high	93.1	Very high	134 Å²	134	106.6 Å²	106.6	51%	0.508	51%	0.51	S	S	.	.	H	α-helix	trans	-64.3	-39.8	178.9	-71.6	116.6	0	0	0	112.9	E84 L85 R90 R91 Y92	E84-W88 PolarHBondContact O-N 2.88Å; E84-W88 PolarHBondContact OE1-NE1 3.04Å; L85-W88 PolarHBondContact O-N 2.69Å; W88-R90 PolarHBondContact O-N 3.44Å; W88-R91 PolarHBondContact O-N 3.31Å; W88-Y92 WeakPolarHBondContact O-CB 3.24Å; W88-Y92 PolarHBondContact O-N 3.22Å
89	I	95.9	Very high	91.4	Very high	97 Å²	97	109 Å²	109	50%	0.497	52%	0.519	S	S	.	.	H	α-helix	trans	-58	-48.4	175.3	-70	165.9	0	0	0	110.8	L85 Y87 Y92 S93	L85-I89 HydrophobicContact CD1-CD1 4.21Å; L85-I89 HydrophobicContact CD1-CG1 4.4Å; L85-I89 HydrophobicContact CG-CD1 3.95Å; L85-I89 VanDerWaalsContact O-CG1 3.29Å; L85-I89 WeakPolarHBondContact O-CG1 3.5Å; L85-I89 PolarHBondContact O-N 2.81Å; Y87-I89 PolarHBondContact O-N 3.26Å; I89-Y92 PolarHBondContact O-N 3.35Å; I89-S93 PolarHBondContact O-N 3.13Å
90	R	96.3	Very high	89.6	Confident	154 Å²	154	113.5 Å²	113.5	58%	0.581	54%	0.537	S	S	*	.	H	α-helix	trans	-62	-49.4	177.6	-74.4	-179.7	-178	84.5	-3	111.4	N86 Y87 W88 Y92 S93 D94	N86-R90 WeakPolarHBondContact O-CG 3.47Å; N86-R90 PolarHBondContact O-N 3.39Å; N86-R90 PolarHBondContact O-NH1 3.08Å; Y87-R90 PolarHBondContact O-N 3.44Å; W88-R90 PolarHBondContact O-N 3.44Å; R90-Y92 VanDerWaalsContact C-N 3.29Å; R90-Y92 PolarHBondContact O-N 3.5Å; R90-S93 WeakPolarHBondContact O-CB 3.34Å; R90-S93 PolarHBondContact O-N 3.45Å; R90-S93 VanDerWaalsContact O-N 3.14Å; R90-D94 VanDerWaalsContact O-CG 3.24Å; R90-D94 PolarHBondContact O-N 3.39Å
91	R	95.6	Very high	87.4	Confident	139 Å²	139	113.4 Å²	113.4	53%	0.525	54%	0.541	S	S	.	.	H	α-helix	trans	-60.4	-38.1	-178.7	-170.2	174.4	-174.5	94.8	8	112.7	Y87 W88 A95	Y87-R91 WeakPolarHBondContact O-CB 3.33Å; Y87-R91 PolarHBondContact O-N 3.03Å; Y87-R91 PolarHBondContact OH-NH1 3.14Å; W88-R91 PolarHBondContact O-N 3.31Å; R91-A95 WeakPolarHBondContact O-CB 3.3Å; R91-A95 PolarHBondContact O-N 2.78Å
92	Y	92.8	Very high	85	Confident	155 Å²	155	112.3 Å²	112.3	61%	0.608	55%	0.554	S	S	*	*	H	α-helix	trans	-68.4	-45.3	175.1	-176.3	-92.7	0	0	0	111.5	W88 I89 R90 D94 A95 E96	W88-Y92 WeakPolarHBondContact O-CB 3.24Å; W88-Y92 PolarHBondContact O-N 3.22Å; I89-Y92 PolarHBondContact O-N 3.35Å; R90-Y92 VanDerWaalsContact C-N 3.29Å; R90-Y92 PolarHBondContact O-N 3.5Å; Y92-D94 PolarHBondContact O-N 3.03Å; Y92-A95 PolarHBondContact O-N 2.74Å; Y92-E96 HydrophobicContact CD1-CG 4.13Å; Y92-E96 HydrophobicContact CE1-CG 3.61Å; Y92-E96 HydrophobicContact CE2-CG 4.42Å; Y92-E96 WeakPolarHBondContact O-CG 3.42Å; Y92-E96 PolarHBondContact O-N 3.01Å
