X5D602_HUMAN Loading...

Cytochrome b

AlphaFold DB , UniProt , Accession X5D602, Species HUMAN (Homo sapiens, Human), Gene CYTB, Length 76 aa.

						>X5D602_HUMAN|X5D602|CYTB
PILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKWA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	P	52	Low	49.4	Very low	149 Å²	149	127.9 Å²	127.9	97%	0.968	66%	0.656	S	S	*	*				0	-46.4	0	-8.9	28.1	0	0	0	114.4
2	I	53.8	Low	49.2	Very low	161 Å²	161	129.4 Å²	129.4	83%	0.826	66%	0.661	S	S	*	*			trans	-85.9	-23.8	-179	-69.9	159.2	0	0	0	113.3
3	L	45.8	Very low	49.3	Very low	139 Å²	139	130.8 Å²	130.8	73%	0.728	66%	0.66	S	S	*	*	S	Bend	trans	-94.5	6.7	177.2	-71.8	168.7	0	0	0	114.2	M5	L3-M5 PolarHBondContact O-N 3.35Å
4	H	44.2	Very low	50.2	Low	149 Å²	149	122.1 Å²	122.1	69%	0.69	62%	0.615	S	S	*	*			trans	-78.6	92.5	176.2	-81.3	-82.1	0	0	0	110.4
5	M	56.5	Low	51.3	Low	155 Å²	155	120.3 Å²	120.3	76%	0.764	62%	0.616	S	S	*	*			trans	-92.8	4.1	171.5	-69.8	-85.9	165	0	0	112.9	L3	L3-M5 PolarHBondContact O-N 3.35Å
6	S	44.7	Very low	52.5	Low	38 Å²	38	117.1 Å²	117.1	27%	0.266	60%	0.6	S	S	.	*			trans	-96.3	127.4	-177.4	174.9	0	0	0	0	112.1	Q8 R14	S6-Q8 VanDerWaalsContact C-N 3.26Å; S6-Q8 PolarHBondContact O-N 3.27Å; S6-Q8 PolarHBondContact OG-N 3.26Å; S6-Q8 PolarHBondContact OG-O 2.89Å; S6-R14 PolarHBondContact OG-NH1 3.29Å; S6-R14 VanDerWaalsContact OG-NH1 3.16Å
7	K	53.2	Low	53.7	Low	198 Å²	198	111.4 Å²	111.4	86%	0.861	57%	0.572	S	S	*	*	S	Bend	trans	-73.7	-6.7	172.2	-86.9	-169.3	178	-179.5	0	114.5
8	Q	43	Very low	54.9	Low	59 Å²	59	109.6 Å²	109.6	28%	0.276	56%	0.561	S	S	.	*			trans	-112	127.9	174.7	-91.1	173.6	-36.8	0	0	110.8	S6 S10 W75	S6-Q8 VanDerWaalsContact C-N 3.26Å; S6-Q8 PolarHBondContact O-N 3.27Å; S6-Q8 PolarHBondContact OG-N 3.26Å; S6-Q8 PolarHBondContact OG-O 2.89Å; Q8-S10 VanDerWaalsContact C-N 3.32Å; Q8-W75 HydrophobicContact CG-CH2 3.98Å; Q8-W75 HydrophobicContact CG-CZ3 3.83Å
9	Q	51.2	Low	56.3	Low	209 Å²	209	107.2 Å²	107.2	98%	0.977	56%	0.555	S	S	*	*	S	Bend	trans	-78.9	-15.5	179.1	-165.6	172.5	-6.3	0	0	112.7
10	S	45.7	Very low	57.6	Low	59 Å²	59	102.4 Å²	102.4	41%	0.413	53%	0.531	S	S	.	.			trans	-108.7	124.7	-177.2	-177.4	0	0	0	0	111.7	Q8 M12	Q8-S10 VanDerWaalsContact C-N 3.32Å; S10-M12 PolarHBondContact O-N 3.48Å; S10-M12 WeakPolarHBondContact OG-CB 3.45Å; S10-M12 PolarHBondContact OG-N 2.93Å
11	M	52.9	Low	58.8	Low	91 Å²	91	103.4 Å²	103.4	45%	0.448	53%	0.528	S	S	.	.	G	3₁₀ helix	trans	-75.2	5.8	173.1	-155.1	174.4	-84.4	0	0	112.2	Q18 Y21	M11-Q18 HydrophobicContact CG-CG 4.17Å; M11-Q18 WeakPolarHBondContact O-CG 3.31Å; M11-Q18 PolarHBondContact O-NE2 3.22Å; M11-Y21 HydrophobicContact SD-CG 4.27Å
12	M	47	Very low	60.3	Low	146 Å²	146	105.2 Å²	105.2	72%	0.719	52%	0.516	S	S	*	.	G	3₁₀ helix	trans	-76	-21.1	-172.7	-162.8	172.8	-177	0	0	114.2	S10	S10-M12 PolarHBondContact O-N 3.48Å; S10-M12 WeakPolarHBondContact OG-CB 3.45Å; S10-M12 PolarHBondContact OG-N 2.93Å
13	F	50.7	Low	61.9	Low	147 Å²	147	101.5 Å²	101.5	65%	0.645	50%	0.497	S	S	*	.	G	3₁₀ helix	trans	-107.2	17.9	-177.6	-67.9	-75.1	0	0	0	114.3
14	R	62.4	Low	63.9	Low	9 Å²	9	95.9 Å²	95.9	3%	0.034	47%	0.468	C	S	.	.			trans	-134.4	81.3	-168.6	-66.2	-177.8	70.7	141.8	27.9	111.4	S6 L16 S17 Q18 S66 E69	S6-R14 PolarHBondContact OG-NH1 3.29Å; S6-R14 VanDerWaalsContact OG-NH1 3.16Å; R14-L16 PolarHBondContact O-N 2.91Å; R14-S17 PolarHBondContact NE-OG 3.15Å; R14-S17 PolarHBondContact O-N 3.01Å; R14-S17 VanDerWaalsContact O-N 3.17Å; R14-Q18 PolarHBondContact O-N 3.38Å; R14-S66 PolarHBondContact NH2-O 3.5Å; R14-E69 VanDerWaalsContact CA-OE1 3.23Å; R14-E69 WeakPolarHBondContact CA-OE1 3.28Å; R14-E69 VanDerWaalsContact CB-OE1 3.28Å; R14-E69 WeakPolarHBondContact CB-OE1 3.4Å; R14-E69 IonicContact CZ-OE2 3.18Å; R14-E69 IonicContact NE-OE2 2.67Å; R14-E69 PolarHBondContact NE-OE2 2.94Å; R14-E69 IonicContact NH2-OE2 2.84Å; R14-E69 PolarHBondContact NH2-OE2 3.11Å
15	P	66.4	Low	66.1	Low	96 Å²	96	90.1 Å²	90.1	62%	0.623	45%	0.446	S	S	*	.	H	α-helix	trans	-62.5	-27.2	-174.1	24.4	-32.9	0	0	0	113.2	S19	P15-S19 PolarHBondContact O-N 3Å
16	L	70.6	Confident	67.8	Low	69 Å²	69	85 Å²	85	36%	0.361	43%	0.428	S	S	.	.	H	α-helix	trans	-78.9	-35.4	176.7	-59.6	168.7	0	0	0	111.5	R14 Q18 S19 L20 I65 E69 M72	R14-L16 PolarHBondContact O-N 2.91Å; L16-Q18 VanDerWaalsContact C-N 3.34Å; L16-S19 PolarHBondContact O-OG 3Å; L16-L20 PolarHBondContact O-N 3.38Å; L16-I65 HydrophobicContact CB-CG2 3.65Å; L16-E69 WeakPolarHBondContact CA-OE1 3.29Å; L16-E69 HydrophobicContact CB-CG 4.09Å; L16-E69 VanDerWaalsContact CB-OE1 3.29Å; L16-E69 WeakPolarHBondContact CB-OE1 3.43Å; L16-E69 HydrophobicContact CD1-CG 3.9Å; L16-E69 HydrophobicContact CG-CG 4.4Å; L16-E69 PolarHBondContact N-OE1 2.74Å; L16-M72 HydrophobicContact CD1-SD 4.41Å
