X5D2Y6_HUMAN Loading...

Necdin isoform B

AlphaFold DB , UniProt , Accession X5D2Y6, Species HUMAN (Homo sapiens, Human), Gene NDN, Length 108 aa.

						>X5D2Y6_HUMAN|X5D2Y6|NDN
MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKALQQAAEEGRAHQASWGCGPGRSTPPSGTCGSSSLRSSSK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.1	Low	61.1	Low	242 Å²	242	141.8 Å²	141.8	100%	1.192	77%	0.77	S	S	*	*				0	112.6	0	-66.4	-159.3	-89.6	0	0	108
2	S	63.9	Low	61.3	Low	121 Å²	121	140.8 Å²	140.8	85%	0.846	76%	0.764	S	S	*	*			trans	-172.3	124.6	137.3	-111.6	0	0	0	0	106.4
3	E	57.7	Low	61	Low	176 Å²	176	143.8 Å²	143.8	82%	0.822	77%	0.766	S	S	*	*			trans	-68	152.6	-162	-69.1	133.4	107.6	0	0	113.2	S5	E3-S5 VanDerWaalsContact C-N 3.3Å; E3-S5 PolarHBondContact O-N 2.84Å
4	Q	65.8	Low	60.7	Low	193 Å²	193	140.2 Å²	140.2	90%	0.902	77%	0.766	S	S	*	*			trans	-56.9	89.5	165.2	-61.8	169.3	-87.8	0	0	109.8	K6	Q4-K6 PolarHBondContact O-N 2.78Å
5	S	66.6	Low	60.7	Low	116 Å²	116	136.2 Å²	136.2	81%	0.811	76%	0.759	S	S	*	*			trans	-87.5	56.4	160.4	56.3	0	0	0	0	109.5	E3 D7	E3-S5 VanDerWaalsContact C-N 3.3Å; E3-S5 PolarHBondContact O-N 2.84Å; S5-D7 PolarHBondContact O-N 2.8Å
6	K	59.1	Low	60.7	Low	169 Å²	169	138.8 Å²	138.8	74%	0.735	76%	0.763	S	S	*	*			trans	-74.8	88.6	154	-168.6	160	-175.7	173.5	0	103.8	Q4 L8	Q4-K6 PolarHBondContact O-N 2.78Å; K6-L8 HydrophobicContact CG-CD2 4.25Å; K6-L8 HydrophobicContact CG-CG 4.31Å; K6-L8 PolarHBondContact O-N 3.09Å
7	D	59.8	Low	60.9	Low	140 Å²	140	136.2 Å²	136.2	75%	0.749	77%	0.765	S	S	*	*			trans	-60	86	169.6	-167.6	-108	0	0	0	106.4	S5 S9	S5-D7 PolarHBondContact O-N 2.8Å; D7-S9 PolarHBondContact O-N 2.87Å; D7-S9 WeakPolarHBondContact OD1-CB 3.21Å
8	L	62.5	Low	60.7	Low	125 Å²	125	134.8 Å²	134.8	65%	0.654	76%	0.762	S	S	*	*			trans	-71.4	57.4	159.7	-64.2	169.6	0	0	0	106	K6 D10	K6-L8 HydrophobicContact CG-CD2 4.25Å; K6-L8 HydrophobicContact CG-CG 4.31Å; K6-L8 PolarHBondContact O-N 3.09Å; L8-D10 HydrophobicContact CB-CB 4.38Å; L8-D10 PolarHBondContact O-N 2.94Å
9	S	62	Low	60.6	Low	89 Å²	89	135.6 Å²	135.6	62%	0.622	76%	0.764	S	S	*	*			trans	-67.3	71	149.7	-177.3	0	0	0	0	105.2	D7 P11	D7-S9 PolarHBondContact O-N 2.87Å; D7-S9 WeakPolarHBondContact OD1-CB 3.21Å; S9-P11 WeakPolarHBondContact O-CD 3.41Å
10	D	60.1	Low	60.8	Low	76 Å²	76	134.4 Å²	134.4	41%	0.406	77%	0.765	S	S	.	*			trans	-83.4	97.4	-178.6	-163.4	-13.7	0	0	0	104	L8 N12 F13	L8-D10 HydrophobicContact CB-CB 4.38Å; L8-D10 PolarHBondContact O-N 2.94Å; D10-N12 PolarHBondContact O-N 2.98Å; D10-N12 WeakPolarHBondContact OD1-CB 3.12Å; D10-N12 PolarHBondContact OD1-N 2.71Å; D10-F13 PolarHBondContact O-N 3.02Å
11	P	61	Low	60.7	Low	113 Å²	113	134.8 Å²	134.8	73%	0.734	76%	0.761	S	S	*	*	G	3₁₀ helix	trans	-66.6	-8.7	-177.2	-12	30.6	0	0	0	110.7	S9	S9-P11 WeakPolarHBondContact O-CD 3.41Å
12	N	62.7	Low	61.1	Low	130 Å²	130	128.8 Å²	128.8	70%	0.695	74%	0.737	S	S	*	*	G	3₁₀ helix	trans	-80.6	-13.1	-176.6	-164.1	47.8	0	0	0	113.7	D10	D10-N12 PolarHBondContact O-N 2.98Å; D10-N12 WeakPolarHBondContact OD1-CB 3.12Å; D10-N12 PolarHBondContact OD1-N 2.71Å
13	F	57.5	Low	61.1	Low	180 Å²	180	129.8 Å²	129.8	79%	0.789	73%	0.728	S	S	*	*	G	3₁₀ helix	trans	-87.6	-10	179.8	-131	-87.4	0	0	0	114	D10	D10-F13 PolarHBondContact O-N 3.02Å
14	A	57.3	Low	61.3	Low	93 Å²	93	126.6 Å²	126.6	77%	0.769	73%	0.726	S	S	*	*	S	Bend	trans	-97.2	-4.7	-178.1	0	0	0	0	0	114.3	E16	A14-E16 PolarHBondContact O-N 3.09Å
