X5D7W4_HUMAN Loading...

Adenylosuccinate lyase isoform C

AlphaFold DB , UniProt , Accession X5D7W4, Species HUMAN (Homo sapiens, Human), Gene ADSL, Length 46 aa.

						>X5D7W4_HUMAN|X5D7W4|ADSL
MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRHWVCLSQMNKSRR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.3	Very low	53.5	Low	252 Å²	252	111.1 Å²	111.1	100%	1.241	72%	0.719	S	S	*	*				0	106.2	0	-149.9	145.4	-172.8	0	0	107.7
2	A	33.3	Very low	55.5	Low	97 Å²	97	108.7 Å²	108.7	80%	0.802	71%	0.707	S	S	*	*			trans	-178.8	99.1	159.6	0	0	0	0	0	105.9	G4	A2-G4 PolarHBondContact O-N 3.41Å
3	A	49	Very low	57.2	Low	111 Å²	111	116.1 Å²	116.1	92%	0.917	72%	0.715	S	S	*	*			trans	-68	75.3	162.9	0	0	0	0	0	107.3	G5	A3-G5 VanDerWaalsContact C-N 3.3Å; A3-G5 PolarHBondContact O-N 3.02Å
4	G	43.6	Very low	58.6	Low	64 Å²	64	115.2 Å²	115.2	66%	0.66	69%	0.692	S	S	*	*			trans	-83.6	82.9	171.6	0	0	0	0	0	107.2	A2 D6	A2-G4 PolarHBondContact O-N 3.41Å; G4-D6 PolarHBondContact O-N 3.25Å; G4-D6 VanDerWaalsContact O-N 3.12Å
5	G	50.7	Low	60.1	Low	50 Å²	50	110.9 Å²	110.9	52%	0.515	67%	0.669	S	S	.	*			trans	-46.5	124.7	157	0	0	0	0	0	106.3	A3 H7	A3-G5 VanDerWaalsContact C-N 3.3Å; A3-G5 PolarHBondContact O-N 3.02Å; G5-H7 PolarHBondContact O-CD2 2.67Å; G5-H7 PolarHBondContact O-N 2.76Å
6	D	57.6	Low	61.5	Low	98 Å²	98	107.7 Å²	107.7	52%	0.524	65%	0.651	S	S	.	*			trans	-47.7	92.8	175.5	177.5	-90.8	0	0	0	107	G4 G8 R14	G4-D6 PolarHBondContact O-N 3.25Å; G4-D6 VanDerWaalsContact O-N 3.12Å; D6-G8 PolarHBondContact O-N 3.5Å; D6-R14 PolarHBondContact O-NH1 3.18Å; D6-R14 PolarHBondContact O-NH2 3.28Å; D6-R14 IonicContact OD1-NH2 3.65Å
7	H	57.6	Low	62.8	Low	180 Å²	180	108 Å²	108	83%	0.833	65%	0.648	S	S	*	*			trans	-81.7	66.7	175.9	-85.9	-89.8	0	0	0	105.1	G5 S9	G5-H7 PolarHBondContact O-CD2 2.67Å; G5-H7 PolarHBondContact O-N 2.76Å; H7-S9 PolarHBondContact O-N 3Å
8	G	58.7	Low	63.7	Low	38 Å²	38	104.8 Å²	104.8	39%	0.392	64%	0.635	S	S	.	*			trans	-48.7	139	161.7	0	0	0	0	0	108.2	D6	D6-G8 PolarHBondContact O-N 3.5Å
9	S	60.5	Low	64.4	Low	64 Å²	64	102.7 Å²	102.7	45%	0.448	63%	0.625	S	S	.	*			trans	-38.6	129.4	-175	-151.2	0	0	0	0	110.4	H7 D11 S12	H7-S9 PolarHBondContact O-N 3Å; S9-D11 PolarHBondContact O-N 3.21Å; S9-D11 PolarHBondContact OG-OD2 3.15Å; S9-D11 VanDerWaalsContact OG-OD2 3.09Å; S9-S12 PolarHBondContact O-N 3.11Å
10	P	62.9	Low	65.2	Low	128 Å²	128	107.7 Å²	107.7	83%	0.831	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.4	-15.7	178.7	23.9	-32.5	0	0	0	112.7
