X5D2W2_HUMAN Loading...

Fibroblast growth factor receptor 3 isoform C

AlphaFold DB , UniProt , Accession X5D2W2, Species HUMAN (Homo sapiens, Human), Gene FGFR3, Length 90 aa.

						>X5D2W2_HUMAN|X5D2W2|FGFR3
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVARTPPAPAPQGTTPCLPTTCCPRPHPAVGARGR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.2	Low	79.9	Confident	253 Å²	253	94.5 Å²	94.5	100%	1.246	61%	0.611	S	S	*	*				0	117.5	0	-71.9	-171.5	-86.8	0	0	107.9
2	G	59.5	Low	80.9	Confident	40 Å²	40	94.3 Å²	94.3	41%	0.412	61%	0.607	S	S	.	*			trans	-180	-18.5	-175	0	0	0	0	0	115.3	A5 C6	G2-A5 PolarHBondContact O-N 3.29Å; G2-C6 WeakPolarHBondContact O-CB 3.49Å; G2-C6 PolarHBondContact O-N 3.38Å
3	A	67	Low	81.9	Confident	83 Å²	83	91.2 Å²	91.2	69%	0.686	60%	0.595	S	S	*	*	H	α-helix	trans	-52.5	-46.5	176.3	0	0	0	0	0	114.7	C6 A7	A3-C6 PolarHBondContact O-N 3.39Å; A3-A7 WeakPolarHBondContact O-CB 3Å; A3-A7 PolarHBondContact O-N 2.99Å
4	P	72.9	Confident	82.5	Confident	93 Å²	93	91.9 Å²	91.9	60%	0.604	60%	0.596	S	S	*	*	H	α-helix	trans	-71.2	-34.4	179.7	26.8	-33.9	0	0	0	112.7	A7 L8	P4-A7 PolarHBondContact O-N 3.02Å; P4-L8 WeakPolarHBondContact O-CG 3.36Å; P4-L8 PolarHBondContact O-N 3.13Å
5	A	83.9	Confident	83	Confident	63 Å²	63	89.7 Å²	89.7	52%	0.521	59%	0.588	S	S	.	*	H	α-helix	trans	-67.7	-39.1	177	0	0	0	0	0	111.7	G2 L8 A9	G2-A5 PolarHBondContact O-N 3.29Å; A5-L8 PolarHBondContact O-N 3.14Å; A5-A9 WeakPolarHBondContact O-CB 3.46Å; A5-A9 PolarHBondContact O-N 3.32Å
6	C	82.9	Confident	83.3	Confident	75 Å²	75	91.4 Å²	91.4	51%	0.507	59%	0.59	S	S	.	*	H	α-helix	trans	-66.1	-42.9	175.5	-160.7	0	0	0	0	111.3	G2 A3 L8 A9 L10	G2-C6 WeakPolarHBondContact O-CB 3.49Å; G2-C6 PolarHBondContact O-N 3.38Å; A3-C6 PolarHBondContact O-N 3.39Å; C6-L8 VanDerWaalsContact C-N 3.35Å; C6-L8 PolarHBondContact O-N 3.14Å; C6-A9 PolarHBondContact O-N 3.06Å; C6-L10 WeakPolarHBondContact O-CG 3.16Å; C6-L10 PolarHBondContact O-N 3.26Å
7	A	90.1	Very high	83.5	Confident	57 Å²	57	91.8 Å²	91.8	47%	0.471	59%	0.589	S	S	.	*	H	α-helix	trans	-61.2	-41.6	175.9	0	0	0	0	0	112.5	A3 P4 L10 C11	A3-A7 WeakPolarHBondContact O-CB 3Å; A3-A7 PolarHBondContact O-N 2.99Å; P4-A7 PolarHBondContact O-N 3.02Å; A7-L10 PolarHBondContact O-N 3.23Å; A7-C11 VanDerWaalsContact O-CB 3.3Å; A7-C11 WeakPolarHBondContact O-CB 3.16Å; A7-C11 PolarHBondContact O-N 2.76Å
8	L	89.3	Confident	83.4	Confident	118 Å²	118	89.4 Å²	89.4	62%	0.618	58%	0.58	S	S	*	*	H	α-helix	trans	-65.4	-43.1	175.6	-71	173.9	0	0	0	111.9	P4 A5 C6 L10 C11 V12	P4-L8 WeakPolarHBondContact O-CG 3.36Å; P4-L8 PolarHBondContact O-N 3.13Å; A5-L8 PolarHBondContact O-N 3.14Å; C6-L8 VanDerWaalsContact C-N 3.35Å; C6-L8 PolarHBondContact O-N 3.14Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 2.85Å; L8-C11 PolarHBondContact O-N 2.78Å; L8-V12 WeakPolarHBondContact O-CG2 3.44Å; L8-V12 PolarHBondContact O-N 2.77Å