17	S	72.3	Confident	70	Confident	19 Å²	19	83.7 Å²	83.7	13%	0.133	42%	0.418	C	S	.	.	H	α-helix	trans	-68.1	-33.3	172.3	-68.8	0	0	0	0	112.4	R14 Y21 E69	R14-S17 PolarHBondContact NE-OG 3.15Å; R14-S17 PolarHBondContact O-N 3.01Å; R14-S17 VanDerWaalsContact O-N 3.17Å; S17-Y21 PolarHBondContact O-N 2.91Å; S17-Y21 VanDerWaalsContact O-N 3.1Å; S17-E69 PolarHBondContact N-OE1 3.4Å; S17-E69 VanDerWaalsContact N-OE1 3.14Å; S17-E69 PolarHBondContact OG-OE2 3.49Å
18	Q	75.6	Confident	71.8	Confident	79 Å²	79	77.7 Å²	77.7	37%	0.369	40%	0.396	S	S	.	.	H	α-helix	trans	-66.8	-42.6	174.3	-74.5	-178.6	4	0	0	112.4	M11 R14 L16 L20 Y21 W22	M11-Q18 HydrophobicContact CG-CG 4.17Å; M11-Q18 WeakPolarHBondContact O-CG 3.31Å; M11-Q18 PolarHBondContact O-NE2 3.22Å; R14-Q18 PolarHBondContact O-N 3.38Å; L16-Q18 VanDerWaalsContact C-N 3.34Å; Q18-L20 VanDerWaalsContact C-N 3.33Å; Q18-L20 PolarHBondContact O-N 3.34Å; Q18-Y21 WeakPolarHBondContact O-CB 3.2Å; Q18-Y21 PolarHBondContact O-N 3.3Å; Q18-W22 VanDerWaalsContact O-CD1 3.29Å; Q18-W22 PolarHBondContact O-N 3.21Å; Q18-W22 VanDerWaalsContact O-N 3.1Å
19	S	81.8	Confident	74.2	Confident	65 Å²	65	80.9 Å²	80.9	46%	0.455	41%	0.414	S	S	.	.	H	α-helix	trans	-64.8	-38.4	177.7	65.6	0	0	0	0	111.9	P15 L16 Y21 W22 L23	P15-S19 PolarHBondContact O-N 3Å; L16-S19 PolarHBondContact O-OG 3Å; S19-Y21 VanDerWaalsContact C-N 3.34Å; S19-Y21 PolarHBondContact O-N 3.32Å; S19-W22 PolarHBondContact O-N 3.3Å; S19-L23 WeakPolarHBondContact O-CB 3.39Å; S19-L23 PolarHBondContact O-N 2.98Å
20	L	82.4	Confident	76	Confident	11 Å²	11	74.5 Å²	74.5	6%	0.058	39%	0.385	C	S	.	.	H	α-helix	trans	-60.6	-40.8	171.7	-83.5	-178.4	0	0	0	113.4	L16 Q18 W22 L23 L24 T57 L61 I65	L16-L20 PolarHBondContact O-N 3.38Å; Q18-L20 VanDerWaalsContact C-N 3.33Å; Q18-L20 PolarHBondContact O-N 3.34Å; L20-W22 VanDerWaalsContact C-N 3.35Å; L20-L23 PolarHBondContact O-N 3.18Å; L20-L24 PolarHBondContact O-N 3.01Å; L20-T57 HydrophobicContact CD2-CG2 4.34Å; L20-L61 HydrophobicContact CD1-CB 4.27Å; L20-L61 HydrophobicContact CD2-CB 3.78Å; L20-L61 HydrophobicContact CD2-CD2 3.64Å; L20-L61 HydrophobicContact CD2-CG 4.17Å; L20-I65 HydrophobicContact CD1-CB 3.56Å; L20-I65 HydrophobicContact CD1-CD1 3.3Å; L20-I65 HydrophobicContact CD1-CG1 3.8Å; L20-I65 HydrophobicContact CD1-CG2 3.84Å; L20-I65 HydrophobicContact CD2-CD1 3.83Å; L20-I65 HydrophobicContact CG-CD1 3.46Å; L20-I65 VanDerWaalsContact CG-CD1 3.46Å; L20-I65 HydrophobicContact CG-CG1 4.48Å
21	Y	82.4	Confident	78	Confident	123 Å²	123	73.7 Å²	73.7	48%	0.482	38%	0.376	S	S	.	.	H	α-helix	trans	-62.5	-44.3	177.4	176.3	-98.1	0	0	0	111.3	M11 S17 Q18 S19 L23 L24 A25	M11-Y21 HydrophobicContact SD-CG 4.27Å; S17-Y21 PolarHBondContact O-N 2.91Å; S17-Y21 VanDerWaalsContact O-N 3.1Å; Q18-Y21 WeakPolarHBondContact O-CB 3.2Å; Q18-Y21 PolarHBondContact O-N 3.3Å; S19-Y21 VanDerWaalsContact C-N 3.34Å; S19-Y21 PolarHBondContact O-N 3.32Å; Y21-L23 VanDerWaalsContact C-N 3.33Å; Y21-L23 PolarHBondContact O-N 3.35Å; Y21-L24 PolarHBondContact O-N 2.99Å; Y21-A25 WeakPolarHBondContact O-CB 3.29Å; Y21-A25 PolarHBondContact O-N 3.27Å
22	W	84.3	Confident	79.8	Confident	187 Å²	187	74.4 Å²	74.4	71%	0.708	39%	0.386	S	S	*	.	H	α-helix	trans	-65.3	-36	175.1	-80.5	106.2	0	0	0	112.8	Q18 S19 L20 A25 A26	Q18-W22 VanDerWaalsContact O-CD1 3.29Å; Q18-W22 PolarHBondContact O-N 3.21Å; Q18-W22 VanDerWaalsContact O-N 3.1Å; S19-W22 PolarHBondContact O-N 3.3Å; L20-W22 VanDerWaalsContact C-N 3.35Å; W22-A25 PolarHBondContact O-N 3.44Å; W22-A26 WeakPolarHBondContact O-CB 3.36Å; W22-A26 PolarHBondContact O-N 2.69Å
23	L	86.9	Confident	81.8	Confident	83 Å²	83	74.6 Å²	74.6	44%	0.435	38%	0.379	S	S	.	.	H	α-helix	trans	-63.2	-44.7	173.7	-171.2	151.3	0	0	0	111.3	S19 L20 Y21 A25 A26 D27 T57	S19-L23 WeakPolarHBondContact O-CB 3.39Å; S19-L23 PolarHBondContact O-N 2.98Å; L20-L23 PolarHBondContact O-N 3.18Å; Y21-L23 VanDerWaalsContact C-N 3.33Å; Y21-L23 PolarHBondContact O-N 3.35Å; L23-A25 PolarHBondContact O-N 3.49Å; L23-A26 PolarHBondContact O-N 3.5Å; L23-D27 WeakPolarHBondContact O-CB 3.39Å; L23-D27 PolarHBondContact O-N 3.09Å; L23-T57 HydrophobicContact CD2-CG2 4.13Å