15	A	60.7	Low	61.4	Low	80 Å²	80	122.7 Å²	122.7	66%	0.661	72%	0.719	S	S	*	*			trans	-102.4	62.4	173.6	0	0	0	0	0	109.6	A17	A15-A17 PolarHBondContact O-N 2.86Å; A15-A17 VanDerWaalsContact O-N 3.13Å
16	E	60	Low	61.2	Low	177 Å²	177	123.2 Å²	123.2	83%	0.827	72%	0.72	S	S	*	*			trans	-48.2	117.8	159.7	-76.3	-176.7	81.6	0	0	108.8	A14	A14-E16 PolarHBondContact O-N 3.09Å
17	A	65.3	Low	60.9	Low	95 Å²	95	118.7 Å²	118.7	79%	0.785	72%	0.721	S	S	*	*			trans	-107.9	117.2	157.9	0	0	0	0	0	107	A15	A15-A17 PolarHBondContact O-N 2.86Å; A15-A17 VanDerWaalsContact O-N 3.13Å
18	P	56.3	Low	60.7	Low	111 Å²	111	117.8 Å²	117.8	72%	0.721	72%	0.721	S	S	*	*				-146.8	106.9	125.2	32.9	-14.7	0	0	0	111.4
19	N	59.5	Low	60.4	Low	150 Å²	150	117.3 Å²	117.3	80%	0.802	73%	0.728	S	S	*	*			trans	-136.9	93.8	141.5	54.4	78.6	0	0	0	108.5	E21	N19-E21 PolarHBondContact O-N 2.88Å
20	S	65.1	Low	60.5	Low	112 Å²	112	122.4 Å²	122.4	78%	0.783	74%	0.742	S	S	*	*			trans	-70.2	82.6	156	61.7	0	0	0	0	107.3	V22	S20-V22 VanDerWaalsContact C-N 3.32Å; S20-V22 PolarHBondContact O-N 3.33Å
21	E	58.6	Low	60.3	Low	143 Å²	143	121.7 Å²	121.7	67%	0.668	75%	0.752	S	S	*	*			trans	-85.7	90.2	157.3	-168.5	145.8	41.4	0	0	107.9	N19 H23	N19-E21 PolarHBondContact O-N 2.88Å; E21-H23 VanDerWaalsContact CG-CE1 3.41Å; E21-H23 WeakPolarHBondContact CG-CE1 3.1Å; E21-H23 PolarHBondContact O-N 2.92Å; E21-H23 IonicContact OE1-CE1 3.46Å; E21-H23 PolarHBondContact OE1-CE1 2.91Å; E21-H23 IonicContact OE1-NE2 3.76Å; E21-H23 IonicContact OE2-CE1 3.97Å
22	V	61.6	Low	60.4	Low	116 Å²	116	122.7 Å²	122.7	70%	0.703	76%	0.756	S	S	*	*			trans	-68.4	87.5	166.4	-176.5	0	0	0	0	106.4	S20 S24	S20-V22 VanDerWaalsContact C-N 3.32Å; S20-V22 PolarHBondContact O-N 3.33Å; V22-S24 PolarHBondContact O-N 3.29Å
23	H	63.9	Low	60.5	Low	142 Å²	142	121.1 Å²	121.1	66%	0.657	75%	0.753	S	S	*	*			trans	-67.1	91.2	165.8	-67.4	-67.1	0	0	0	108.1	E21 S25	E21-H23 VanDerWaalsContact CG-CE1 3.41Å; E21-H23 WeakPolarHBondContact CG-CE1 3.1Å; E21-H23 PolarHBondContact O-N 2.92Å; E21-H23 IonicContact OE1-CE1 3.46Å; E21-H23 PolarHBondContact OE1-CE1 2.91Å; E21-H23 IonicContact OE1-NE2 3.76Å; E21-H23 IonicContact OE2-CE1 3.97Å; H23-S25 PolarHBondContact O-N 3.46Å; H23-S25 VanDerWaalsContact O-N 3.09Å
24	S	61.2	Low	61	Low	109 Å²	109	118.3 Å²	118.3	76%	0.762	75%	0.753	S	S	*	*			trans	-61.1	110.5	168.9	-65	0	0	0	0	108.3	V22	V22-S24 PolarHBondContact O-N 3.29Å
25	S	67.6	Low	61.3	Low	110 Å²	110	118.9 Å²	118.9	77%	0.769	75%	0.751	S	S	*	*			trans	-89.9	132.2	167.9	-62.2	0	0	0	0	108	H23	H23-S25 PolarHBondContact O-N 3.46Å; H23-S25 VanDerWaalsContact O-N 3.09Å
26	P	63.8	Low	61.6	Low	128 Å²	128	119.3 Å²	119.3	83%	0.831	75%	0.754	S	S	*	*				-152.5	131.3	106.1	33.8	-15.2	0	0	0	113
27	G	52.4	Low	61.8	Low	73 Å²	73	116.8 Å²	116.8	75%	0.753	75%	0.752	S	S	*	*			trans	-176.2	61.4	176.1	0	0	0	0	0	116.8
28	V	54.9	Low	61.9	Low	122 Å²	122	119.9 Å²	119.9	74%	0.739	75%	0.754	S	S	*	*			trans	38.6	116.6	141.6	-177.2	0	0	0	0	117.8
29	S	57.1	Low	62.5	Low	115 Å²	115	118.4 Å²	118.4	80%	0.804	75%	0.751	S	S	*	*				-151	103.2	108.7	-79.6	0	0	0	0	109.2	G31	S29-G31 PolarHBondContact O-N 3.1Å; S29-G31 VanDerWaalsContact O-N 3.09Å
30	E	62.8	Low	63.2	Low	195 Å²	195	119.2 Å²	119.2	91%	0.911	75%	0.75	S	S	*	*			trans	-52.8	110.1	158.2	-66.1	179.9	109.8	0	0	107.7