93	S	91	Very high	82.7	Confident	57 Å²	57	109.1 Å²	109.1	40%	0.399	56%	0.562	S	S	.	*	H	α-helix	trans	-56.8	-50.2	175.7	-166.8	0	0	0	0	111.7	I89 R90 A95 E96 D97	I89-S93 PolarHBondContact O-N 3.13Å; R90-S93 WeakPolarHBondContact O-CB 3.34Å; R90-S93 PolarHBondContact O-N 3.45Å; R90-S93 VanDerWaalsContact O-N 3.14Å; S93-A95 VanDerWaalsContact C-N 3.27Å; S93-A95 PolarHBondContact O-N 3.45Å; S93-E96 PolarHBondContact O-N 2.83Å; S93-E96 VanDerWaalsContact O-N 3.14Å; S93-D97 PolarHBondContact O-N 2.89Å
94	D	90.9	Very high	80	Confident	106 Å²	106	108.7 Å²	108.7	57%	0.567	57%	0.572	S	S	*	*	H	α-helix	trans	-60.5	-37.8	-178.5	-65.1	-21.4	0	0	0	111.9	R90 Y92 L98	R90-D94 VanDerWaalsContact O-CG 3.24Å; R90-D94 PolarHBondContact O-N 3.39Å; Y92-D94 PolarHBondContact O-N 3.03Å; D94-L98 PolarHBondContact O-N 3.06Å
95	A	85.4	Confident	78.1	Confident	59 Å²	59	109.6 Å²	109.6	49%	0.488	59%	0.59	S	S	.	*	H	α-helix	trans	-69.5	-37.7	177.6	0	0	0	0	0	112.6	R91 Y92 S93 K99	R91-A95 WeakPolarHBondContact O-CB 3.3Å; R91-A95 PolarHBondContact O-N 2.78Å; Y92-A95 PolarHBondContact O-N 2.74Å; S93-A95 VanDerWaalsContact C-N 3.27Å; S93-A95 PolarHBondContact O-N 3.45Å; A95-K99 PolarHBondContact O-N 2.78Å
96	E	84.3	Confident	75.7	Confident	86 Å²	86	109 Å²	109	40%	0.402	60%	0.595	S	S	.	*	H	α-helix	trans	-70.8	-38.3	175.8	-72.3	-74.3	89.9	0	0	111.7	Y92 S93 L98 K99 K100	Y92-E96 HydrophobicContact CD1-CG 4.13Å; Y92-E96 HydrophobicContact CE1-CG 3.61Å; Y92-E96 HydrophobicContact CE2-CG 4.42Å; Y92-E96 WeakPolarHBondContact O-CG 3.42Å; Y92-E96 PolarHBondContact O-N 3.01Å; S93-E96 PolarHBondContact O-N 2.83Å; S93-E96 VanDerWaalsContact O-N 3.14Å; E96-L98 VanDerWaalsContact C-N 3.34Å; E96-L98 PolarHBondContact O-N 3.4Å; E96-K99 PolarHBondContact O-N 3.43Å; E96-K100 PolarHBondContact O-N 3.38Å; E96-K100 VanDerWaalsContact O-N 3.09Å