9	A	91.6	Very high	83.1	Confident	61 Å²	61	86.1 Å²	86.1	50%	0.504	56%	0.563	S	S	.	*	H	α-helix	trans	-60.6	-43.1	177.1	0	0	0	0	0	111.9	A5 C6 A13	A5-A9 WeakPolarHBondContact O-CB 3.46Å; A5-A9 PolarHBondContact O-N 3.32Å; C6-A9 PolarHBondContact O-N 3.06Å; A9-A13 WeakPolarHBondContact O-CB 3.49Å; A9-A13 PolarHBondContact O-N 3Å
10	L	90.6	Very high	82.6	Confident	113 Å²	113	84.5 Å²	84.5	59%	0.592	56%	0.557	S	S	*	*	H	α-helix	trans	-65.4	-42.5	175.2	-67.6	175	0	0	0	111.9	C6 A7 L8 V12 A13 V14	C6-L10 WeakPolarHBondContact O-CG 3.16Å; C6-L10 PolarHBondContact O-N 3.26Å; A7-L10 PolarHBondContact O-N 3.23Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 2.85Å; L10-V12 PolarHBondContact O-N 2.99Å; L10-A13 PolarHBondContact O-N 2.82Å; L10-V14 VanDerWaalsContact O-CG2 3.29Å; L10-V14 WeakPolarHBondContact O-CG2 3.33Å; L10-V14 PolarHBondContact O-N 3.06Å
11	C	92	Very high	81.9	Confident	83 Å²	83	83.9 Å²	83.9	56%	0.561	55%	0.554	S	S	*	*	H	α-helix	trans	-61.1	-45.3	178.1	-168.5	0	0	0	0	111.7	A7 L8 V14 A15	A7-C11 VanDerWaalsContact O-CB 3.3Å; A7-C11 WeakPolarHBondContact O-CB 3.16Å; A7-C11 PolarHBondContact O-N 2.76Å; L8-C11 PolarHBondContact O-N 2.78Å; C11-V14 PolarHBondContact O-N 2.81Å; C11-A15 WeakPolarHBondContact O-CB 3.35Å; C11-A15 PolarHBondContact O-N 3.38Å
12	V	91.4	Very high	82	Confident	92 Å²	92	75.1 Å²	75.1	56%	0.558	52%	0.518	S	S	*	.	H	α-helix	trans	-64.5	-44.9	176.8	174.3	0	0	0	0	110.8	L8 L10 V14 A15 I16	L8-V12 WeakPolarHBondContact O-CG2 3.44Å; L8-V12 PolarHBondContact O-N 2.77Å; L10-V12 PolarHBondContact O-N 2.99Å; V12-V14 VanDerWaalsContact C-N 3.33Å; V12-V14 PolarHBondContact O-N 3.05Å; V12-A15 PolarHBondContact O-N 3.31Å; V12-I16 HydrophobicContact CG1-CG1 4.4Å; V12-I16 WeakPolarHBondContact O-CG1 3.44Å; V12-I16 PolarHBondContact O-N 3.4Å
13	A	93.9	Very high	81.9	Confident	55 Å²	55	80.4 Å²	80.4	46%	0.455	53%	0.532	S	S	.	.	H	α-helix	trans	-58.9	-44	177.6	0	0	0	0	0	112.1	A9 L10 I16 V17	A9-A13 WeakPolarHBondContact O-CB 3.49Å; A9-A13 PolarHBondContact O-N 3Å; L10-A13 PolarHBondContact O-N 2.82Å; A13-I16 PolarHBondContact O-N 3.09Å; A13-V17 WeakPolarHBondContact O-CG2 3.49Å; A13-V17 PolarHBondContact O-N 3.3Å; A13-V17 VanDerWaalsContact O-N 3.15Å