31	G	57.7	Low	63.7	Low	61 Å²	61	119.2 Å²	119.2	63%	0.629	75%	0.747	S	S	*	*			trans	-160.1	61.9	178.2	0	0	0	0	0	107.6	S29 P33	S29-G31 PolarHBondContact O-N 3.1Å; S29-G31 VanDerWaalsContact O-N 3.09Å; G31-P33 WeakPolarHBondContact O-CD 3.07Å
32	V	61.7	Low	64.7	Low	134 Å²	134	121.5 Å²	121.5	81%	0.812	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-62.3	116.3	161.8	110.3	0	0	0	0	104.7
33	P	66.1	Low	65.6	Low	98 Å²	98	120.4 Å²	120.4	64%	0.636	76%	0.755	S	S	*	*	P	Polyproline II helix	trans	-57.9	144.3	167.8	26.4	-32.2	0	0	0	106.5	G31 S35	G31-P33 WeakPolarHBondContact O-CD 3.07Å; P33-S35 PolarHBondContact O-N 3.11Å
34	P	66.6	Low	66.6	Low	120 Å²	120	118.8 Å²	118.8	78%	0.779	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-50.8	118	174.5	23.1	-32.4	0	0	0	106.5	A36	P34-A36 VanDerWaalsContact C-N 3.28Å; P34-A36 PolarHBondContact O-N 3.11Å
35	S	64.6	Low	67.5	Low	106 Å²	106	119.4 Å²	119.4	74%	0.741	76%	0.759	S	S	*	*			trans	-61.3	103.3	179.3	-160.5	0	0	0	0	104.6	P33 T37	P33-S35 PolarHBondContact O-N 3.11Å; S35-T37 PolarHBondContact O-N 3.01Å
36	A	66.6	Low	68.1	Low	88 Å²	88	122.4 Å²	122.4	73%	0.727	77%	0.765	S	S	*	*			trans	-66.2	94.5	169.5	0	0	0	0	0	103.6	P34 L38	P34-A36 VanDerWaalsContact C-N 3.28Å; P34-A36 PolarHBondContact O-N 3.11Å; A36-L38 PolarHBondContact O-N 3.13Å
37	T	65.2	Low	69.1	Low	125 Å²	125	118.6 Å²	118.6	77%	0.767	75%	0.749	S	S	*	*			trans	-59.7	87.6	161.1	-55.5	0	0	0	0	104.5	S35 A39	S35-T37 PolarHBondContact O-N 3.01Å; T37-A39 PolarHBondContact O-N 3.45Å
38	L	65.6	Low	70.4	Confident	159 Å²	159	121.6 Å²	121.6	83%	0.832	76%	0.756	S	S	*	*			trans	-56.5	100	156.4	-93.7	169.1	0	0	0	102.9	A36 E40	A36-L38 PolarHBondContact O-N 3.13Å; L38-E40 PolarHBondContact O-N 3.46Å
39	A	70.6	Confident	71.6	Confident	80 Å²	80	122 Å²	122	66%	0.661	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-47.1	119.3	171.3	0	0	0	0	0	105.4	T37 P41	T37-A39 PolarHBondContact O-N 3.45Å; A39-P41 VanDerWaalsContact O-N 3.12Å
40	E	72.8	Confident	72.6	Confident	168 Å²	168	120.8 Å²	120.8	79%	0.785	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-51.2	126.1	-178.6	-165.6	174.6	105.9	0	0	106.7	L38 Q42	L38-E40 PolarHBondContact O-N 3.46Å; E40-Q42 PolarHBondContact O-N 3.5Å
41	P	76.2	Confident	73.4	Confident	112 Å²	112	115.3 Å²	115.3	73%	0.727	74%	0.744	S	S	*	*	P	Polyproline II helix	trans	-54.3	118.2	-177.6	18.7	-29.3	0	0	0	107.6	A39 S43	A39-P41 VanDerWaalsContact O-N 3.12Å; P41-S43 PolarHBondContact O-N 3.34Å
42	Q	80.8	Confident	74.5	Confident	191 Å²	191	118.6 Å²	118.6	89%	0.893	75%	0.754	S	S	*	*	P	Polyproline II helix	trans	-56.8	118.4	-173.1	-166.5	178.8	-92.5	0	0	108.1	E40	E40-Q42 PolarHBondContact O-N 3.5Å
43	S	80.5	Confident	75.5	Confident	92 Å²	92	121.3 Å²	121.3	64%	0.643	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-59	134.4	-179.4	-70.9	0	0	0	0	108.9	P41	P41-S43 PolarHBondContact O-N 3.34Å
44	P	83.1	Confident	76.3	Confident	109 Å²	109	121.3 Å²	121.3	71%	0.708	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-57.7	150.2	173.6	24.5	-32	0	0	0	109.4	L46	P44-L46 PolarHBondContact O-N 3.48Å
45	P	81.1	Confident	77.1	Confident	121 Å²	121	119.8 Å²	119.8	79%	0.786	76%	0.764	S	S	*	*	P	Polyproline II helix	trans	-55.8	136.8	177.5	24.2	-32.9	0	0	0	109.1	G47	P45-G47 PolarHBondContact O-N 2.99Å
46	L	81.1	Confident	78	Confident	173 Å²	173	120.1 Å²	120.1	91%	0.906	76%	0.763	S	S	*	*			trans	-55.9	111.3	173.6	-73.5	163.4	0	0	0	107.5	P44	P44-L46 PolarHBondContact O-N 3.48Å