11	D	65.1	Low	66	Low	140 Å²	140	110.4 Å²	110.4	75%	0.749	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.2	-13.8	177.5	-46.2	-87.2	0	0	0	114.6	S9	S9-D11 PolarHBondContact O-N 3.21Å; S9-D11 PolarHBondContact OG-OD2 3.15Å; S9-D11 VanDerWaalsContact OG-OD2 3.09Å
12	S	78	Confident	67.6	Low	82 Å²	82	100.5 Å²	100.5	57%	0.573	59%	0.592	S	S	*	*	S	Bend	trans	-97.7	131.7	-179.9	-71.6	0	0	0	0	110.8	S9 R14	S9-S12 PolarHBondContact O-N 3.11Å; S12-R14 PolarHBondContact O-N 3.35Å
13	Y	77.3	Confident	70.1	Confident	205 Å²	205	98.4 Å²	98.4	80%	0.804	57%	0.571	S	S	*	*			trans	-56.3	126.7	176.4	176	-98.5	0	0	0	110.6
14	R	77	Confident	71.4	Confident	104 Å²	104	97.7 Å²	97.7	39%	0.392	56%	0.557	S	S	.	*			trans	-125	130	176.9	-165.8	175.8	178.2	176.6	11.3	109.2	D6 S12	D6-R14 PolarHBondContact O-NH1 3.18Å; D6-R14 PolarHBondContact O-NH2 3.28Å; D6-R14 IonicContact OD1-NH2 3.65Å; S12-R14 PolarHBondContact O-N 3.35Å
15	S	80.8	Confident	73.3	Confident	50 Å²	50	100.6 Å²	100.6	35%	0.35	55%	0.553	S	S	.	*			trans	-56.1	122.2	179.4	178.5	0	0	0	0	110.1	L17 A18 S19	S15-L17 PolarHBondContact O-N 3.4Å; S15-A18 PolarHBondContact O-N 3.25Å; S15-S19 PolarHBondContact O-N 3.35Å; S15-S19 VanDerWaalsContact O-N 3.09Å; S15-S19 PolarHBondContact O-OG 3.08Å
16	P	82.3	Confident	74.8	Confident	60 Å²	60	103.2 Å²	103.2	39%	0.39	55%	0.553	S	S	.	*	H	α-helix	trans	-62.7	-25.1	-178.6	24.7	-33.5	0	0	0	112.2	S19 R20 Y21	P16-S19 WeakPolarHBondContact CA-OG 3.22Å; P16-R20 PolarHBondContact O-N 3.09Å; P16-Y21 HydrophobicContact CB-CD2 4.4Å; P16-Y21 HydrophobicContact CB-CE2 4.18Å; P16-Y21 VanDerWaalsContact O-CD2 3.22Å; P16-Y21 WeakPolarHBondContact O-CD2 3.1Å; P16-Y21 PolarHBondContact O-N 3.03Å
17	L	83.3	Confident	75.8	Confident	113 Å²	113	100.2 Å²	100.2	59%	0.592	54%	0.54	S	S	*	.	I	π-helix	trans	-59.5	-51.7	171.6	-68.3	171.5	0	0	0	110.6	S15 Y21 A22	S15-L17 PolarHBondContact O-N 3.4Å; L17-Y21 PolarHBondContact O-N 3.26Å; L17-A22 WeakPolarHBondContact O-CB 3.17Å; L17-A22 PolarHBondContact O-N 3.07Å
18	A	79.6	Confident	76.8	Confident	51 Å²	51	97.6 Å²	97.6	42%	0.421	53%	0.526	S	S	.	.	I	π-helix	trans	-73.2	-29.3	-177.4	0	0	0	0	0	113.5	S15	S15-A18 PolarHBondContact O-N 3.25Å
19	S	76.8	Confident	77.8	Confident	64 Å²	64	98.6 Å²	98.6	45%	0.448	53%	0.525	S	S	.	.	I	π-helix	trans	-91.5	-21.8	-175.2	62.8	0	0	0	0	114.8	S15 P16	S15-S19 PolarHBondContact O-N 3.35Å; S15-S19 VanDerWaalsContact O-N 3.09Å; S15-S19 PolarHBondContact O-OG 3.08Å; P16-S19 WeakPolarHBondContact CA-OG 3.22Å
20	R	80.9	Confident	78.5	Confident	202 Å²	202	102.2 Å²	102.2	76%	0.762	53%	0.532	S	S	*	.	I	π-helix	trans	-136.9	-33.8	-172.3	-169.1	171	-177.5	160.3	0.3	115.6	P16	P16-R20 PolarHBondContact O-N 3.09Å