97	D	72.9	Confident	73.4	Confident	95 Å²	95	110.8 Å²	110.8	51%	0.508	61%	0.612	S	S	.	*	H	α-helix	trans	-64.9	-37.6	174.7	-77.6	-45.6	0	0	0	111.8	S93 K99 K100 G101	S93-D97 PolarHBondContact O-N 2.89Å; D97-K99 VanDerWaalsContact C-N 3.26Å; D97-K99 PolarHBondContact O-N 2.8Å; D97-K100 PolarHBondContact O-N 2.83Å; D97-G101 WeakPolarHBondContact O-CA 3.42Å; D97-G101 PolarHBondContact O-N 2.83Å
98	L	67.8	Low	70.9	Confident	146 Å²	146	115.2 Å²	115.2	76%	0.764	64%	0.636	S	S	*	*	H	α-helix	trans	-64.8	-31.6	175.1	-134.7	71.2	0	0	0	112.6	D94 E96	D94-L98 PolarHBondContact O-N 3.06Å; E96-L98 VanDerWaalsContact C-N 3.34Å; E96-L98 PolarHBondContact O-N 3.4Å
99	K	64.3	Low	68.7	Low	177 Å²	177	113.4 Å²	113.4	77%	0.77	64%	0.644	S	S	*	*	H	α-helix	trans	-78	-27	177.8	-164.2	177.5	178.1	-173.3	0	112.6	A95 E96 D97	A95-K99 PolarHBondContact O-N 2.78Å; E96-K99 PolarHBondContact O-N 3.43Å; D97-K99 VanDerWaalsContact C-N 3.26Å; D97-K99 PolarHBondContact O-N 2.8Å
100	K	60.4	Low	66.5	Low	191 Å²	191	120.5 Å²	120.5	83%	0.83	66%	0.664	S	S	*	*	H	α-helix	trans	-91.2	-18.4	175.7	-158	175.4	-179.4	-175	0	113.2	E96 D97	E96-K100 PolarHBondContact O-N 3.38Å; E96-K100 VanDerWaalsContact O-N 3.09Å; D97-K100 PolarHBondContact O-N 2.83Å
101	G	52.1	Low	64.2	Low	49 Å²	49	120.3 Å²	120.3	51%	0.505	67%	0.67	S	S	.	*			trans	-116.8	18.7	-167.8	0	0	0	0	0	116.6	D97 G103	D97-G101 WeakPolarHBondContact O-CA 3.42Å; D97-G101 PolarHBondContact O-N 2.83Å; G101-G103 PolarHBondContact O-N 2.69Å
102	G	47.5	Very low	61.7	Low	81 Å²	81	121.5 Å²	121.5	84%	0.835	68%	0.682	S	S	*	*	S	Bend	trans	-65.6	2.9	172.7	0	0	0	0	0	115.5
103	G	50.9	Low	59.4	Low	63 Å²	63	119.1 Å²	119.1	65%	0.649	69%	0.687	S	S	*	*	S	Bend	trans	-137.2	80.4	177.5	0	0	0	0	0	111.3	G101	G101-G103 PolarHBondContact O-N 2.69Å
104	S	42.2	Very low	57.5	Low	110 Å²	110	122 Å²	122	77%	0.769	71%	0.705	S	S	*	*			trans	174.2	94.8	139.5	-77.5	0	0	0	0	110.1	S106	S104-S106 PolarHBondContact O-N 2.95Å; S104-S106 VanDerWaalsContact O-N 3.1Å
105	S	58.1	Low	55.6	Low	129 Å²	129	123.5 Å²	123.5	90%	0.902	72%	0.718	S	S	*	*			trans	-56.2	105	146.4	50.2	0	0	0	0	108.5
106	S	47.3	Very low	53.9	Low	94 Å²	94	127.2 Å²	127.2	66%	0.657	73%	0.729	S	S	*	*			trans	-162	112.3	160.8	-165	0	0	0	0	112.4	S104	S104-S106 PolarHBondContact O-N 2.95Å; S104-S106 VanDerWaalsContact O-N 3.1Å
107	S	50.5	Low	52.5	Low	91 Å²	91	128.6 Å²	128.6	64%	0.636	75%	0.745	S	S	*	*			trans	57.1	88.9	141.5	57.3	0	0	0	0	119.1