47	G	83.9	Confident	78.9	Confident	48 Å²	48	121.2 Å²	121.2	50%	0.495	76%	0.763	S	S	.	*			trans	-61.7	169.8	174.7	0	0	0	0	0	110.5	P45 T49	P45-G47 PolarHBondContact O-N 2.99Å; G47-T49 PolarHBondContact O-N 3.32Å
48	P	79.3	Confident	79.7	Confident	137 Å²	137	121.2 Å²	121.2	89%	0.89	77%	0.765	S	S	*	*			trans	-56.2	110.6	175.5	23.5	-31.6	0	0	0	109.1	A50	P48-A50 PolarHBondContact O-N 2.76Å; P48-A50 VanDerWaalsContact O-N 3.11Å
49	T	81.4	Confident	80.4	Confident	129 Å²	129	122.9 Å²	122.9	79%	0.791	77%	0.768	S	S	*	*	P	Polyproline II helix	trans	-57.5	117.7	172.9	-63.1	0	0	0	0	107.5	G47 A51	G47-T49 PolarHBondContact O-N 3.32Å; T49-A51 PolarHBondContact O-N 3.44Å; T49-A51 VanDerWaalsContact O-N 3.1Å
50	A	76.3	Confident	80.7	Confident	91 Å²	91	122.8 Å²	122.8	75%	0.752	77%	0.768	S	S	*	*	P	Polyproline II helix	trans	-57.2	120.3	173.7	0	0	0	0	0	108.1	P48	P48-A50 PolarHBondContact O-N 2.76Å; P48-A50 VanDerWaalsContact O-N 3.11Å
51	A	81.1	Confident	80.7	Confident	79 Å²	79	121.1 Å²	121.1	65%	0.653	77%	0.771	S	S	*	*	P	Polyproline II helix	trans	-60	144.1	173.9	0	0	0	0	0	108.8	T49 Q53	T49-A51 PolarHBondContact O-N 3.44Å; T49-A51 VanDerWaalsContact O-N 3.1Å; A51-Q53 PolarHBondContact O-N 3.49Å; A51-Q53 VanDerWaalsContact O-N 3.11Å
52	P	80.5	Confident	80.5	Confident	130 Å²	130	121.2 Å²	121.2	84%	0.844	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-51.2	123.2	171.7	-23.2	32.1	0	0	0	109.2	A54	P52-A54 PolarHBondContact O-N 2.91Å
53	Q	82	Confident	79.8	Confident	192 Å²	192	117.3 Å²	117.3	90%	0.897	75%	0.751	S	S	*	*	P	Polyproline II helix	trans	-63.3	137.4	174.4	-67	-161.1	-55.1	0	0	108.7	A51 A55	A51-Q53 PolarHBondContact O-N 3.49Å; A51-Q53 VanDerWaalsContact O-N 3.11Å; Q53-A55 PolarHBondContact O-N 2.96Å
54	A	83.1	Confident	79.2	Confident	98 Å²	98	120.3 Å²	120.3	81%	0.81	76%	0.755	S	S	*	*	P	Polyproline II helix	trans	-59.5	137.6	174.9	0	0	0	0	0	109.6	P52	P52-A54 PolarHBondContact O-N 2.91Å
55	A	84.4	Confident	78.8	Confident	88 Å²	88	118.1 Å²	118.1	73%	0.727	75%	0.752	S	S	*	*	P	Polyproline II helix	trans	-59.7	142.9	176.3	0	0	0	0	0	110.2	Q53	Q53-A55 PolarHBondContact O-N 2.96Å
56	P	82.6	Confident	79	Confident	112 Å²	112	115.2 Å²	115.2	73%	0.727	73%	0.73	S	S	*	*	P	Polyproline II helix	trans	-60.1	150.9	174.2	26.8	-33.9	0	0	0	110.2
57	P	85.1	Confident	79	Confident	112 Å²	112	111.6 Å²	111.6	73%	0.727	72%	0.717	S	S	*	*	P	Polyproline II helix	trans	-59.4	147.4	177.5	25.9	-33.5	0	0	0	110.4	Q59	P57-Q59 PolarHBondContact O-N 2.7Å
58	P	82.7	Confident	79.1	Confident	125 Å²	125	116.4 Å²	116.4	81%	0.812	72%	0.724	S	S	*	*	P	Polyproline II helix	trans	-57.4	133.2	176	24	-32.2	0	0	0	109.5	A60	P58-A60 PolarHBondContact O-N 3.02Å
59	Q	79.3	Confident	79.3	Confident	193 Å²	193	110.6 Å²	110.6	90%	0.902	69%	0.688	S	S	*	*	P	Polyproline II helix	trans	-61.6	136	175.4	-70.1	-176.8	-79.7	0	0	109.1	P57	P57-Q59 PolarHBondContact O-N 2.7Å
60	A	77.6	Confident	79.4	Confident	78 Å²	78	109 Å²	109	65%	0.645	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-57.3	153.5	174.6	0	0	0	0	0	110.2	P58 N62	P58-A60 PolarHBondContact O-N 3.02Å; A60-N62 PolarHBondContact O-N 3.19Å
61	P	72.3	Confident	79.8	Confident	133 Å²	133	111.6 Å²	111.6	86%	0.864	67%	0.67	S	S	*	*			trans	-51	111.1	172.6	-22.3	32.1	0	0	0	109.1	D63	P61-D63 PolarHBondContact O-N 3.39Å