21	Y	82.7	Confident	79.1	Confident	165 Å²	165	98 Å²	98	65%	0.647	51%	0.506	S	S	*	.	I	π-helix	trans	-107.2	-33.8	-166.9	-61.9	-67.1	0	0	0	114.5	P16 L17	P16-Y21 HydrophobicContact CB-CD2 4.4Å; P16-Y21 HydrophobicContact CB-CE2 4.18Å; P16-Y21 VanDerWaalsContact O-CD2 3.22Å; P16-Y21 WeakPolarHBondContact O-CD2 3.1Å; P16-Y21 PolarHBondContact O-N 3.03Å; L17-Y21 PolarHBondContact O-N 3.26Å
22	A	83.1	Confident	79.5	Confident	45 Å²	45	97.7 Å²	97.7	37%	0.372	50%	0.504	S	S	.	.	S	Bend	trans	-82.2	145.8	-178.2	0	0	0	0	0	111.1	L17 C27	L17-A22 WeakPolarHBondContact O-CB 3.17Å; L17-A22 PolarHBondContact O-N 3.07Å; A22-C27 VanDerWaalsContact CB-SG 3.55Å
23	S	83.9	Confident	78.9	Confident	52 Å²	52	102.8 Å²	102.8	36%	0.364	51%	0.511	S	S	.	.			trans	-70.4	152	171.7	86.1	0	0	0	0	110.5	E25 M26 C27	S23-E25 WeakPolarHBondContact CB-OE2 3.47Å; S23-E25 PolarHBondContact O-N 3.26Å; S23-E25 PolarHBondContact OG-OE2 3.16Å; S23-M26 PolarHBondContact O-N 2.9Å; S23-M26 VanDerWaalsContact O-N 3.15Å; S23-M26 PolarHBondContact OG-N 2.84Å; S23-C27 PolarHBondContact O-N 2.67Å
24	P	77.1	Confident	78.4	Confident	96 Å²	96	95.4 Å²	95.4	62%	0.623	48%	0.484	S	S	*	.	H	α-helix	trans	-57.1	-33.9	-179.5	-25.5	35.1	0	0	0	113.9	C27 F28	P24-C27 PolarHBondContact O-N 3.12Å; P24-F28 WeakPolarHBondContact O-CB 3.4Å; P24-F28 PolarHBondContact O-N 2.84Å
25	E	83.2	Confident	77.8	Confident	126 Å²	126	97.5 Å²	97.5	59%	0.589	49%	0.492	S	S	*	.	H	α-helix	trans	-67.5	-40.6	-179.2	-52.3	69.3	-150.5	0	0	110.3	S23 F28 V29	S23-E25 WeakPolarHBondContact CB-OE2 3.47Å; S23-E25 PolarHBondContact O-N 3.26Å; S23-E25 PolarHBondContact OG-OE2 3.16Å; E25-F28 WeakPolarHBondContact O-CB 3.37Å; E25-F28 PolarHBondContact O-N 2.58Å; E25-V29 WeakPolarHBondContact O-CG2 3.42Å; E25-V29 PolarHBondContact O-N 3.17Å; E25-V29 VanDerWaalsContact O-N 3.11Å
26	M	83.4	Confident	77.1	Confident	104 Å²	104	99.5 Å²	99.5	51%	0.512	50%	0.502	S	S	.	.	H	α-helix	trans	-70.2	-43	174.6	-82.1	-68.1	-71.3	0	0	111.6	S23 F28 V29 F30	S23-M26 PolarHBondContact O-N 2.9Å; S23-M26 VanDerWaalsContact O-N 3.15Å; S23-M26 PolarHBondContact OG-N 2.84Å; M26-F28 PolarHBondContact O-N 3.2Å; M26-V29 PolarHBondContact O-N 3.49Å; M26-F30 HydrophobicContact CE-CD2 4.31Å; M26-F30 HydrophobicContact CE-CE2 3.63Å; M26-F30 WeakPolarHBondContact O-CD2 3.25Å; M26-F30 PolarHBondContact O-N 3.35Å; M26-F30 HydrophobicContact SD-CE2 4.29Å
27	C	78.8	Confident	76	Confident	36 Å²	36	100.8 Å²	100.8	24%	0.243	51%	0.511	C	S	.	.	H	α-helix	trans	-57	-37	172.7	-71.3	0	0	0	0	111.6	A22 S23 P24 S31	A22-C27 VanDerWaalsContact CB-SG 3.55Å; S23-C27 PolarHBondContact O-N 2.67Å; P24-C27 PolarHBondContact O-N 3.12Å; C27-S31 PolarHBondContact O-N 2.67Å; C27-S31 VanDerWaalsContact O-N 3.16Å; C27-S31 PolarHBondContact O-OG 3.18Å