14	V	90.6	Very high	81.6	Confident	100 Å²	100	81.1 Å²	81.1	61%	0.606	53%	0.532	S	S	*	.	H	α-helix	trans	-65	-42.4	176.7	172.9	0	0	0	0	111.3	L10 C11 V12 I16 V17 A18	L10-V14 VanDerWaalsContact O-CG2 3.29Å; L10-V14 WeakPolarHBondContact O-CG2 3.33Å; L10-V14 PolarHBondContact O-N 3.06Å; C11-V14 PolarHBondContact O-N 2.81Å; V12-V14 VanDerWaalsContact C-N 3.33Å; V12-V14 PolarHBondContact O-N 3.05Å; V14-I16 VanDerWaalsContact C-N 3.35Å; V14-I16 PolarHBondContact O-N 2.85Å; V14-V17 PolarHBondContact O-N 3.44Å; V14-A18 VanDerWaalsContact O-CB 3.3Å; V14-A18 WeakPolarHBondContact O-CB 2.92Å; V14-A18 PolarHBondContact O-N 2.91Å
15	A	89.8	Confident	80.8	Confident	59 Å²	59	81 Å²	81	49%	0.488	53%	0.526	S	S	.	.	H	α-helix	trans	-62	-39.8	178.4	0	0	0	0	0	112.6	C11 V12 G19	C11-A15 WeakPolarHBondContact O-CB 3.35Å; C11-A15 PolarHBondContact O-N 3.38Å; V12-A15 PolarHBondContact O-N 3.31Å; A15-G19 PolarHBondContact O-N 3.34Å
16	I	88.4	Confident	79.5	Confident	118 Å²	118	78.7 Å²	78.7	61%	0.605	51%	0.509	S	S	*	.	H	α-helix	trans	-67.8	-42.8	177	-62.4	-61.7	0	0	0	111.4	V12 A13 V14 G19 A20	V12-I16 HydrophobicContact CG1-CG1 4.4Å; V12-I16 WeakPolarHBondContact O-CG1 3.44Å; V12-I16 PolarHBondContact O-N 3.4Å; A13-I16 PolarHBondContact O-N 3.09Å; V14-I16 VanDerWaalsContact C-N 3.35Å; V14-I16 PolarHBondContact O-N 2.85Å; I16-G19 PolarHBondContact O-N 3.03Å; I16-A20 WeakPolarHBondContact O-CB 3.38Å; I16-A20 PolarHBondContact O-N 2.88Å
17	V	86.6	Confident	78.1	Confident	97 Å²	97	80.3 Å²	80.3	59%	0.588	52%	0.516	S	S	*	.	H	α-helix	trans	-65.6	-42.2	177.9	171.4	0	0	0	0	111.4	A13 V14 S21	A13-V17 WeakPolarHBondContact O-CG2 3.49Å; A13-V17 PolarHBondContact O-N 3.3Å; A13-V17 VanDerWaalsContact O-N 3.15Å; V14-V17 PolarHBondContact O-N 3.44Å; V17-S21 WeakPolarHBondContact O-CB 3.33Å; V17-S21 PolarHBondContact O-N 2.83Å; V17-S21 PolarHBondContact O-OG 2.87Å
18	A	82.2	Confident	76.4	Confident	50 Å²	50	84.5 Å²	84.5	41%	0.413	53%	0.526	S	S	.	.	H	α-helix	trans	-67.3	-39.2	175.9	0	0	0	0	0	112	V14 S21 S22	V14-A18 VanDerWaalsContact O-CB 3.3Å; V14-A18 WeakPolarHBondContact O-CB 2.92Å; V14-A18 PolarHBondContact O-N 2.91Å; A18-S21 PolarHBondContact O-N 3.15Å; A18-S22 WeakPolarHBondContact O-CB 3.4Å; A18-S22 PolarHBondContact O-N 3.45Å; A18-S22 PolarHBondContact O-OG 2.94Å
19	G	76.9	Confident	74.8	Confident	26 Å²	26	83.9 Å²	83.9	27%	0.268	52%	0.52	S	S	.	.	H	α-helix	trans	-62.3	-50.2	174.2	0	0	0	0	0	112.1	A15 I16 S21 S22 E23	A15-G19 PolarHBondContact O-N 3.34Å; I16-G19 PolarHBondContact O-N 3.03Å; G19-S21 VanDerWaalsContact C-N 3.28Å; G19-S21 PolarHBondContact O-N 3.44Å; G19-S22 CarbonylContact O-C 3.49Å; G19-S22 WeakPolarHBondContact O-CA 3.34Å; G19-S22 PolarHBondContact O-N 3.01Å; G19-E23 WeakPolarHBondContact O-CB 3.29Å; G19-E23 WeakPolarHBondContact O-CG 3.47Å; G19-E23 PolarHBondContact O-N 3.33Å