62	N	71.6	Confident	80	Confident	115 Å²	115	113.6 Å²	113.6	62%	0.615	67%	0.666	S	S	*	*			trans	-83.6	117	-178.6	171.5	-88.7	0	0	0	107.7	A60 E64	A60-N62 PolarHBondContact O-N 3.19Å; N62-E64 PolarHBondContact O-N 3.03Å; N62-E64 WeakPolarHBondContact OD1-CB 3.02Å; N62-E64 PolarHBondContact OD1-N 2.74Å
63	D	67.2	Low	80.1	Confident	109 Å²	109	110.1 Å²	110.1	58%	0.583	65%	0.648	S	S	*	*	G	3₁₀ helix	trans	-76.5	-7.7	-178.5	-148.3	-126.4	0	0	0	112	P61 G65 D66 A69	P61-D63 PolarHBondContact O-N 3.39Å; D63-G65 PolarHBondContact O-N 3.19Å; D63-G65 VanDerWaalsContact O-N 3.14Å; D63-D66 WeakPolarHBondContact O-CB 3.13Å; D63-D66 PolarHBondContact O-N 2.86Å; D63-A69 HydrophobicContact CB-CB 4.48Å; D63-A69 WeakPolarHBondContact O-CB 3.42Å; D63-A69 WeakPolarHBondContact OD1-CB 3.47Å
64	E	67.6	Low	80	Confident	155 Å²	155	103.5 Å²	103.5	72%	0.724	63%	0.627	S	S	*	*	G	3₁₀ helix	trans	-67.8	-14.7	-175.9	-155	156.3	60.3	0	0	113.3	N62	N62-E64 PolarHBondContact O-N 3.03Å; N62-E64 WeakPolarHBondContact OD1-CB 3.02Å; N62-E64 PolarHBondContact OD1-N 2.74Å
65	G	75.1	Confident	79.9	Confident	62 Å²	62	104.2 Å²	104.2	64%	0.639	61%	0.613	S	S	*	*	G	3₁₀ helix	trans	-101.1	-3.3	170.8	0	0	0	0	0	114.6	D63	D63-G65 PolarHBondContact O-N 3.19Å; D63-G65 VanDerWaalsContact O-N 3.14Å
66	D	85.7	Confident	79.5	Confident	61 Å²	61	105.4 Å²	105.4	33%	0.326	60%	0.604	S	S	.	*			trans	-77.7	122.4	-178.4	-175.6	-75.5	0	0	0	110.1	D63 K68 A69 L70	D63-D66 WeakPolarHBondContact O-CB 3.13Å; D63-D66 PolarHBondContact O-N 2.86Å; D66-K68 PolarHBondContact O-N 3Å; D66-K68 VanDerWaalsContact OD1-CA 3.26Å; D66-K68 WeakPolarHBondContact OD1-CA 3.45Å; D66-K68 WeakPolarHBondContact OD1-CB 2.94Å; D66-K68 PolarHBondContact OD1-N 2.95Å; D66-A69 HydrophobicContact CB-CB 3.86Å; D66-A69 WeakPolarHBondContact O-CB 3.35Å; D66-A69 PolarHBondContact O-N 3.15Å; D66-A69 VanDerWaalsContact O-N 3.15Å; D66-A69 PolarHBondContact OD1-N 3.14Å; D66-L70 WeakPolarHBondContact O-CG 3.26Å; D66-L70 PolarHBondContact O-N 3.2Å
67	P	81.1	Confident	79	Confident	97 Å²	97	102 Å²	102	63%	0.63	59%	0.59	S	S	*	*	H	α-helix	trans	-64.8	-24.6	-175.9	25.2	-33.6	0	0	0	113	Q71	P67-Q71 WeakPolarHBondContact O-CB 3.36Å; P67-Q71 PolarHBondContact O-N 2.86Å
68	K	84.6	Confident	77.8	Confident	149 Å²	149	104.5 Å²	104.5	65%	0.648	58%	0.584	S	S	*	*	H	α-helix	trans	-76.7	-42.4	174.6	-54.1	-173.9	-179.7	-173.2	0	110.6	D66 L70 Q71 Q72	D66-K68 PolarHBondContact O-N 3Å; D66-K68 VanDerWaalsContact OD1-CA 3.26Å; D66-K68 WeakPolarHBondContact OD1-CA 3.45Å; D66-K68 WeakPolarHBondContact OD1-CB 2.94Å; D66-K68 PolarHBondContact OD1-N 2.95Å; K68-L70 VanDerWaalsContact C-N 3.32Å; K68-L70 PolarHBondContact O-N 3.29Å; K68-Q71 PolarHBondContact O-N 3.01Å; K68-Q71 VanDerWaalsContact O-N 3.14Å; K68-Q72 WeakPolarHBondContact O-CG 3.39Å; K68-Q72 PolarHBondContact O-N 3.18Å
69	A	83.4	Confident	76.8	Confident	15 Å²	15	101.7 Å²	101.7	12%	0.124	57%	0.572	C	S	.	*	H	α-helix	trans	-59	-44.1	174.9	0	0	0	0	0	112.1	D63 D66 Q71 Q72 A73	D63-A69 HydrophobicContact CB-CB 4.48Å; D63-A69 WeakPolarHBondContact O-CB 3.42Å; D63-A69 WeakPolarHBondContact OD1-CB 3.47Å; D66-A69 HydrophobicContact CB-CB 3.86Å; D66-A69 WeakPolarHBondContact O-CB 3.35Å; D66-A69 PolarHBondContact O-N 3.15Å; D66-A69 VanDerWaalsContact O-N 3.15Å; D66-A69 PolarHBondContact OD1-N 3.14Å; A69-Q71 VanDerWaalsContact C-N 3.34Å; A69-Q71 PolarHBondContact O-N 3.39Å; A69-Q72 PolarHBondContact O-N 3.44Å; A69-A73 WeakPolarHBondContact O-CB 3.42Å; A69-A73 PolarHBondContact O-N 2.99Å