28	F	77.4	Confident	74.9	Confident	125 Å²	125	99.2 Å²	99.2	55%	0.548	50%	0.503	S	S	.	.	H	α-helix	trans	-67.9	-44.7	178.1	-177	-97.7	0	0	0	112.8	P24 E25 M26 F30 S31 H34	P24-F28 WeakPolarHBondContact O-CB 3.4Å; P24-F28 PolarHBondContact O-N 2.84Å; E25-F28 WeakPolarHBondContact O-CB 3.37Å; E25-F28 PolarHBondContact O-N 2.58Å; M26-F28 PolarHBondContact O-N 3.2Å; F28-F30 PolarHBondContact O-N 3Å; F28-S31 WeakPolarHBondContact O-CB 3.35Å; F28-S31 PolarHBondContact O-N 3.07Å; F28-H34 HydrophobicContact CE1-CB 4.3Å; F28-H34 AromaticContact CE1-CD2 3.83Å; F28-H34 HydrophobicContact CZ-CB 4.48Å; F28-H34 VanDerWaalsContact O-CB 3.25Å; F28-H34 WeakPolarHBondContact O-CB 3.38Å
29	V	79.9	Confident	74.4	Confident	59 Å²	59	100.3 Å²	100.3	36%	0.358	51%	0.508	S	S	.	.	H	α-helix	trans	-55.7	-40.5	178.6	169.3	0	0	0	0	112	E25 M26 H34	E25-V29 WeakPolarHBondContact O-CG2 3.42Å; E25-V29 PolarHBondContact O-N 3.17Å; E25-V29 VanDerWaalsContact O-N 3.11Å; M26-V29 PolarHBondContact O-N 3.49Å; V29-H34 PolarHBondContact O-ND1 2.93Å; V29-H34 VanDerWaalsContact O-ND1 3.08Å
30	F	75.1	Confident	73.8	Confident	139 Å²	139	102.8 Å²	102.8	61%	0.61	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.2	7.6	-178.8	-66.2	-79.6	0	0	0	114	M26 F28	M26-F30 HydrophobicContact CE-CD2 4.31Å; M26-F30 HydrophobicContact CE-CE2 3.63Å; M26-F30 WeakPolarHBondContact O-CD2 3.25Å; M26-F30 PolarHBondContact O-N 3.35Å; M26-F30 HydrophobicContact SD-CE2 4.29Å; F28-F30 PolarHBondContact O-N 3Å
31	S	76.1	Confident	73	Confident	39 Å²	39	99.2 Å²	99.2	27%	0.273	51%	0.505	S	S	.	.	S	Bend	trans	-79.4	140.1	174.9	-71.5	0	0	0	0	111.2	C27 F28 R33 H34 W35	C27-S31 PolarHBondContact O-N 2.67Å; C27-S31 VanDerWaalsContact O-N 3.16Å; C27-S31 PolarHBondContact O-OG 3.18Å; F28-S31 WeakPolarHBondContact O-CB 3.35Å; F28-S31 PolarHBondContact O-N 3.07Å; S31-R33 PolarHBondContact O-N 3.39Å; S31-R33 VanDerWaalsContact O-N 3.07Å; S31-H34 WeakPolarHBondContact O-CB 3.44Å; S31-H34 PolarHBondContact O-N 2.94Å; S31-W35 PolarHBondContact O-N 3.27Å
32	D	73	Confident	72.4	Confident	135 Å²	135	96.2 Å²	96.2	72%	0.722	50%	0.501	S	S	*	.	H	α-helix	trans	-54.3	-32.3	176	-61.9	-78.6	0	0	0	112.8	H34 W35 V36	D32-H34 VanDerWaalsContact C-N 3.31Å; D32-H34 PolarHBondContact O-N 2.91Å; D32-W35 PolarHBondContact O-N 3.46Å; D32-V36 VanDerWaalsContact O-CG2 3.32Å; D32-V36 WeakPolarHBondContact O-CG2 3.18Å; D32-V36 PolarHBondContact O-N 2.88Å