20	A	74.3	Confident	72.9	Confident	54 Å²	54	90.2 Å²	90.2	45%	0.446	53%	0.531	S	S	.	.	H	α-helix	trans	-59.8	-38	176.6	0	0	0	0	0	112.4	I16 S24	I16-A20 WeakPolarHBondContact O-CB 3.38Å; I16-A20 PolarHBondContact O-N 2.88Å; A20-S24 WeakPolarHBondContact O-CB 3.32Å; A20-S24 PolarHBondContact O-N 2.96Å
21	S	67.3	Low	71	Confident	71 Å²	71	90.1 Å²	90.1	50%	0.497	54%	0.535	S	S	.	.	H	α-helix	trans	-68.2	-38.4	174.4	-57	0	0	0	0	111.8	V17 A18 G19 L25	V17-S21 WeakPolarHBondContact O-CB 3.33Å; V17-S21 PolarHBondContact O-N 2.83Å; V17-S21 PolarHBondContact O-OG 2.87Å; A18-S21 PolarHBondContact O-N 3.15Å; G19-S21 VanDerWaalsContact C-N 3.28Å; G19-S21 PolarHBondContact O-N 3.44Å; S21-L25 WeakPolarHBondContact O-CB 3.3Å; S21-L25 PolarHBondContact O-N 3.41Å
22	S	60.3	Low	69.1	Low	70 Å²	70	90.6 Å²	90.6	49%	0.49	54%	0.535	S	S	.	.	H	α-helix	trans	-76	-25.9	178.1	-62.4	0	0	0	0	113.3	A18 G19 L25 G26	A18-S22 WeakPolarHBondContact O-CB 3.4Å; A18-S22 PolarHBondContact O-N 3.45Å; A18-S22 PolarHBondContact O-OG 2.94Å; G19-S22 CarbonylContact O-C 3.49Å; G19-S22 WeakPolarHBondContact O-CA 3.34Å; G19-S22 PolarHBondContact O-N 3.01Å; S22-L25 CarbonylContact O-C 3.41Å; S22-G26 WeakPolarHBondContact O-CA 3.39Å; S22-G26 PolarHBondContact O-N 3.22Å
23	E	59	Low	67.2	Low	151 Å²	151	88.6 Å²	88.6	71%	0.706	53%	0.533	S	S	*	.	H	α-helix	trans	-75.6	-40.7	171	-75.4	176.4	87.8	0	0	110.5	G19 G26	G19-E23 WeakPolarHBondContact O-CB 3.29Å; G19-E23 WeakPolarHBondContact O-CG 3.47Å; G19-E23 PolarHBondContact O-N 3.33Å; E23-G26 PolarHBondContact O-N 3.49Å
24	S	59.7	Low	65.2	Low	98 Å²	98	96.8 Å²	96.8	69%	0.685	55%	0.552	S	S	*	*	H	α-helix	trans	-65.7	-36.9	172.8	-173	0	0	0	0	112.6	A20 G26	A20-S24 WeakPolarHBondContact O-CB 3.32Å; A20-S24 PolarHBondContact O-N 2.96Å; S24-G26 VanDerWaalsContact C-N 3.29Å
25	L	57.1	Low	63.1	Low	90 Å²	90	95.8 Å²	95.8	47%	0.471	55%	0.554	S	S	.	*	T	Hydrogen-bonded Turn	trans	-91.2	6.6	172.4	-159.1	76	0	0	0	111	S21 S22 Q29	S21-L25 WeakPolarHBondContact O-CB 3.3Å; S21-L25 PolarHBondContact O-N 3.41Å; S22-L25 CarbonylContact O-C 3.41Å; L25-Q29 HydrophobicContact CD2-CG 3.98Å; L25-Q29 HydrophobicContact CG-CG 3.95Å; L25-Q29 WeakPolarHBondContact O-CB 3.3Å; L25-Q29 PolarHBondContact O-N 3.39Å
26	G	55.1	Low	61.3	Low	15 Å²	15	96.4 Å²	96.4	16%	0.155	56%	0.559	C	S	.	*	H	α-helix	trans	-92.2	-21.8	-171.4	0	0	0	0	0	112.7	S22 E23 S24 E28 R30	S22-G26 WeakPolarHBondContact O-CA 3.39Å; S22-G26 PolarHBondContact O-N 3.22Å; E23-G26 PolarHBondContact O-N 3.49Å; S24-G26 VanDerWaalsContact C-N 3.29Å; G26-E28 VanDerWaalsContact C-N 3.29Å; G26-R30 WeakPolarHBondContact O-CB 3.34Å; G26-R30 PolarHBondContact O-N 3Å; G26-R30 VanDerWaalsContact O-N 3.14Å