70	L	83.6	Confident	75.5	Confident	95 Å²	95	98.5 Å²	98.5	50%	0.497	56%	0.557	S	S	.	*	H	α-helix	trans	-62.5	-39.8	174.7	-68.5	174.5	0	0	0	112.3	D66 K68 A74	D66-L70 WeakPolarHBondContact O-CG 3.26Å; D66-L70 PolarHBondContact O-N 3.2Å; K68-L70 VanDerWaalsContact C-N 3.32Å; K68-L70 PolarHBondContact O-N 3.29Å; L70-A74 WeakPolarHBondContact O-CB 3.47Å; L70-A74 PolarHBondContact O-N 2.67Å
71	Q	86.1	Confident	74.3	Confident	146 Å²	146	101.8 Å²	101.8	68%	0.682	56%	0.559	S	S	*	*	H	α-helix	trans	-67.5	-39.2	176.4	-177.6	159.2	84.3	0	0	112.2	P67 K68 A69 A74 E75	P67-Q71 WeakPolarHBondContact O-CB 3.36Å; P67-Q71 PolarHBondContact O-N 2.86Å; K68-Q71 PolarHBondContact O-N 3.01Å; K68-Q71 VanDerWaalsContact O-N 3.14Å; A69-Q71 VanDerWaalsContact C-N 3.34Å; A69-Q71 PolarHBondContact O-N 3.39Å; Q71-A74 PolarHBondContact O-N 3.45Å; Q71-E75 PolarHBondContact O-N 3.14Å
72	Q	85.1	Confident	73.4	Confident	120 Å²	120	99.4 Å²	99.4	56%	0.561	55%	0.55	S	S	*	*	H	α-helix	trans	-66.8	-45.4	175.6	-71.6	-177.1	-94.6	0	0	111.7	K68 A69 A74 E75 E76	K68-Q72 WeakPolarHBondContact O-CG 3.39Å; K68-Q72 PolarHBondContact O-N 3.18Å; A69-Q72 PolarHBondContact O-N 3.44Å; Q72-A74 PolarHBondContact O-N 2.82Å; Q72-E75 WeakPolarHBondContact O-CB 3.39Å; Q72-E75 PolarHBondContact O-N 2.88Å; Q72-E75 VanDerWaalsContact O-N 3.1Å; Q72-E76 WeakPolarHBondContact O-CB 3.38Å; Q72-E76 WeakPolarHBondContact O-CG 3.36Å; Q72-E76 PolarHBondContact O-N 2.88Å
73	A	81.5	Confident	72.6	Confident	57 Å²	57	98.5 Å²	98.5	47%	0.471	55%	0.553	S	S	.	*	H	α-helix	trans	-61.1	-34.6	175.3	0	0	0	0	0	112.1	A69 G77	A69-A73 WeakPolarHBondContact O-CB 3.42Å; A69-A73 PolarHBondContact O-N 2.99Å; A73-G77 PolarHBondContact O-N 3.1Å
74	A	81.1	Confident	72	Confident	54 Å²	54	103.4 Å²	103.4	45%	0.446	56%	0.563	S	S	.	*	H	α-helix	trans	-69.1	-38.3	173.8	0	0	0	0	0	112.8	L70 Q71 Q72 R78	L70-A74 WeakPolarHBondContact O-CB 3.47Å; L70-A74 PolarHBondContact O-N 2.67Å; Q71-A74 PolarHBondContact O-N 3.45Å; Q72-A74 PolarHBondContact O-N 2.82Å; A74-R78 WeakPolarHBondContact O-CG 3.45Å; A74-R78 PolarHBondContact O-N 3.01Å; A74-R78 VanDerWaalsContact O-N 3.13Å
75	E	79.8	Confident	71.2	Confident	113 Å²	113	99.3 Å²	99.3	53%	0.528	56%	0.562	S	S	.	*	H	α-helix	trans	-67.1	-47.4	175.1	-166.3	95.9	97.8	0	0	111.2	Q71 Q72 R78 A79	Q71-E75 PolarHBondContact O-N 3.14Å; Q72-E75 WeakPolarHBondContact O-CB 3.39Å; Q72-E75 PolarHBondContact O-N 2.88Å; Q72-E75 VanDerWaalsContact O-N 3.1Å; E75-R78 WeakPolarHBondContact O-CB 3.46Å; E75-R78 PolarHBondContact O-N 3.2Å; E75-R78 IonicContact OE2-CZ 3.81Å; E75-R78 IonicContact OE2-NE 3.91Å; E75-R78 IonicContact OE2-NH2 2.86Å; E75-R78 PolarHBondContact OE2-NH2 3.19Å; E75-A79 PolarHBondContact O-N 3.42Å
76	E	76.8	Confident	69.6	Low	112 Å²	112	102.3 Å²	102.3	52%	0.523	57%	0.572	S	S	.	*	H	α-helix	trans	-63	-45.7	176.4	-71.5	176.2	156.6	0	0	110.1	Q72 R78 A79 H80	Q72-E76 WeakPolarHBondContact O-CB 3.38Å; Q72-E76 WeakPolarHBondContact O-CG 3.36Å; Q72-E76 PolarHBondContact O-N 2.88Å; E76-R78 PolarHBondContact O-N 2.83Å; E76-A79 WeakPolarHBondContact O-CB 3.47Å; E76-A79 PolarHBondContact O-N 3.31Å; E76-H80 PolarHBondContact O-N 3.03Å; E76-H80 PolarHBondContact O-ND1 2.79Å