24	L	88.7	Confident	83.8	Confident	22 Å²	22	68.6 Å²	68.6	12%	0.115	35%	0.353	C	S	.	.	H	α-helix	trans	-62.1	-42.4	174.5	-170.1	91.1	0	0	0	111.7	L20 Y21 A26 D27 L28 Y54 T57 I58	L20-L24 PolarHBondContact O-N 3.01Å; Y21-L24 PolarHBondContact O-N 2.99Å; L24-A26 VanDerWaalsContact C-N 3.34Å; L24-A26 PolarHBondContact O-N 3.04Å; L24-D27 PolarHBondContact O-N 2.63Å; L24-L28 WeakPolarHBondContact O-CG 3.42Å; L24-L28 PolarHBondContact O-N 2.67Å; L24-Y54 HydrophobicContact CD1-CD2 4.06Å; L24-Y54 HydrophobicContact CD1-CE2 3.99Å; L24-Y54 HydrophobicContact CG-CE2 4.48Å; L24-T57 HydrophobicContact CB-CG2 4.46Å; L24-T57 HydrophobicContact CD1-CG2 3.94Å; L24-I58 HydrophobicContact CD1-CD1 3.93Å; L24-I58 HydrophobicContact CD1-CG1 3.54Å
25	A	89.9	Confident	85	Confident	28 Å²	28	71.4 Å²	71.4	23%	0.231	39%	0.385	C	S	.	.	H	α-helix	trans	-62.5	-42	177.3	0	0	0	0	0	111.6	Y21 W22 L23 L28 L29	Y21-A25 WeakPolarHBondContact O-CB 3.29Å; Y21-A25 PolarHBondContact O-N 3.27Å; W22-A25 PolarHBondContact O-N 3.44Å; L23-A25 PolarHBondContact O-N 3.49Å; A25-L28 PolarHBondContact O-N 3.09Å; A25-L29 WeakPolarHBondContact O-CG 3.35Å; A25-L29 PolarHBondContact O-N 2.94Å; A25-L29 VanDerWaalsContact O-N 3.11Å
26	A	92.2	Very high	85.9	Confident	47 Å²	47	70 Å²	70	39%	0.388	39%	0.388	S	S	.	.	H	α-helix	trans	-64.2	-42	174.5	0	0	0	0	0	112.2	W22 L23 L24 L29 I30	W22-A26 WeakPolarHBondContact O-CB 3.36Å; W22-A26 PolarHBondContact O-N 2.69Å; L23-A26 PolarHBondContact O-N 3.5Å; L24-A26 VanDerWaalsContact C-N 3.34Å; L24-A26 PolarHBondContact O-N 3.04Å; A26-L29 WeakPolarHBondContact O-CB 3.48Å; A26-L29 PolarHBondContact O-N 2.71Å; A26-I30 WeakPolarHBondContact O-CG1 3.44Å; A26-I30 PolarHBondContact O-N 3.37Å
27	D	90.7	Very high	86.7	Confident	10 Å²	10	69.8 Å²	69.8	5%	0.053	39%	0.385	C	S	.	.	H	α-helix	trans	-63.7	-40.6	178.1	-169.8	74	0	0	0	112.2	L23 L24 L29 I30 L31 Y54	L23-D27 WeakPolarHBondContact O-CB 3.39Å; L23-D27 PolarHBondContact O-N 3.09Å; L24-D27 PolarHBondContact O-N 2.63Å; D27-L29 PolarHBondContact O-N 2.84Å; D27-I30 PolarHBondContact O-N 2.96Å; D27-L31 WeakPolarHBondContact O-CG 3.11Å; D27-L31 PolarHBondContact O-N 3.44Å; D27-Y54 WeakPolarHBondContact OD2-CA 3.45Å; D27-Y54 VanDerWaalsContact OD2-CB 3.22Å; D27-Y54 WeakPolarHBondContact OD2-CB 3.44Å; D27-Y54 PolarHBondContact OD2-N 2.89Å
28	L	90.4	Very high	87.2	Confident	73 Å²	73	72.9 Å²	72.9	38%	0.382	40%	0.404	S	S	.	.	H	α-helix	trans	-62.8	-38.6	172.3	-77.5	173.5	0	0	0	112.9	L24 A25 L31 T32 Y54	L24-L28 WeakPolarHBondContact O-CG 3.42Å; L24-L28 PolarHBondContact O-N 2.67Å; A25-L28 PolarHBondContact O-N 3.09Å; L28-L31 PolarHBondContact O-N 3.2Å; L28-T32 WeakPolarHBondContact O-CB 3.28Å; L28-T32 PolarHBondContact O-N 3.15Å; L28-T32 PolarHBondContact O-OG1 2.97Å; L28-Y54 HydrophobicContact CD1-CE2 4.49Å; L28-Y54 HydrophobicContact CD2-CD2 4.1Å; L28-Y54 HydrophobicContact CD2-CE2 3.55Å; L28-Y54 HydrophobicContact CG-CD2 4.42Å; L28-Y54 HydrophobicContact CG-CE2 3.98Å
29	L	93.1	Very high	87.4	Confident	126 Å²	126	75.5 Å²	75.5	66%	0.66	43%	0.426	S	S	*	.	H	α-helix	trans	-64.8	-41.2	174.7	-71.5	172.1	0	0	0	111.2	A25 A26 D27 T32 W33	A25-L29 WeakPolarHBondContact O-CG 3.35Å; A25-L29 PolarHBondContact O-N 2.94Å; A25-L29 VanDerWaalsContact O-N 3.11Å; A26-L29 WeakPolarHBondContact O-CB 3.48Å; A26-L29 PolarHBondContact O-N 2.71Å; D27-L29 PolarHBondContact O-N 2.84Å; L29-T32 PolarHBondContact O-N 3.14Å; L29-W33 WeakPolarHBondContact O-CB 3.43Å; L29-W33 PolarHBondContact O-N 3.21Å
30	I	89.1	Confident	87.4	Confident	74 Å²	74	74.9 Å²	74.9	38%	0.379	42%	0.421	S	S	.	.	H	α-helix	trans	-63.7	-45.8	176.3	-68.1	165.4	0	0	0	110.8	A26 D27 T32 W33 I34 A50	A26-I30 WeakPolarHBondContact O-CG1 3.44Å; A26-I30 PolarHBondContact O-N 3.37Å; D27-I30 PolarHBondContact O-N 2.96Å; I30-T32 VanDerWaalsContact C-N 3.35Å; I30-T32 PolarHBondContact O-N 3.48Å; I30-W33 PolarHBondContact O-N 2.88Å; I30-I34 HydrophobicContact CG2-CD1 3.63Å; I30-I34 HydrophobicContact CG2-CG1 4.41Å; I30-I34 VanDerWaalsContact O-CG1 3.28Å; I30-I34 WeakPolarHBondContact O-CG1 3.2Å; I30-I34 PolarHBondContact O-N 3.44Å; I30-A50 HydrophobicContact CG2-CB 4.31Å
31	L	88.7	Confident	87.4	Confident	43 Å²	43	83.6 Å²	83.6	23%	0.225	46%	0.455	C	S	.	.	H	α-helix	trans	-61.3	-42.2	176.5	-78.2	165.2	0	0	0	112.2	D27 L28 W33 I34 G35 A50 Y54	D27-L31 WeakPolarHBondContact O-CG 3.11Å; D27-L31 PolarHBondContact O-N 3.44Å; L28-L31 PolarHBondContact O-N 3.2Å; L31-W33 VanDerWaalsContact C-N 3.34Å; L31-I34 PolarHBondContact O-N 3.28Å; L31-G35 PolarHBondContact O-N 3Å; L31-A50 HydrophobicContact CD2-CB 3.76Å; L31-A50 HydrophobicContact CG-CB 3.96Å; L31-Y54 HydrophobicContact CD1-CD2 4.3Å; L31-Y54 HydrophobicContact CD1-CG 4.28Å
32	T	90.7	Very high	87.4	Confident	106 Å²	106	80.5 Å²	80.5	65%	0.65	45%	0.45	S	S	*	.	H	α-helix	trans	-63.4	-42.3	176.7	-55.7	0	0	0	0	111.1	L28 L29 I30 G35	L28-T32 WeakPolarHBondContact O-CB 3.28Å; L28-T32 PolarHBondContact O-N 3.15Å; L28-T32 PolarHBondContact O-OG1 2.97Å; L29-T32 PolarHBondContact O-N 3.14Å; I30-T32 VanDerWaalsContact C-N 3.35Å; I30-T32 PolarHBondContact O-N 3.48Å; T32-G35 PolarHBondContact O-N 3.28Å