33	R	66.3	Low	71.5	Confident	188 Å²	188	101.2 Å²	101.2	71%	0.709	51%	0.514	S	S	*	.	H	α-helix	trans	-62.2	-35.7	176.5	-75.1	-172	-88.7	-117.8	0.5	113.1	S31 C37	S31-R33 PolarHBondContact O-N 3.39Å; S31-R33 VanDerWaalsContact O-N 3.07Å; R33-C37 WeakPolarHBondContact O-CB 3.35Å; R33-C37 PolarHBondContact O-N 2.9Å
34	H	66.4	Low	70.7	Confident	51 Å²	51	103.6 Å²	103.6	24%	0.236	53%	0.531	C	S	.	.	H	α-helix	trans	-68.5	-43.7	176.8	175.5	-120.1	0	0	0	110.7	F28 V29 S31 D32 C37 L38	F28-H34 HydrophobicContact CE1-CB 4.3Å; F28-H34 AromaticContact CE1-CD2 3.83Å; F28-H34 HydrophobicContact CZ-CB 4.48Å; F28-H34 VanDerWaalsContact O-CB 3.25Å; F28-H34 WeakPolarHBondContact O-CB 3.38Å; V29-H34 PolarHBondContact O-ND1 2.93Å; V29-H34 VanDerWaalsContact O-ND1 3.08Å; S31-H34 WeakPolarHBondContact O-CB 3.44Å; S31-H34 PolarHBondContact O-N 2.94Å; D32-H34 VanDerWaalsContact C-N 3.31Å; D32-H34 PolarHBondContact O-N 2.91Å; H34-C37 PolarHBondContact O-N 3.32Å; H34-L38 WeakPolarHBondContact O-CB 3.41Å; H34-L38 PolarHBondContact O-N 3.47Å
35	W	64.1	Low	70	Confident	147 Å²	147	109.6 Å²	109.6	56%	0.557	54%	0.541	S	S	*	.	H	α-helix	trans	-64.3	-40.5	176.5	-66.9	107.8	0	0	0	113	S31 D32 S39	S31-W35 PolarHBondContact O-N 3.27Å; D32-W35 PolarHBondContact O-N 3.46Å; W35-S39 WeakPolarHBondContact O-CB 3.32Å; W35-S39 PolarHBondContact O-N 3.36Å
36	V	65.6	Low	68.8	Low	92 Å²	92	116.3 Å²	116.3	56%	0.558	56%	0.561	S	S	*	*	H	α-helix	trans	-64.3	-46	174.8	172.7	0	0	0	0	110.9	D32 S39 Q40	D32-V36 VanDerWaalsContact O-CG2 3.32Å; D32-V36 WeakPolarHBondContact O-CG2 3.18Å; D32-V36 PolarHBondContact O-N 2.88Å; V36-S39 PolarHBondContact O-N 3.46Å; V36-Q40 HydrophobicContact CG1-CG 4.45Å; V36-Q40 WeakPolarHBondContact O-CB 3.4Å; V36-Q40 WeakPolarHBondContact O-CG 3.19Å; V36-Q40 PolarHBondContact O-N 2.92Å
37	C	59.2	Low	68.1	Low	87 Å²	87	117 Å²	117	59%	0.588	56%	0.564	S	S	*	*	H	α-helix	trans	-63.1	-46	177.1	-94.1	0	0	0	0	112.5	R33 H34 S39 Q40 M41	R33-C37 WeakPolarHBondContact O-CB 3.35Å; R33-C37 PolarHBondContact O-N 2.9Å; H34-C37 PolarHBondContact O-N 3.32Å; C37-S39 VanDerWaalsContact C-N 3.34Å; C37-S39 PolarHBondContact O-N 2.94Å; C37-Q40 PolarHBondContact O-N 2.89Å; C37-M41 WeakPolarHBondContact O-CB 3.43Å; C37-M41 PolarHBondContact O-N 3.33Å
38	L	61.5	Low	67.5	Low	80 Å²	80	121.2 Å²	121.2	42%	0.419	58%	0.58	S	S	.	*	H	α-helix	trans	-64.1	-40.9	179.7	-172.7	67	0	0	0	111.5	H34 M41 N42	H34-L38 WeakPolarHBondContact O-CB 3.41Å; H34-L38 PolarHBondContact O-N 3.47Å; L38-M41 PolarHBondContact O-N 3.46Å; L38-N42 WeakPolarHBondContact O-CB 3.4Å; L38-N42 PolarHBondContact O-N 2.92Å