77	G	71.3	Confident	67.4	Low	42 Å²	42	102.7 Å²	102.7	43%	0.433	59%	0.59	S	S	.	*	H	α-helix	trans	-56.6	-33.9	175	0	0	0	0	0	113.3	A73 Q81	A73-G77 PolarHBondContact O-N 3.1Å; G77-Q81 WeakPolarHBondContact O-CB 3.46Å; G77-Q81 PolarHBondContact O-N 2.99Å
78	R	60.9	Low	66	Low	163 Å²	163	105 Å²	105	62%	0.615	61%	0.606	S	S	*	*	H	α-helix	trans	-72.1	-40	172	-78.1	-162.1	-65.6	-123.7	1.6	113.2	A74 E75 E76 H80 Q81 A82	A74-R78 WeakPolarHBondContact O-CG 3.45Å; A74-R78 PolarHBondContact O-N 3.01Å; A74-R78 VanDerWaalsContact O-N 3.13Å; E75-R78 WeakPolarHBondContact O-CB 3.46Å; E75-R78 PolarHBondContact O-N 3.2Å; E75-R78 IonicContact OE2-CZ 3.81Å; E75-R78 IonicContact OE2-NE 3.91Å; E75-R78 IonicContact OE2-NH2 2.86Å; E75-R78 PolarHBondContact OE2-NH2 3.19Å; E76-R78 PolarHBondContact O-N 2.83Å; R78-H80 VanDerWaalsContact C-N 3.3Å; R78-H80 PolarHBondContact O-N 2.91Å; R78-Q81 PolarHBondContact O-N 3.18Å; R78-A82 WeakPolarHBondContact O-CB 3.48Å; R78-A82 PolarHBondContact O-N 2.86Å
79	A	60.4	Low	63.9	Low	67 Å²	67	101 Å²	101	55%	0.554	61%	0.606	S	S	*	*	H	α-helix	trans	-62.8	-39.4	175	0	0	0	0	0	111.5	E75 E76 S83	E75-A79 PolarHBondContact O-N 3.42Å; E76-A79 WeakPolarHBondContact O-CB 3.47Å; E76-A79 PolarHBondContact O-N 3.31Å; A79-S83 PolarHBondContact O-N 3.13Å
80	H	53.2	Low	62.4	Low	126 Å²	126	112.3 Å²	112.3	58%	0.583	65%	0.645	S	S	*	*	H	α-helix	trans	-70.7	-39.9	174.2	-63.9	92.6	0	0	0	111.5	E76 R78 A82 S83 W84	E76-H80 PolarHBondContact O-N 3.03Å; E76-H80 PolarHBondContact O-ND1 2.79Å; R78-H80 VanDerWaalsContact C-N 3.3Å; R78-H80 PolarHBondContact O-N 2.91Å; H80-A82 VanDerWaalsContact C-N 3.32Å; H80-A82 PolarHBondContact O-N 3.31Å; H80-S83 WeakPolarHBondContact O-CB 3.4Å; H80-S83 PolarHBondContact O-N 3.49Å; H80-W84 VanDerWaalsContact O-CD1 3.25Å
81	Q	52.9	Low	60.3	Low	147 Å²	147	113 Å²	113	69%	0.687	66%	0.658	S	S	*	*	H	α-helix	trans	-66.3	-32.8	175.9	-156.8	-163.2	89.3	0	0	112.6	G77 R78 S83 W84	G77-Q81 WeakPolarHBondContact O-CB 3.46Å; G77-Q81 PolarHBondContact O-N 2.99Å; R78-Q81 PolarHBondContact O-N 3.18Å; Q81-S83 PolarHBondContact O-N 3.48Å; Q81-W84 CarbonylContact O-C 3.57Å; Q81-W84 PolarHBondContact O-N 3.31Å
82	A	53.3	Low	58.5	Low	83 Å²	83	112.1 Å²	112.1	69%	0.686	66%	0.663	S	S	*	*	H	α-helix	trans	-66.2	-22.4	175.4	0	0	0	0	0	113.4	R78 H80	R78-A82 WeakPolarHBondContact O-CB 3.48Å; R78-A82 PolarHBondContact O-N 2.86Å; H80-A82 VanDerWaalsContact C-N 3.32Å; H80-A82 PolarHBondContact O-N 3.31Å
83	S	53.3	Low	56.6	Low	95 Å²	95	112.1 Å²	112.1	66%	0.664	67%	0.673	S	S	*	*	H	α-helix	trans	-81.2	-18.7	174.9	180	0	0	0	0	113.5	A79 H80 Q81	A79-S83 PolarHBondContact O-N 3.13Å; H80-S83 WeakPolarHBondContact O-CB 3.4Å; H80-S83 PolarHBondContact O-N 3.49Å; Q81-S83 PolarHBondContact O-N 3.48Å
84	W	54.3	Low	54.7	Low	213 Å²	213	114.7 Å²	114.7	81%	0.807	69%	0.686	S	S	*	*	S	Bend	trans	-107.7	80.1	176.2	-62.9	75.1	0	0	0	107.6	H80 Q81 C86	H80-W84 VanDerWaalsContact O-CD1 3.25Å; Q81-W84 CarbonylContact O-C 3.57Å; Q81-W84 PolarHBondContact O-N 3.31Å; W84-C86 PolarHBondContact O-N 2.92Å; W84-C86 VanDerWaalsContact O-N 3.13Å
85	G	50.9	Low	53.4	Low	68 Å²	68	118.2 Å²	118.2	70%	0.701	71%	0.707	S	S	*	*			trans	-48	116.2	-171.1	0	0	0	0	0	114.3
86	C	41.5	Very low	51.7	Low	125 Å²	125	115.8 Å²	115.8	85%	0.845	71%	0.712	S	S	*	*			trans	-160.1	116.3	136.4	-105.7	0	0	0	0	106.7	W84	W84-C86 PolarHBondContact O-N 2.92Å; W84-C86 VanDerWaalsContact O-N 3.13Å