33	W	89.6	Confident	87.5	Confident	149 Å²	149	74 Å²	74	56%	0.564	43%	0.426	S	S	*	.	H	α-helix	trans	-65	-43.8	177.6	178.2	58.7	0	0	0	112.2	L29 I30 L31 G35 G36	L29-W33 WeakPolarHBondContact O-CB 3.43Å; L29-W33 PolarHBondContact O-N 3.21Å; I30-W33 PolarHBondContact O-N 2.88Å; L31-W33 VanDerWaalsContact C-N 3.34Å; W33-G35 VanDerWaalsContact C-N 3.33Å; W33-G35 PolarHBondContact O-N 3.42Å; W33-G36 PolarHBondContact O-N 2.94Å
34	I	90.9	Very high	87.5	Confident	21 Å²	21	72.7 Å²	72.7	11%	0.108	42%	0.422	C	S	.	.	H	α-helix	trans	-67.6	-34	178.3	-68.1	167.7	0	0	0	111.7	I30 L31 G36 Q37 I46	I30-I34 HydrophobicContact CG2-CD1 3.63Å; I30-I34 HydrophobicContact CG2-CG1 4.41Å; I30-I34 VanDerWaalsContact O-CG1 3.28Å; I30-I34 WeakPolarHBondContact O-CG1 3.2Å; I30-I34 PolarHBondContact O-N 3.44Å; L31-I34 PolarHBondContact O-N 3.28Å; I34-G36 PolarHBondContact O-N 3.16Å; I34-G36 VanDerWaalsContact O-N 3.16Å; I34-Q37 PolarHBondContact O-N 3.22Å; I34-I46 HydrophobicContact CD1-CB 3.83Å; I34-I46 HydrophobicContact CD1-CG2 3.37Å; I34-I46 HydrophobicContact CG1-CG2 4.47Å
35	G	87.4	Confident	87.6	Confident	69 Å²	69	75.7 Å²	75.7	71%	0.711	44%	0.437	S	S	*	.	H	α-helix	trans	-60.6	-22.3	176.1	0	0	0	0	0	114.1	L31 T32 W33	L31-G35 PolarHBondContact O-N 3Å; T32-G35 PolarHBondContact O-N 3.28Å; W33-G35 VanDerWaalsContact C-N 3.33Å; W33-G35 PolarHBondContact O-N 3.42Å
36	G	86.9	Confident	87.5	Confident	65 Å²	65	77.7 Å²	77.7	67%	0.67	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.1	-7.5	174.4	0	0	0	0	0	114.9	W33 I34	W33-G36 PolarHBondContact O-N 2.94Å; I34-G36 PolarHBondContact O-N 3.16Å; I34-G36 VanDerWaalsContact O-N 3.16Å
37	Q	86.2	Confident	87.4	Confident	66 Å²	66	76 Å²	76	31%	0.308	43%	0.431	S	S	.	.	S	Bend	trans	-85.8	150	177.8	-64.7	-55.9	-48.4	0	0	110.9	I34 F43	I34-Q37 PolarHBondContact O-N 3.22Å; Q37-F43 HydrophobicContact CB-CB 4.42Å; Q37-F43 HydrophobicContact CB-CD1 4.35Å; Q37-F43 HydrophobicContact CB-CD2 4.25Å; Q37-F43 HydrophobicContact CB-CG 4.09Å; Q37-F43 HydrophobicContact CG-CD1 4.25Å; Q37-F43 HydrophobicContact CG-CE1 4.34Å; Q37-F43 HydrophobicContact CG-CG 4.48Å
38	P	83.9	Confident	87.4	Confident	83 Å²	83	81.3 Å²	81.3	54%	0.539	46%	0.455	S	S	.	.			trans	-60.3	144.3	171.5	26.4	-33.6	0	0	0	110.1	S40	P38-S40 PolarHBondContact O-N 2.96Å
39	V	79.8	Confident	87.5	Confident	135 Å²	135	81.6 Å²	81.6	82%	0.818	46%	0.46	S	S	*	.	S	Bend	trans	-75.2	71	177.8	-169.4	0	0	0	0	109.5
40	S	81.8	Confident	87.4	Confident	52 Å²	52	75.8 Å²	75.8	36%	0.364	43%	0.43	S	S	.	.			trans	-120.4	155.5	174	59.2	0	0	0	0	110.4	P38 F43 T44	P38-S40 PolarHBondContact O-N 2.96Å; S40-F43 PolarHBondContact O-N 3.24Å; S40-T44 PolarHBondContact O-N 3.23Å
41	Y	82.3	Confident	87.5	Confident	193 Å²	193	74.7 Å²	74.7	76%	0.757	43%	0.429	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.8	128.4	166.9	-175.9	-90.2	0	0	0	108.4	I45	Y41-I45 HydrophobicContact CD2-CD1 4.02Å; Y41-I45 HydrophobicContact CE2-CD1 3.53Å
42	P	81.8	Confident	87.7	Confident	58 Å²	58	77.1 Å²	77.1	38%	0.377	45%	0.446	S	S	.	.	T	Hydrogen-bonded Turn	cis	-101.7	-1.1	14.8	37.9	-35.3	0	0	0	116.1	T44 I45 I46	P42-T44 VanDerWaalsContact C-N 3.27Å; P42-T44 PolarHBondContact O-N 3.07Å; P42-I45 PolarHBondContact O-N 3.43Å; P42-I45 VanDerWaalsContact O-N 3.15Å; P42-I46 PolarHBondContact O-N 3.29Å
43	F	86.5	Confident	87.7	Confident	50 Å²	50	76.1 Å²	76.1	22%	0.219	44%	0.436	C	S	.	.	H	α-helix	trans	-62.9	-30.4	-171.2	-58.5	-64.7	0	0	0	113.7	Q37 S40 I45 I46 G47	Q37-F43 HydrophobicContact CB-CB 4.42Å; Q37-F43 HydrophobicContact CB-CD1 4.35Å; Q37-F43 HydrophobicContact CB-CD2 4.25Å; Q37-F43 HydrophobicContact CB-CG 4.09Å; Q37-F43 HydrophobicContact CG-CD1 4.25Å; Q37-F43 HydrophobicContact CG-CE1 4.34Å; Q37-F43 HydrophobicContact CG-CG 4.48Å; S40-F43 PolarHBondContact O-N 3.24Å; F43-I45 VanDerWaalsContact C-N 3.34Å; F43-I45 PolarHBondContact O-N 2.92Å; F43-I46 HydrophobicContact CD1-CD1 4.47Å; F43-I46 PolarHBondContact O-N 3.47Å; F43-G47 PolarHBondContact O-N 2.89Å
44	T	86.9	Confident	87.8	Confident	57 Å²	57	72.3 Å²	72.3	35%	0.35	42%	0.422	S	S	.	.	H	α-helix	trans	-59.4	-42.2	175.3	-49.4	0	0	0	0	112.5	S40 P42 G47 Q48	S40-T44 PolarHBondContact O-N 3.23Å; P42-T44 VanDerWaalsContact C-N 3.27Å; P42-T44 PolarHBondContact O-N 3.07Å; T44-G47 PolarHBondContact O-N 3.48Å; T44-Q48 WeakPolarHBondContact O-CG 3.29Å; T44-Q48 PolarHBondContact O-N 3.39Å; T44-Q48 VanDerWaalsContact O-N 3.07Å