27	T	53.9	Low	59.6	Low	108 Å²	108	98.8 Å²	98.8	66%	0.663	57%	0.568	S	S	*	*	H	α-helix	trans	-71.1	-29.6	167.6	48.9	0	0	0	0	111.4
28	E	54.3	Low	57.7	Low	146 Å²	146	99.6 Å²	99.6	68%	0.682	57%	0.573	S	S	*	*	H	α-helix	trans	-95	-38.5	-179.7	-56.3	-115.5	96.9	0	0	112.1	G26	G26-E28 VanDerWaalsContact C-N 3.29Å
29	Q	55.3	Low	56.2	Low	105 Å²	105	103.7 Å²	103.7	49%	0.491	60%	0.595	S	S	.	*	H	α-helix	trans	-84.1	-21.8	177.9	-78.2	-161.2	102.4	0	0	115.2	L25 V31 V32 G33	L25-Q29 HydrophobicContact CD2-CG 3.98Å; L25-Q29 HydrophobicContact CG-CG 3.95Å; L25-Q29 WeakPolarHBondContact O-CB 3.3Å; L25-Q29 PolarHBondContact O-N 3.39Å; Q29-V31 PolarHBondContact O-N 3.25Å; Q29-V32 PolarHBondContact O-N 2.91Å; Q29-G33 PolarHBondContact O-N 2.92Å
30	R	53.3	Low	55	Low	193 Å²	193	105.3 Å²	105.3	73%	0.728	61%	0.612	S	S	*	*	H	α-helix	trans	-66.3	-20.7	172.3	-166.4	-145.1	-62.4	-88.3	2.5	111.5	G26	G26-R30 WeakPolarHBondContact O-CB 3.34Å; G26-R30 PolarHBondContact O-N 3Å; G26-R30 VanDerWaalsContact O-N 3.14Å
31	V	50	Low	54.2	Low	111 Å²	111	107.9 Å²	107.9	67%	0.673	62%	0.624	S	S	*	*	H	α-helix	trans	-73.7	-35.4	171.4	-177.8	0	0	0	0	110.9	Q29	Q29-V31 PolarHBondContact O-N 3.25Å
32	V	50.8	Low	53.1	Low	94 Å²	94	111.7 Å²	111.7	57%	0.57	63%	0.634	S	S	*	*	H	α-helix	trans	-85.5	-38.7	179.8	173.3	0	0	0	0	112.9	Q29 R34 A35 A36	Q29-V32 PolarHBondContact O-N 2.91Å; V32-R34 VanDerWaalsContact C-N 3.27Å; V32-R34 PolarHBondContact O-N 3.44Å; V32-A35 WeakPolarHBondContact O-CB 3.33Å; V32-A35 PolarHBondContact O-N 3.46Å; V32-A36 PolarHBondContact O-N 2.97Å
33	G	53.4	Low	53.1	Low	50 Å²	50	114.5 Å²	114.5	52%	0.515	65%	0.651	S	S	.	*	T	Hydrogen-bonded Turn	trans	-75.2	-8.4	-178	0	0	0	0	0	115.2	Q29	Q29-G33 PolarHBondContact O-N 2.92Å
34	R	50.5	Low	52.9	Low	226 Å²	226	109 Å²	109	85%	0.853	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.5	-6.2	166.1	-84.7	-86.8	-174.7	130.9	-1.3	112.8	V32	V32-R34 VanDerWaalsContact C-N 3.27Å; V32-R34 PolarHBondContact O-N 3.44Å
35	A	47.9	Very low	52.4	Low	79 Å²	79	113 Å²	113	65%	0.653	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.8	-13.1	177.2	0	0	0	0	0	113.3	V32	V32-A35 WeakPolarHBondContact O-CB 3.33Å; V32-A35 PolarHBondContact O-N 3.46Å
36	A	51.3	Low	52.3	Low	72 Å²	72	118.4 Å²	118.4	60%	0.595	67%	0.665	S	S	*	*	S	Bend	trans	-101.3	-2.6	-173.5	0	0	0	0	0	115.6	V32	V32-A36 PolarHBondContact O-N 2.97Å
37	E	52.2	Low	52.2	Low	169 Å²	169	126.6 Å²	126.6	79%	0.79	70%	0.699	S	S	*	*	S	Bend	trans	-105	34.3	179.8	-69.4	-73.5	106.3	0	0	113.2
38	V	46.5	Very low	52.1	Low	114 Å²	114	128.9 Å²	128.9	69%	0.691	70%	0.702	S	S	*	*			trans	-147.3	107.9	162.6	176.9	0	0	0	0	109	G40	V38-G40 PolarHBondContact O-N 2.95Å; V38-G40 VanDerWaalsContact O-N 3.09Å