87	G	41.3	Very low	50.3	Low	69 Å²	69	116.9 Å²	116.9	71%	0.711	73%	0.727	S	S	*	*			trans	-67.8	-171.3	-163.1	0	0	0	0	0	116.8	G89	G87-G89 PolarHBondContact O-N 3.13Å
88	P	51.3	Low	49.1	Very low	147 Å²	147	121 Å²	121	96%	0.955	75%	0.747	S	S	*	*			trans	-74.7	106.3	-169.5	31.7	-31.7	0	0	0	109.5
89	G	40.4	Very low	48.2	Very low	63 Å²	63	116.5 Å²	116.5	65%	0.649	75%	0.752	S	S	*	*			trans	-149.3	86.5	177.1	0	0	0	0	0	109.9	G87 S91	G87-G89 PolarHBondContact O-N 3.13Å; G89-S91 PolarHBondContact O-N 3.17Å
90	R	51.3	Low	48.1	Very low	253 Å²	253	118 Å²	118	96%	0.955	76%	0.758	S	S	*	*			trans	-63.7	95.2	155.4	-69.2	176.1	100.2	-114.8	8.4	106.6
91	S	39.5	Very low	47.5	Very low	109 Å²	109	117.2 Å²	117.2	76%	0.762	77%	0.767	S	S	*	*			trans	-139.6	125.9	158.3	-82.2	0	0	0	0	107.9	G89	G89-S91 PolarHBondContact O-N 3.17Å
92	T	47.7	Very low	47.2	Very low	129 Å²	129	115 Å²	115	79%	0.791	77%	0.768	S	S	*	*			trans	-38.3	154.2	165.2	37.8	0	0	0	0	113.5
93	P	46.1	Very low	47.2	Very low	119 Å²	119	118.9 Å²	118.9	77%	0.773	78%	0.776	S	S	*	*			trans	-74	136.3	-160.7	31.2	-34.7	0	0	0	111.8
94	P	42.2	Very low	47.1	Very low	112 Å²	112	125.5 Å²	125.5	73%	0.727	79%	0.786	S	S	*	*			trans	-86.5	115.7	145.7	30.4	-23.4	0	0	0	107.3	G96	P94-G96 PolarHBondContact O-N 2.99Å
95	S	52.9	Low	46.8	Very low	128 Å²	128	120.1 Å²	120.1	90%	0.895	78%	0.781	S	S	*	*			trans	-35.7	110.8	153.3	49.2	0	0	0	0	109.7
96	G	43.6	Very low	46.6	Very low	62 Å²	62	121.6 Å²	121.6	64%	0.639	78%	0.781	S	S	*	*			trans	-172.1	68.7	-171	0	0	0	0	0	110.6	P94	P94-G96 PolarHBondContact O-N 2.99Å
97	T	46.8	Very low	46.8	Very low	135 Å²	135	121.3 Å²	121.3	83%	0.828	78%	0.78	S	S	*	*			trans	21	105.9	156.9	56.5	0	0	0	0	115.8	G99	T97-G99 PolarHBondContact O-N 3.06Å
98	C	47.9	Very low	46.9	Very low	127 Å²	127	131 Å²	131	86%	0.858	80%	0.803	S	S	*	*			trans	-51.5	96	154.8	-173.7	0	0	0	0	107.9	S100	C98-S100 PolarHBondContact O-N 2.92Å
99	G	41.8	Very low	46.7	Very low	69 Å²	69	130.2 Å²	130.2	71%	0.711	80%	0.795	S	S	*	*			trans	-67.3	100.8	-179.2	0	0	0	0	0	108.2	T97	T97-G99 PolarHBondContact O-N 3.06Å
100	S	56.8	Low	47	Very low	100 Å²	100	133.7 Å²	133.7	70%	0.699	80%	0.803	S	S	*	*			trans	-56	161.8	171.3	-56.9	0	0	0	0	110.6	C98	C98-S100 PolarHBondContact O-N 2.92Å
101	S	42	Very low	46.8	Very low	109 Å²	109	127.1 Å²	127.1	76%	0.762	80%	0.795	S	S	*	*			trans	82.7	137.2	163.8	-20.8	0	0	0	0	112.5
102	S	45.2	Very low	47.2	Very low	100 Å²	100	128.2 Å²	128.2	70%	0.699	80%	0.797	S	S	*	*			cis	-170	139	17.5	-120.2	0	0	0	0	108.4
103	L	54.1	Low	47.2	Very low	165 Å²	165	128.1 Å²	128.1	86%	0.864	80%	0.797	S	S	*	*			trans	4.4	116.1	135.4	-63.1	158.8	0	0	0	116.2
104	R	52	Low	47.2	Very low	233 Å²	233	128.7 Å²	128.7	88%	0.879	80%	0.798	S	S	*	*			trans	-174	92	135.1	-155.2	161.1	-79.5	-103.1	3.4	107.8
105	S	47.5	Very low	47.6	Very low	100 Å²	100	129.9 Å²	129.9	70%	0.699	80%	0.804	S	S	*	*				39.3	104.9	93.4	-157	0	0	0	0	114.3
106	S	46	Very low	47.2	Very low	99 Å²	99	130.1 Å²	130.1	69%	0.692	80%	0.796	S	S	*	*			trans	75.3	140.2	137.5	-53	0	0	0	0	121.2
107	S	46	Very low	47.5	Very low	120 Å²	120	135.8 Å²	135.8	84%	0.839	81%	0.81	S	S	*	*			trans	82.7	136	147.3	-56.4	0	0	0	0	115.9
108	K	43.6	Very low	47.5	Very low	272 Å²	272	135.8 Å²	135.8	100%	1.183	81%	0.808	S	S	*	*			cis	-157.6	0	10.8	-164.1	171.7	76.7	-161.8	0	108

Retrieved 108 of 108 residues in 59.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).