45	I	90.2	Very high	87.7	Confident	84 Å²	84	77.2 Å²	77.2	43%	0.431	44%	0.443	S	S	.	.	H	α-helix	trans	-70.3	-41.6	-179.5	-66.1	175.6	0	0	0	110	Y41 P42 F43 G47 Q48 V49	Y41-I45 HydrophobicContact CD2-CD1 4.02Å; Y41-I45 HydrophobicContact CE2-CD1 3.53Å; P42-I45 PolarHBondContact O-N 3.43Å; P42-I45 VanDerWaalsContact O-N 3.15Å; F43-I45 VanDerWaalsContact C-N 3.34Å; F43-I45 PolarHBondContact O-N 2.92Å; I45-G47 VanDerWaalsContact C-N 3.3Å; I45-G47 PolarHBondContact O-N 3.47Å; I45-Q48 PolarHBondContact O-N 3.01Å; I45-V49 HydrophobicContact CG2-CG2 4.32Å; I45-V49 WeakPolarHBondContact O-CG2 3.45Å; I45-V49 PolarHBondContact O-N 2.86Å
46	I	88.9	Confident	87.8	Confident	70 Å²	70	76.4 Å²	76.4	36%	0.359	42%	0.424	S	S	.	.	H	α-helix	trans	-62.6	-41.8	178.5	-52.1	173.2	0	0	0	109.9	I34 P42 F43 Q48 V49 A50	I34-I46 HydrophobicContact CD1-CB 3.83Å; I34-I46 HydrophobicContact CD1-CG2 3.37Å; I34-I46 HydrophobicContact CG1-CG2 4.47Å; P42-I46 PolarHBondContact O-N 3.29Å; F43-I46 HydrophobicContact CD1-CD1 4.47Å; F43-I46 PolarHBondContact O-N 3.47Å; I46-Q48 PolarHBondContact O-N 3.29Å; I46-V49 PolarHBondContact O-N 2.7Å; I46-A50 VanDerWaalsContact O-CB 3.24Å; I46-A50 WeakPolarHBondContact O-CB 3.28Å; I46-A50 PolarHBondContact O-N 3.1Å
47	G	89.9	Confident	87.8	Confident	12 Å²	12	73.5 Å²	73.5	12%	0.124	39%	0.393	C	S	.	.	H	α-helix	trans	-63.4	-39.2	175.9	0	0	0	0	0	113.3	F43 T44 I45 S51	F43-G47 PolarHBondContact O-N 2.89Å; T44-G47 PolarHBondContact O-N 3.48Å; I45-G47 VanDerWaalsContact C-N 3.3Å; I45-G47 PolarHBondContact O-N 3.47Å; G47-S51 WeakPolarHBondContact O-CB 3.23Å; G47-S51 PolarHBondContact O-N 3.3Å; G47-S51 PolarHBondContact O-OG 3.48Å
48	Q	89.6	Confident	87.7	Confident	121 Å²	121	72.4 Å²	72.4	57%	0.565	39%	0.389	S	S	*	.	H	α-helix	trans	-65.2	-47.3	175.1	-74.1	175.8	0.1	0	0	111.8	T44 I45 I46 S51 V52	T44-Q48 WeakPolarHBondContact O-CG 3.29Å; T44-Q48 PolarHBondContact O-N 3.39Å; T44-Q48 VanDerWaalsContact O-N 3.07Å; I45-Q48 PolarHBondContact O-N 3.01Å; I46-Q48 PolarHBondContact O-N 3.29Å; Q48-S51 PolarHBondContact O-N 3.4Å; Q48-V52 WeakPolarHBondContact O-CG2 3.22Å; Q48-V52 PolarHBondContact O-N 2.84Å
49	V	93	Very high	87.8	Confident	79 Å²	79	73.6 Å²	73.6	48%	0.479	39%	0.39	S	S	.	.	H	α-helix	trans	-63	-44.5	178.4	172.8	0	0	0	0	111	I45 I46 S51 V52 L53	I45-V49 HydrophobicContact CG2-CG2 4.32Å; I45-V49 WeakPolarHBondContact O-CG2 3.45Å; I45-V49 PolarHBondContact O-N 2.86Å; I46-V49 PolarHBondContact O-N 2.7Å; V49-S51 PolarHBondContact O-N 3.22Å; V49-V52 PolarHBondContact O-N 3.48Å; V49-L53 HydrophobicContact CG1-CD1 4.01Å; V49-L53 WeakPolarHBondContact O-CB 3.48Å; V49-L53 WeakPolarHBondContact O-CG 3.42Å; V49-L53 PolarHBondContact O-N 3.22Å
50	A	90.8	Very high	88.1	Confident	4 Å²	4	71.6 Å²	71.6	3%	0.033	37%	0.374	C	S	.	.	H	α-helix	trans	-61.2	-42.3	175.9	0	0	0	0	0	111.6	I30 L31 I46 V52 L53 Y54	I30-A50 HydrophobicContact CG2-CB 4.31Å; L31-A50 HydrophobicContact CD2-CB 3.76Å; L31-A50 HydrophobicContact CG-CB 3.96Å; I46-A50 VanDerWaalsContact O-CB 3.24Å; I46-A50 WeakPolarHBondContact O-CB 3.28Å; I46-A50 PolarHBondContact O-N 3.1Å; A50-V52 PolarHBondContact O-N 3.19Å; A50-L53 WeakPolarHBondContact O-CB 3.36Å; A50-L53 PolarHBondContact O-N 2.92Å; A50-Y54 WeakPolarHBondContact O-CB 3.4Å; A50-Y54 PolarHBondContact O-N 3.42Å
51	S	91.3	Very high	88.1	Confident	51 Å²	51	71.8 Å²	71.8	36%	0.357	37%	0.371	S	S	.	.	H	α-helix	trans	-62.8	-41.9	176.5	-57.8	0	0	0	0	112.3	G47 Q48 V49 Y54 F55	G47-S51 WeakPolarHBondContact O-CB 3.23Å; G47-S51 PolarHBondContact O-N 3.3Å; G47-S51 PolarHBondContact O-OG 3.48Å; Q48-S51 PolarHBondContact O-N 3.4Å; V49-S51 PolarHBondContact O-N 3.22Å; S51-Y54 WeakPolarHBondContact O-CB 3.47Å; S51-Y54 PolarHBondContact O-N 2.91Å; S51-F55 VanDerWaalsContact O-CD2 3.29Å; S51-F55 WeakPolarHBondContact O-CD2 3.5Å; S51-F55 PolarHBondContact O-N 2.75Å
52	V	94.2	Very high	88.2	Confident	95 Å²	95	66.4 Å²	66.4	58%	0.576	35%	0.353	S	S	*	.	H	α-helix	trans	-64.6	-41.9	175.6	172.1	0	0	0	0	110.8	Q48 V49 A50 T56	Q48-V52 WeakPolarHBondContact O-CG2 3.22Å; Q48-V52 PolarHBondContact O-N 2.84Å; V49-V52 PolarHBondContact O-N 3.48Å; A50-V52 PolarHBondContact O-N 3.19Å; V52-T56 VanDerWaalsContact O-CB 3.22Å; V52-T56 WeakPolarHBondContact O-CB 3.49Å; V52-T56 PolarHBondContact O-N 3.44Å; V52-T56 PolarHBondContact O-OG1 3.29Å
53	L	90.4	Very high	88	Confident	85 Å²	85	66.5 Å²	66.5	45%	0.445	35%	0.354	S	S	.	.	H	α-helix	trans	-61.9	-43.4	175.8	-82	169.3	0	0	0	111.8	V49 A50 T56 T57	V49-L53 HydrophobicContact CG1-CD1 4.01Å; V49-L53 WeakPolarHBondContact O-CB 3.48Å; V49-L53 WeakPolarHBondContact O-CG 3.42Å; V49-L53 PolarHBondContact O-N 3.22Å; A50-L53 WeakPolarHBondContact O-CB 3.36Å; A50-L53 PolarHBondContact O-N 2.92Å; L53-T56 PolarHBondContact O-N 3.33Å; L53-T57 VanDerWaalsContact O-CB 3.27Å; L53-T57 WeakPolarHBondContact O-CB 3.36Å; L53-T57 PolarHBondContact O-N 3Å; L53-T57 PolarHBondContact O-OG1 3.17Å