39	P	51.9	Low	51.9	Low	135 Å²	135	128.9 Å²	128.9	88%	0.877	71%	0.707	S	S	*	*			trans	-76.5	94.1	161.4	29.3	-25	0	0	0	107.5
40	G	51.8	Low	51.5	Low	61 Å²	61	129.6 Å²	129.6	63%	0.629	72%	0.718	S	S	*	*			trans	-134.1	80.8	175.3	0	0	0	0	0	111.7	V38	V38-G40 PolarHBondContact O-N 2.95Å; V38-G40 VanDerWaalsContact O-N 3.09Å
41	P	57.3	Low	51.5	Low	108 Å²	108	130.6 Å²	130.6	70%	0.701	73%	0.728	S	S	*	*			trans	-91.9	111.9	164.6	32.5	-22.4	0	0	0	109.1
42	E	43.9	Very low	51.7	Low	150 Å²	150	128.6 Å²	128.6	70%	0.701	73%	0.73	S	S	*	*				-165.5	95.1	123.7	-107.3	-63	90.9	0	0	110.9	G44	E42-G44 VanDerWaalsContact C-N 3.28Å; E42-G44 PolarHBondContact O-N 3.48Å
43	P	59	Low	51.8	Low	130 Å²	130	130 Å²	130	84%	0.844	74%	0.743	S	S	*	*			trans	-84.4	74.3	163.5	34.1	-26.2	0	0	0	108.4
44	G	56.4	Low	52	Low	34 Å²	34	131.1 Å²	131.1	35%	0.351	76%	0.755	S	S	.	*			trans	-145.1	7.5	-167.4	0	0	0	0	0	117.7	E42	E42-G44 VanDerWaalsContact C-N 3.28Å; E42-G44 PolarHBondContact O-N 3.48Å
45	Q	48.8	Very low	52.3	Low	183 Å²	183	127.8 Å²	127.8	86%	0.855	75%	0.754	S	S	*	*	S	Bend	trans	-109.9	-2.6	-174.7	-60.3	-169.1	2.7	0	0	115.4
46	Q	54.9	Low	52.2	Low	203 Å²	203	128.6 Å²	128.6	95%	0.949	76%	0.761	S	S	*	*	S	Bend	trans	-91.4	-7.8	175.5	-71.9	-171.9	75.4	0	0	113.4
47	E	52.7	Low	52.5	Low	188 Å²	188	130.7 Å²	130.7	88%	0.879	77%	0.766	S	S	*	*	S	Bend	trans	-130.3	35.6	-176.1	-157.7	141.9	80.4	0	0	113.1
48	Q	52.4	Low	52.7	Low	155 Å²	155	127.3 Å²	127.3	72%	0.724	77%	0.767	S	S	*	*	S	Bend	trans	-116.9	112.6	153.1	-88.2	-166.2	31.8	0	0	109.4
49	L	49	Very low	52.8	Low	147 Å²	147	132.6 Å²	132.6	77%	0.77	78%	0.775	S	S	*	*			trans	49.2	122.5	134.2	-74.5	92.6	0	0	0	115.8
50	V	48.4	Very low	53	Low	120 Å²	120	132.5 Å²	132.5	73%	0.727	77%	0.771	S	S	*	*			cis	168.4	156.1	20.5	61.3	0	0	0	0	101.7	G52	V50-G52 PolarHBondContact O-N 3Å
51	F	52.8	Low	53.3	Low	214 Å²	214	134.3 Å²	134.3	94%	0.939	77%	0.772	S	S	*	*			trans	-33	114.3	160.1	-91.2	-107.9	0	0	0	112.7
52	G	52.7	Low	52.9	Low	69 Å²	69	135.2 Å²	135.2	71%	0.711	78%	0.778	S	S	*	*			trans	-166.4	77.5	-176.6	0	0	0	0	0	113.9	V50	V50-G52 PolarHBondContact O-N 3Å
53	S	54.5	Low	53.3	Low	123 Å²	123	132.6 Å²	132.6	86%	0.86	78%	0.782	S	S	*	*			trans	61.7	99.4	150.6	-170.6	0	0	0	0	119.4
54	G	56.4	Low	52.8	Low	73 Å²	73	132.2 Å²	132.2	75%	0.753	78%	0.779	S	S	*	*				42.5	120.5	128.1	0	0	0	0	0	121.2
55	D	57.6	Low	52.5	Low	157 Å²	157	135.1 Å²	135.1	84%	0.84	80%	0.8	S	S	*	*			trans	84	103.1	156.1	-149.9	-87	0	0	0	118.1
56	A	46.5	Very low	53.3	Low	96 Å²	96	131.9 Å²	131.9	79%	0.793	80%	0.795	S	S	*	*			trans	-162.9	84.2	149.5	0	0	0	0	0	110.5