108	H	44.6	Very low	51.6	Low	207 Å²	207	131.2 Å²	131.2	96%	0.958	76%	0.759	S	S	*	*			trans	-108.5	61.5	136.8	-95.1	30.5	0	0	0	109.7
109	S	51.5	Low	51.3	Low	95 Å²	95	130 Å²	130	66%	0.664	76%	0.76	S	S	*	*			trans	-95.1	93	152.6	-174.9	0	0	0	0	106.8
110	R	49.4	Very low	51.1	Low	247 Å²	247	128.3 Å²	128.3	93%	0.932	76%	0.764	S	S	*	*			trans	-129.6	97.8	154.6	-84.8	-170.6	170	-110.4	-0.1	107.8
111	Q	48.6	Very low	50.7	Low	150 Å²	150	122.8 Å²	122.8	70%	0.701	76%	0.755	S	S	*	*			trans	-53.6	152.7	163.4	-69.7	-179.6	-1.3	0	0	112.3
112	Q	43.5	Very low	50.4	Low	164 Å²	164	129.1 Å²	129.1	77%	0.766	78%	0.776	S	S	*	*			trans	74.6	130.2	152.8	-66.9	167.1	61.7	0	0	116.6
113	S	45.2	Very low	50.4	Low	104 Å²	104	132.7 Å²	132.7	73%	0.727	81%	0.812	S	S	*	*			cis	-150.5	158.6	39.4	-68.7	0	0	0	0	113.8
114	P	51.1	Low	50.4	Low	118 Å²	118	136.2 Å²	136.2	77%	0.766	82%	0.821	S	S	*	*			trans	-73.7	126.6	171	30.7	-30.6	0	0	0	110	N116	P114-N116 PolarHBondContact O-N 3.18Å
115	V	50.3	Low	50.8	Low	138 Å²	138	137.5 Å²	137.5	84%	0.836	82%	0.823	S	S	*	*			trans	-76.8	112.2	168.4	60.9	0	0	0	0	108.2
116	N	48.6	Very low	50.4	Low	137 Å²	137	138 Å²	138	73%	0.733	82%	0.819	S	S	*	*			trans	-69.1	132.8	165	-88.3	-61.3	0	0	0	108.8	P114	P114-N116 PolarHBondContact O-N 3.18Å
117	P	56.4	Low	50.6	Low	114 Å²	114	140.6 Å²	140.6	74%	0.74	83%	0.828	S	S	*	*			trans	-86.9	114.9	160.9	31.1	-26.8	0	0	0	109.5	P119	P117-P119 WeakPolarHBondContact O-CD 3.27Å
118	D	53.4	Low	50.6	Low	150 Å²	150	143.7 Å²	143.7	80%	0.802	84%	0.84	S	S	*	*			trans	-77.5	125.6	162.1	-86.2	-48.2	0	0	0	109.5
119	P	61.6	Low	51	Low	120 Å²	120	139.5 Å²	139.5	78%	0.779	83%	0.832	S	S	*	*			trans	-93.2	106.4	162.7	32.7	-23.9	0	0	0	108.8	P117	P117-P119 WeakPolarHBondContact O-CD 3.27Å
120	V	59.6	Low	50.9	Low	142 Å²	142	142.6 Å²	142.6	86%	0.861	85%	0.845	S	S	*	*			trans	-90.7	113	165.5	-177	0	0	0	0	108.6
121	A	52.3	Low	51	Low	76 Å²	76	134.6 Å²	134.6	63%	0.628	84%	0.838	S	S	*	*			trans	-71.7	149.6	175.2	0	0	0	0	0	112.6
122	L	46.1	Very low	51.3	Low	182 Å²	182	133.3 Å²	133.3	95%	0.953	85%	0.849	S	S	*	*			trans	41.8	116.4	140.4	-70.3	160.6	0	0	0	119.4
123	G	47	Very low	52	Low	155 Å²	155	130.5 Å²	130.5	100%	1.598	86%	0.857	S	S	*	*			trans	-163.7	0	156.1	0	0	0	0	0	109.6

Retrieved 123 of 123 residues in 29.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).