54	Y	90.3	Very high	87.9	Confident	68 Å²	68	67 Å²	67	27%	0.267	36%	0.361	S	S	.	.	H	α-helix	trans	-54.8	-56	176.2	-177.3	-104.3	0	0	0	112	L24 D27 L28 L31 A50 S51 T56 T57 I58	L24-Y54 HydrophobicContact CD1-CD2 4.06Å; L24-Y54 HydrophobicContact CD1-CE2 3.99Å; L24-Y54 HydrophobicContact CG-CE2 4.48Å; D27-Y54 WeakPolarHBondContact OD2-CA 3.45Å; D27-Y54 VanDerWaalsContact OD2-CB 3.22Å; D27-Y54 WeakPolarHBondContact OD2-CB 3.44Å; D27-Y54 PolarHBondContact OD2-N 2.89Å; L28-Y54 HydrophobicContact CD1-CE2 4.49Å; L28-Y54 HydrophobicContact CD2-CD2 4.1Å; L28-Y54 HydrophobicContact CD2-CE2 3.55Å; L28-Y54 HydrophobicContact CG-CD2 4.42Å; L28-Y54 HydrophobicContact CG-CE2 3.98Å; L31-Y54 HydrophobicContact CD1-CD2 4.3Å; L31-Y54 HydrophobicContact CD1-CG 4.28Å; A50-Y54 WeakPolarHBondContact O-CB 3.4Å; A50-Y54 PolarHBondContact O-N 3.42Å; S51-Y54 WeakPolarHBondContact O-CB 3.47Å; S51-Y54 PolarHBondContact O-N 2.91Å; Y54-T56 PolarHBondContact O-N 3.24Å; Y54-T57 PolarHBondContact O-N 3.49Å; Y54-I58 HydrophobicContact CD1-CD1 4.26Å; Y54-I58 HydrophobicContact CD2-CD1 4.33Å; Y54-I58 HydrophobicContact CE1-CD1 3.64Å; Y54-I58 HydrophobicContact CE2-CD1 3.7Å; Y54-I58 PolarHBondContact O-N 2.89Å; Y54-I58 VanDerWaalsContact O-N 3.15Å; Y54-I58 WeakPolarHBondContact OH-CD1 3.4Å
55	F	89.6	Confident	87.7	Confident	125 Å²	125	65.8 Å²	65.8	55%	0.548	35%	0.352	S	S	.	.	H	α-helix	trans	-65.6	-40.7	-178.9	-80.5	-71.9	0	0	0	112.2	S51 T57 I58 L59	S51-F55 VanDerWaalsContact O-CD2 3.29Å; S51-F55 WeakPolarHBondContact O-CD2 3.5Å; S51-F55 PolarHBondContact O-N 2.75Å; F55-T57 VanDerWaalsContact C-N 3.29Å; F55-T57 PolarHBondContact O-N 3.41Å; F55-I58 PolarHBondContact O-N 2.94Å; F55-L59 HydrophobicContact CD1-CD1 4.39Å; F55-L59 VanDerWaalsContact O-CB 3.28Å; F55-L59 WeakPolarHBondContact O-CB 3.29Å; F55-L59 WeakPolarHBondContact O-CG 3.27Å; F55-L59 PolarHBondContact O-N 2.82Å
56	T	90.3	Very high	87	Confident	51 Å²	51	62.6 Å²	62.6	31%	0.313	34%	0.338	S	S	.	.	H	α-helix	trans	-62.7	-39.3	177.1	-59.2	0	0	0	0	111.1	V52 L53 Y54 I60 L61	V52-T56 VanDerWaalsContact O-CB 3.22Å; V52-T56 WeakPolarHBondContact O-CB 3.49Å; V52-T56 PolarHBondContact O-N 3.44Å; V52-T56 PolarHBondContact O-OG1 3.29Å; L53-T56 PolarHBondContact O-N 3.33Å; Y54-T56 PolarHBondContact O-N 3.24Å; T56-I60 HydrophobicContact CG2-CB 4.46Å; T56-I60 HydrophobicContact CG2-CD1 4.26Å; T56-I60 WeakPolarHBondContact O-CA 3.39Å; T56-I60 WeakPolarHBondContact O-CB 3.46Å; T56-I60 PolarHBondContact O-N 2.94Å; T56-L61 HydrophobicContact CG2-CD1 4.15Å; T56-L61 PolarHBondContact O-N 3.33Å; T56-L61 VanDerWaalsContact O-N 3.09Å
57	T	86.2	Confident	86.5	Confident	4 Å²	4	64.1 Å²	64.1	3%	0.025	35%	0.346	C	S	.	.	I	π-helix	trans	-64.9	-46.5	-179.9	-59.9	0	0	0	0	111.3	L20 L23 L24 L53 Y54 F55 L61 M62	L20-T57 HydrophobicContact CD2-CG2 4.34Å; L23-T57 HydrophobicContact CD2-CG2 4.13Å; L24-T57 HydrophobicContact CB-CG2 4.46Å; L24-T57 HydrophobicContact CD1-CG2 3.94Å; L53-T57 VanDerWaalsContact O-CB 3.27Å; L53-T57 WeakPolarHBondContact O-CB 3.36Å; L53-T57 PolarHBondContact O-N 3Å; L53-T57 PolarHBondContact O-OG1 3.17Å; Y54-T57 PolarHBondContact O-N 3.49Å; F55-T57 VanDerWaalsContact C-N 3.29Å; F55-T57 PolarHBondContact O-N 3.41Å; T57-L61 WeakPolarHBondContact O-CB 3.44Å; T57-L61 PolarHBondContact O-N 3.43Å; T57-M62 PolarHBondContact O-N 3.24Å
58	I	84.5	Confident	86.1	Confident	44 Å²	44	67.5 Å²	67.5	23%	0.226	36%	0.36	C	S	.	.	I	π-helix	trans	-73.4	-45.9	-179.2	-64.8	177.3	0	0	0	112.1	L24 Y54 F55 M62	L24-I58 HydrophobicContact CD1-CD1 3.93Å; L24-I58 HydrophobicContact CD1-CG1 3.54Å; Y54-I58 HydrophobicContact CD1-CD1 4.26Å; Y54-I58 HydrophobicContact CD2-CD1 4.33Å; Y54-I58 HydrophobicContact CE1-CD1 3.64Å; Y54-I58 HydrophobicContact CE2-CD1 3.7Å; Y54-I58 PolarHBondContact O-N 2.89Å; Y54-I58 VanDerWaalsContact O-N 3.15Å; Y54-I58 WeakPolarHBondContact OH-CD1 3.4Å; F55-I58 PolarHBondContact O-N 2.94Å; I58-M62 WeakPolarHBondContact O-CB 3.45Å
59	L	84.8	Confident	85.4	Confident	108 Å²	108	62 Å²	62	57%	0.565	33%	0.334	S	S	*	.	I	π-helix	trans	-82.2	-32.5	-172.5	-67.9	174.1	0	0	0	113.2	F55 P63	F55-L59 HydrophobicContact CD1-CD1 4.39Å; F55-L59 VanDerWaalsContact O-CB 3.28Å; F55-L59 WeakPolarHBondContact O-CB 3.29Å; F55-L59 WeakPolarHBondContact O-CG 3.27Å; F55-L59 PolarHBondContact O-N 2.82Å; L59-P63 WeakPolarHBondContact O-CG 3.46Å