57	V	56.1	Low	52.7	Low	115 Å²	115	132 Å²	132	70%	0.697	80%	0.796	S	S	*	*			trans	33.9	112.5	147.5	163	0	0	0	0	118.5	R59	V57-R59 PolarHBondContact O-N 3.45Å; V57-R59 VanDerWaalsContact O-N 3.13Å
58	A	56.6	Low	52.1	Low	99 Å²	99	126.1 Å²	126.1	82%	0.818	79%	0.786	S	S	*	*			trans	-54	112.9	158.7	0	0	0	0	0	110.3
59	R	48.1	Very low	51.6	Low	225 Å²	225	125 Å²	125	85%	0.849	79%	0.79	S	S	*	*			trans	-104.8	90.6	174.2	-167	179.8	168.4	162	-1.9	109.7	V57 P61	V57-R59 PolarHBondContact O-N 3.45Å; V57-R59 VanDerWaalsContact O-N 3.13Å; R59-P61 WeakPolarHBondContact O-CD 3.44Å
60	T	57.8	Low	51.4	Low	132 Å²	132	124.2 Å²	124.2	81%	0.81	79%	0.791	S	S	*	*			trans	-85.6	130.4	165.3	-19.2	0	0	0	0	109.5
61	P	57.8	Low	51.2	Low	99 Å²	99	124.1 Å²	124.1	64%	0.643	79%	0.793	S	S	*	*			trans	-136.8	164	154.6	41.9	-27.5	0	0	0	112.4	R59	R59-P61 WeakPolarHBondContact O-CD 3.44Å
62	P	48	Very low	51.1	Low	128 Å²	128	119.3 Å²	119.3	83%	0.831	78%	0.784	S	S	*	*				-111.4	157.6	-95.1	32.4	-15.7	0	0	0	113.5
63	A	52.3	Low	50.8	Low	94 Å²	94	123.7 Å²	123.7	78%	0.777	79%	0.791	S	S	*	*			trans	-109	136.1	158	0	0	0	0	0	107.1
64	P	48	Very low	50.5	Low	122 Å²	122	122.2 Å²	122.2	79%	0.792	78%	0.778	S	S	*	*				-151.6	146.7	67.7	34.4	-11.2	0	0	0	116.7
65	A	51.3	Low	50.5	Low	96 Å²	96	124.1 Å²	124.1	79%	0.793	78%	0.776	S	S	*	*				85	172.1	104.2	0	0	0	0	0	117.6
66	P	64.7	Low	50.1	Low	115 Å²	115	123.2 Å²	123.2	75%	0.747	78%	0.776	S	S	*	*				-131.9	125.4	-88.9	35.1	-16.8	0	0	0	114.6
67	Q	43.1	Very low	50.2	Low	205 Å²	205	124.9 Å²	124.9	96%	0.958	78%	0.78	S	S	*	*			trans	-153.1	123.1	170	-63.9	-170	99.2	0	0	114.2
68	G	39.9	Very low	49.7	Very low	65 Å²	65	124 Å²	124	67%	0.67	78%	0.778	S	S	*	*			trans	97.2	106.5	134.7	0	0	0	0	0	119.9
69	T	42.7	Very low	49.4	Very low	131 Å²	131	125 Å²	125	80%	0.804	78%	0.777	S	S	*	*			trans	69.4	100.2	137.5	55.8	0	0	0	0	120
70	T	43.7	Very low	49.5	Very low	130 Å²	130	125.4 Å²	125.4	80%	0.798	78%	0.778	S	S	*	*				94.8	152.1	97.5	-49.6	0	0	0	0	111.6
71	P	44.9	Very low	49.1	Very low	119 Å²	119	124.8 Å²	124.8	77%	0.773	78%	0.776	S	S	*	*			cis	-124.8	170.1	1.2	15.6	10.8	0	0	0	116
72	C	51.2	Low	48.7	Very low	112 Å²	112	128.7 Å²	128.7	76%	0.757	79%	0.785	S	S	*	*			trans	-69.6	156.9	162	-67.4	0	0	0	0	112.7
73	L	46.6	Very low	48.8	Very low	162 Å²	162	128.1 Å²	128.1	85%	0.848	78%	0.782	S	S	*	*			trans	126.2	156.9	142.2	-69.5	155.8	0	0	0	113.7
74	P	48.2	Very low	48.8	Very low	92 Å²	92	128.5 Å²	128.5	60%	0.597	79%	0.785	S	S	*	*			cis	-139	164.7	-42.9	36	-19.6	0	0	0	112.6
75	T	55.4	Low	49.2	Very low	113 Å²	113	129.9 Å²	129.9	69%	0.693	79%	0.791	S	S	*	*			trans	46	82.2	136.7	-50.3	0	0	0	0	118.8