39	S	67.2	Low	67	Low	75 Å²	75	121 Å²	121	52%	0.524	58%	0.582	S	S	.	*	H	α-helix	trans	-62.1	-45.2	175.4	-174.1	0	0	0	0	111.7	W35 V36 C37 M41 N42 K43	W35-S39 WeakPolarHBondContact O-CB 3.32Å; W35-S39 PolarHBondContact O-N 3.36Å; V36-S39 PolarHBondContact O-N 3.46Å; C37-S39 VanDerWaalsContact C-N 3.34Å; C37-S39 PolarHBondContact O-N 2.94Å; S39-M41 PolarHBondContact O-N 2.98Å; S39-N42 PolarHBondContact O-N 3.32Å; S39-K43 WeakPolarHBondContact O-CB 3.4Å; S39-K43 PolarHBondContact O-N 3.29Å
40	Q	64.4	Low	66.2	Low	116 Å²	116	124.6 Å²	124.6	54%	0.542	60%	0.595	S	S	.	*	H	α-helix	trans	-64.1	-40	176.1	-70.2	-70.4	100.7	0	0	112.2	V36 C37 K43 S44	V36-Q40 HydrophobicContact CG1-CG 4.45Å; V36-Q40 WeakPolarHBondContact O-CB 3.4Å; V36-Q40 WeakPolarHBondContact O-CG 3.19Å; V36-Q40 PolarHBondContact O-N 2.92Å; C37-Q40 PolarHBondContact O-N 2.89Å; Q40-K43 PolarHBondContact O-N 3.48Å; Q40-S44 PolarHBondContact O-N 3.46Å
41	M	63.9	Low	65.7	Low	126 Å²	126	123.8 Å²	123.8	62%	0.621	59%	0.594	S	S	*	*	H	α-helix	trans	-68.4	-36	177.5	-138.2	162	69	0	0	112	C37 L38 S39 R45	C37-M41 WeakPolarHBondContact O-CB 3.43Å; C37-M41 PolarHBondContact O-N 3.33Å; L38-M41 PolarHBondContact O-N 3.46Å; S39-M41 PolarHBondContact O-N 2.98Å; M41-R45 WeakPolarHBondContact O-CG 3.43Å; M41-R45 PolarHBondContact O-N 2.99Å
42	N	69.8	Low	65	Low	102 Å²	102	129.4 Å²	129.4	55%	0.545	62%	0.616	S	S	.	*	H	α-helix	trans	-68.3	-38.6	173.4	-162.8	-94.6	0	0	0	111.7	L38 S39 R45	L38-N42 WeakPolarHBondContact O-CB 3.4Å; L38-N42 PolarHBondContact O-N 2.92Å; S39-N42 PolarHBondContact O-N 3.32Å; N42-R45 PolarHBondContact O-N 2.94Å
43	K	66.3	Low	64.4	Low	150 Å²	150	129 Å²	129	65%	0.652	61%	0.608	S	S	*	*	H	α-helix	trans	-65.3	-35.2	176	-168	171	-175.8	175	0	112.9	S39 Q40 R45	S39-K43 WeakPolarHBondContact O-CB 3.4Å; S39-K43 PolarHBondContact O-N 3.29Å; Q40-K43 PolarHBondContact O-N 3.48Å; K43-R45 VanDerWaalsContact C-N 3.29Å; K43-R45 PolarHBondContact O-N 3.09Å
44	S	66.2	Low	64.3	Low	103 Å²	103	124.5 Å²	124.5	72%	0.72	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.2	-9.8	177.5	-169.3	0	0	0	0	114.4	Q40	Q40-S44 PolarHBondContact O-N 3.46Å
45	R	63.2	Low	64.1	Low	222 Å²	222	130.6 Å²	130.6	84%	0.838	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100	1.3	177.2	-67.9	-177.6	88.3	174.5	7.6	113.2	M41 N42 K43	M41-R45 WeakPolarHBondContact O-CG 3.43Å; M41-R45 PolarHBondContact O-N 2.99Å; N42-R45 PolarHBondContact O-N 2.94Å; K43-R45 VanDerWaalsContact C-N 3.29Å; K43-R45 PolarHBondContact O-N 3.09Å
46	R	57.8	Low	64.1	Low	267 Å²	267	129.1 Å²	129.1	100%	1.008	64%	0.638	S	S	*	*			trans	-104.7	0	166.2	-74.3	-174.6	179.1	-175.3	0.1	108.9

Retrieved 46 of 46 residues in 35.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).