60	I	86.2	Confident	84.5	Confident	93 Å²	93	60.5 Å²	60.5	48%	0.477	32%	0.324	S	S	.	.	I	π-helix	trans	-114.4	-52	-171.4	-59.5	170.9	0	0	0	111.4	T56 P63 T64	T56-I60 HydrophobicContact CG2-CB 4.46Å; T56-I60 HydrophobicContact CG2-CD1 4.26Å; T56-I60 WeakPolarHBondContact O-CA 3.39Å; T56-I60 WeakPolarHBondContact O-CB 3.46Å; T56-I60 PolarHBondContact O-N 2.94Å; I60-P63 VanDerWaalsContact O-CD 3.29Å; I60-P63 WeakPolarHBondContact O-CD 3.37Å; I60-P63 WeakPolarHBondContact O-CG 3.22Å; I60-T64 HydrophobicContact CG2-CG2 4.33Å; I60-T64 WeakPolarHBondContact O-CB 3.34Å; I60-T64 WeakPolarHBondContact O-CG2 3.43Å; I60-T64 PolarHBondContact O-N 3.15Å; I60-T64 VanDerWaalsContact O-N 3.15Å; I60-T64 PolarHBondContact O-OG1 3.21Å
61	L	83.1	Confident	83.8	Confident	56 Å²	56	67.5 Å²	67.5	29%	0.293	35%	0.353	S	S	.	.	I	π-helix	trans	-69.1	-42	-175	-90.4	59.4	0	0	0	112.3	L20 T56 T57 T64 I65	L20-L61 HydrophobicContact CD1-CB 4.27Å; L20-L61 HydrophobicContact CD2-CB 3.78Å; L20-L61 HydrophobicContact CD2-CD2 3.64Å; L20-L61 HydrophobicContact CD2-CG 4.17Å; T56-L61 HydrophobicContact CG2-CD1 4.15Å; T56-L61 PolarHBondContact O-N 3.33Å; T56-L61 VanDerWaalsContact O-N 3.09Å; T57-L61 WeakPolarHBondContact O-CB 3.44Å; T57-L61 PolarHBondContact O-N 3.43Å; L61-T64 VanDerWaalsContact CA-OG1 3.31Å; L61-T64 WeakPolarHBondContact CA-OG1 3.46Å; L61-T64 PolarHBondContact O-N 2.98Å; L61-T64 PolarHBondContact O-OG1 2.94Å; L61-I65 WeakPolarHBondContact O-CB 3.45Å; L61-I65 PolarHBondContact O-N 3.31Å
62	M	82.9	Confident	82.8	Confident	80 Å²	80	71.5 Å²	71.5	39%	0.394	37%	0.368	S	S	.	.	H	α-helix	trans	-55	-54.6	176.6	-90.7	-170.6	172.7	0	0	113.1	T57 I58 S66	T57-M62 PolarHBondContact O-N 3.24Å; I58-M62 WeakPolarHBondContact O-CB 3.45Å; M62-S66 WeakPolarHBondContact O-CB 3.47Å; M62-S66 PolarHBondContact O-N 3.33Å; M62-S66 PolarHBondContact O-OG 3.49Å
63	P	79.4	Confident	81.8	Confident	60 Å²	60	71.2 Å²	71.2	39%	0.39	36%	0.363	S	S	.	.	H	α-helix	trans	-67	-37.7	179.4	21.9	-30.5	0	0	0	112.9	L59 I60 S66 L67	L59-P63 WeakPolarHBondContact O-CG 3.46Å; I60-P63 VanDerWaalsContact O-CD 3.29Å; I60-P63 WeakPolarHBondContact O-CD 3.37Å; I60-P63 WeakPolarHBondContact O-CG 3.22Å; P63-S66 WeakPolarHBondContact CA-OG 3.24Å; P63-S66 PolarHBondContact O-N 2.92Å; P63-S66 PolarHBondContact O-OG 3.42Å; P63-L67 PolarHBondContact O-N 3.1Å
64	T	83	Confident	80.3	Confident	61 Å²	61	76.1 Å²	76.1	37%	0.374	38%	0.38	S	S	.	.	H	α-helix	trans	-67.9	-48.6	-178.3	52.3	0	0	0	0	112.3	I60 L61 S66 L67 I68	I60-T64 HydrophobicContact CG2-CG2 4.33Å; I60-T64 WeakPolarHBondContact O-CB 3.34Å; I60-T64 WeakPolarHBondContact O-CG2 3.43Å; I60-T64 PolarHBondContact O-N 3.15Å; I60-T64 VanDerWaalsContact O-N 3.15Å; I60-T64 PolarHBondContact O-OG1 3.21Å; L61-T64 VanDerWaalsContact CA-OG1 3.31Å; L61-T64 WeakPolarHBondContact CA-OG1 3.46Å; L61-T64 PolarHBondContact O-N 2.98Å; L61-T64 PolarHBondContact O-OG1 2.94Å; T64-S66 PolarHBondContact O-N 3.5Å; T64-L67 WeakPolarHBondContact O-CB 3.48Å; T64-L67 PolarHBondContact O-N 2.89Å; T64-I68 VanDerWaalsContact O-CG1 3.29Å; T64-I68 WeakPolarHBondContact O-CG1 3.2Å; T64-I68 PolarHBondContact O-N 2.78Å
65	I	82.4	Confident	78.7	Confident	30 Å²	30	80 Å²	80	15%	0.154	40%	0.395	C	S	.	.	H	α-helix	trans	-63.4	-34.1	173.6	-73.7	-175.4	0	0	0	110.2	L16 L20 L61 L67 I68 E69	L16-I65 HydrophobicContact CB-CG2 3.65Å; L20-I65 HydrophobicContact CD1-CB 3.56Å; L20-I65 HydrophobicContact CD1-CD1 3.3Å; L20-I65 HydrophobicContact CD1-CG1 3.8Å; L20-I65 HydrophobicContact CD1-CG2 3.84Å; L20-I65 HydrophobicContact CD2-CD1 3.83Å; L20-I65 HydrophobicContact CG-CD1 3.46Å; L20-I65 VanDerWaalsContact CG-CD1 3.46Å; L20-I65 HydrophobicContact CG-CG1 4.48Å; L61-I65 WeakPolarHBondContact O-CB 3.45Å; L61-I65 PolarHBondContact O-N 3.31Å; I65-L67 VanDerWaalsContact C-N 3.28Å; I65-L67 PolarHBondContact O-N 3.48Å; I65-I68 PolarHBondContact O-N 2.91Å; I65-E69 HydrophobicContact CG2-CG 4.42Å; I65-E69 PolarHBondContact O-N 3.23Å
66	S	76.6	Confident	76.6	Confident	18 Å²	18	82.1 Å²	82.1	13%	0.126	44%	0.436	C	S	.	.	H	α-helix	trans	-60.5	-40.7	177	84.1	0	0	0	0	112.8	R14 M62 P63 T64 N70	R14-S66 PolarHBondContact NH2-O 3.5Å; M62-S66 WeakPolarHBondContact O-CB 3.47Å; M62-S66 PolarHBondContact O-N 3.33Å; M62-S66 PolarHBondContact O-OG 3.49Å; P63-S66 WeakPolarHBondContact CA-OG 3.24Å; P63-S66 PolarHBondContact O-N 2.92Å; P63-S66 PolarHBondContact O-OG 3.42Å; T64-S66 PolarHBondContact O-N 3.5Å; S66-N70 PolarHBondContact O-N 3.35Å; S66-N70 PolarHBondContact O-ND2 2.91Å; S66-N70 PolarHBondContact O-OD1 3.31Å