76	T	50.1	Low	49.1	Very low	137 Å²	137	128.7 Å²	128.7	84%	0.84	79%	0.788	S	S	*	*			trans	-136	-1.7	142.5	-23.8	0	0	0	0	114.3	C78	T76-C78 PolarHBondContact O-N 3.28Å
77	C	47.9	Very low	48.6	Very low	132 Å²	132	127.9 Å²	127.9	89%	0.892	79%	0.791	S	S	*	*			trans	-79.2	67.3	159.2	-78.6	0	0	0	0	109.8	P79	C77-P79 WeakPolarHBondContact O-CD 3.5Å
78	C	44.5	Very low	49.2	Very low	97 Å²	97	130.1 Å²	130.1	66%	0.655	79%	0.791	S	S	*	*			trans	-87.8	110.7	157.8	-74.1	0	0	0	0	107.5	T76 R80	T76-C78 PolarHBondContact O-N 3.28Å; C78-R80 PolarHBondContact O-N 3.44Å
79	P	50.4	Low	49.9	Very low	120 Å²	120	130.5 Å²	130.5	78%	0.779	79%	0.794	S	S	*	*			trans	-66.7	129.3	164.6	28.1	-29.9	0	0	0	108.7	C77	C77-P79 WeakPolarHBondContact O-CD 3.5Å
80	R	51.9	Low	50.3	Low	232 Å²	232	139.9 Å²	139.9	88%	0.875	82%	0.815	S	S	*	*			trans	-29.8	125.6	167.7	-173.9	175.1	175.9	134.9	-3.7	112.9	C78 H82	C78-R80 PolarHBondContact O-N 3.44Å; R80-H82 PolarHBondContact O-N 3.03Å
81	P	48.4	Very low	50.6	Low	119 Å²	119	140.4 Å²	140.4	77%	0.773	82%	0.816	S	S	*	*	P	Polyproline II helix	trans	-70.2	126.4	174.3	26.1	-30.3	0	0	0	110.6
82	H	48.7	Very low	50.9	Low	181 Å²	181	141.5 Å²	141.5	84%	0.838	82%	0.818	S	S	*	*	P	Polyproline II helix	trans	-65.4	139.3	165.5	-100.5	-100.5	0	0	0	110.1	R80 A84	R80-H82 PolarHBondContact O-N 3.03Å; H82-A84 PolarHBondContact O-N 3.43Å
83	P	50.8	Low	50.9	Low	117 Å²	117	143.1 Å²	143.1	76%	0.76	82%	0.821	S	S	*	*	P	Polyproline II helix	trans	-71.3	118.9	167.2	28.6	-30.7	0	0	0	109.4	V85	P83-V85 PolarHBondContact O-N 3.05Å; P83-V85 VanDerWaalsContact O-N 3.14Å
84	A	52.5	Low	51.2	Low	101 Å²	101	142 Å²	142	84%	0.835	82%	0.82	S	S	*	*			trans	-71.7	102.8	169.8	0	0	0	0	0	109.3	H82 G86	H82-A84 PolarHBondContact O-N 3.43Å; A84-G86 PolarHBondContact O-N 3.25Å
85	V	56.4	Low	51.4	Low	151 Å²	151	145.1 Å²	145.1	92%	0.915	83%	0.834	S	S	*	*			trans	-64.5	112.8	154.8	156.9	0	0	0	0	107	P83	P83-V85 PolarHBondContact O-N 3.05Å; P83-V85 VanDerWaalsContact O-N 3.14Å
86	G	50	Low	51.1	Low	72 Å²	72	147.3 Å²	147.3	74%	0.742	84%	0.843	S	S	*	*			trans	-158	65.6	-178.6	0	0	0	0	0	112	A84	A84-G86 PolarHBondContact O-N 3.25Å
87	A	53.7	Low	51.2	Low	97 Å²	97	148 Å²	148	80%	0.802	84%	0.843	S	S	*	*			trans	-77.8	126.4	161.2	0	0	0	0	0	109.7
88	R	54.7	Low	51.4	Low	253 Å²	253	149.2 Å²	149.2	96%	0.955	84%	0.84	S	S	*	*			trans	166	101.7	157.4	-95.2	168.1	-172.4	-156.4	3.4	105.6
89	G	54.3	Low	52	Low	73 Å²	73	153.6 Å²	153.6	75%	0.753	86%	0.855	S	S	*	*				103.2	110.8	55.5	0	0	0	0	0	108.4
90	R	52.3	Low	52.1	Low	327 Å²	327	156.6 Å²	156.6	100%	1.234	86%	0.862	S	S	*	*			trans	-179.2	0	144	-99.3	178.2	-161.9	-77.4	0.2	109.4

Retrieved 90 of 90 residues in 18.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).