67	L	78.6	Confident	75.9	Confident	101 Å²	101	83.7 Å²	83.7	53%	0.529	44%	0.442	S	S	.	.	H	α-helix	trans	-71.5	-41.6	177.9	-169.8	87.4	0	0	0	112.1	P63 T64 I65 N70 K71	P63-L67 PolarHBondContact O-N 3.1Å; T64-L67 WeakPolarHBondContact O-CB 3.48Å; T64-L67 PolarHBondContact O-N 2.89Å; I65-L67 VanDerWaalsContact C-N 3.28Å; I65-L67 PolarHBondContact O-N 3.48Å; L67-N70 PolarHBondContact O-N 2.96Å; L67-K71 WeakPolarHBondContact O-CG 3.36Å; L67-K71 PolarHBondContact O-N 3.46Å
68	I	81.6	Confident	75.4	Confident	83 Å²	83	87.9 Å²	87.9	43%	0.426	46%	0.464	S	S	.	.	H	α-helix	trans	-62.8	-48.4	-179.9	-69.6	164.8	0	0	0	110.3	T64 I65 N70 K71 M72	T64-I68 VanDerWaalsContact O-CG1 3.29Å; T64-I68 WeakPolarHBondContact O-CG1 3.2Å; T64-I68 PolarHBondContact O-N 2.78Å; I65-I68 PolarHBondContact O-N 2.91Å; I68-N70 PolarHBondContact O-N 3.27Å; I68-K71 PolarHBondContact O-N 3.47Å; I68-M72 HydrophobicContact CG2-SD 4.16Å; I68-M72 WeakPolarHBondContact O-CG 3.41Å; I68-M72 PolarHBondContact O-N 3.49Å
69	E	75.3	Confident	74.8	Confident	6 Å²	6	90.3 Å²	90.3	3%	0.028	48%	0.477	C	S	.	.	H	α-helix	trans	-65.9	-37	178.1	-80.1	178	141.9	0	0	112	R14 L16 S17 I65 K71 M72 L73	R14-E69 VanDerWaalsContact CA-OE1 3.23Å; R14-E69 WeakPolarHBondContact CA-OE1 3.28Å; R14-E69 VanDerWaalsContact CB-OE1 3.28Å; R14-E69 WeakPolarHBondContact CB-OE1 3.4Å; R14-E69 IonicContact CZ-OE2 3.18Å; R14-E69 IonicContact NE-OE2 2.67Å; R14-E69 PolarHBondContact NE-OE2 2.94Å; R14-E69 IonicContact NH2-OE2 2.84Å; R14-E69 PolarHBondContact NH2-OE2 3.11Å; L16-E69 WeakPolarHBondContact CA-OE1 3.29Å; L16-E69 HydrophobicContact CB-CG 4.09Å; L16-E69 VanDerWaalsContact CB-OE1 3.29Å; L16-E69 WeakPolarHBondContact CB-OE1 3.43Å; L16-E69 HydrophobicContact CD1-CG 3.9Å; L16-E69 HydrophobicContact CG-CG 4.4Å; L16-E69 PolarHBondContact N-OE1 2.74Å; S17-E69 PolarHBondContact N-OE1 3.4Å; S17-E69 VanDerWaalsContact N-OE1 3.14Å; S17-E69 PolarHBondContact OG-OE2 3.49Å; I65-E69 HydrophobicContact CG2-CG 4.42Å; I65-E69 PolarHBondContact O-N 3.23Å; E69-K71 VanDerWaalsContact C-N 3.32Å; E69-K71 PolarHBondContact O-N 3.16Å; E69-M72 PolarHBondContact O-N 3.44Å; E69-L73 WeakPolarHBondContact O-CB 3.48Å; E69-L73 WeakPolarHBondContact O-CG 3.47Å; E69-L73 PolarHBondContact O-N 3.41Å
70	N	73.7	Confident	74.3	Confident	47 Å²	47	89.3 Å²	89.3	25%	0.251	47%	0.472	S	S	.	.	H	α-helix	trans	-60.5	-42.5	173.3	-72	-9.4	0	0	0	111.4	S66 L67 I68 K74	S66-N70 PolarHBondContact O-N 3.35Å; S66-N70 PolarHBondContact O-ND2 2.91Å; S66-N70 PolarHBondContact O-OD1 3.31Å; L67-N70 PolarHBondContact O-N 2.96Å; I68-N70 PolarHBondContact O-N 3.27Å; N70-K74 PolarHBondContact O-N 3.01Å
71	K	74.9	Confident	73.5	Confident	152 Å²	152	89.1 Å²	89.1	66%	0.661	47%	0.472	S	S	*	.	H	α-helix	trans	-65.7	-41	175.3	-75.9	176.5	177.4	-75.4	0	112.2	L67 I68 E69 K74	L67-K71 WeakPolarHBondContact O-CG 3.36Å; L67-K71 PolarHBondContact O-N 3.46Å; I68-K71 PolarHBondContact O-N 3.47Å; E69-K71 VanDerWaalsContact C-N 3.32Å; E69-K71 PolarHBondContact O-N 3.16Å; K71-K74 PolarHBondContact O-N 3.27Å
72	M	71.6	Confident	72.9	Confident	135 Å²	135	91.3 Å²	91.3	67%	0.665	48%	0.484	S	S	*	.	H	α-helix	trans	-65.6	-38.4	178.2	-76.6	-179.2	64.7	0	0	112.6	L16 I68 E69 K74	L16-M72 HydrophobicContact CD1-SD 4.41Å; I68-M72 HydrophobicContact CG2-SD 4.16Å; I68-M72 WeakPolarHBondContact O-CG 3.41Å; I68-M72 PolarHBondContact O-N 3.49Å; E69-M72 PolarHBondContact O-N 3.44Å; M72-K74 PolarHBondContact O-N 2.93Å
73	L	71.7	Confident	72.2	Confident	89 Å²	89	92.1 Å²	92.1	47%	0.466	49%	0.49	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.1	5.7	-179.8	-68.1	170.6	0	0	0	113.5	E69 W75	E69-L73 WeakPolarHBondContact O-CB 3.48Å; E69-L73 WeakPolarHBondContact O-CG 3.47Å; E69-L73 PolarHBondContact O-N 3.41Å; L73-W75 PolarHBondContact O-N 2.75Å; L73-W75 VanDerWaalsContact O-N 3.09Å
74	K	59.1	Low	71.6	Confident	187 Å²	187	94.5 Å²	94.5	81%	0.813	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	49	34	178.3	-68.8	-174.4	177.7	179.7	0	114.1	N70 K71 M72 A76	N70-K74 PolarHBondContact O-N 3.01Å; K71-K74 PolarHBondContact O-N 3.27Å; M72-K74 PolarHBondContact O-N 2.93Å; K74-A76 PolarHBondContact O-N 2.95Å
75	W	57.8	Low	70.7	Confident	149 Å²	149	97.3 Å²	97.3	56%	0.564	51%	0.508	S	S	*	.			trans	-83.3	97.8	160.4	-80.4	-3.9	0	0	0	107.5	Q8 L73	Q8-W75 HydrophobicContact CG-CH2 3.98Å; Q8-W75 HydrophobicContact CG-CZ3 3.83Å; L73-W75 PolarHBondContact O-N 2.75Å; L73-W75 VanDerWaalsContact O-N 3.09Å
76	A	44.7	Very low	69.6	Low	171 Å²	171	103.5 Å²	103.5	100%	1.413	54%	0.54	S	S	*	.			trans	-63.3	0	163.8	0	0	0	0	0	110.4	K74	K74-A76 PolarHBondContact O-N 2.95Å

Retrieved 76 of 76 residues in 80.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).