X5D926_HUMAN Loading...

Glutathione peroxidase 1 isoform A

AlphaFold DB , UniProt , Accession X5D926, Species HUMAN (Homo sapiens, Human), Gene GPX1, Length 48 aa.

						>X5D926_HUMAN|X5D926|GPX1
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	64.9	Low	67	Low	193 Å²	193	93.8 Å²	93.8	95%	0.951	60%	0.595	S	S	*	*				0	-47.6	0	-66.9	-129.4	-167.3	0	0	113.4	A4 R5	M1-A4 PolarHBondContact O-N 3.05Å; M1-R5 PolarHBondContact O-N 2.92Å
2	C	70.9	Confident	66.4	Low	97 Å²	97	89.6 Å²	89.6	66%	0.655	58%	0.575	S	S	*	*	H	α-helix	trans	-59.6	-46.3	178.3	-77.2	0	0	0	0	114.4	A4 R5 L6	C2-A4 PolarHBondContact O-N 3.49Å; C2-A4 VanDerWaalsContact C-N 3.32Å; C2-R5 PolarHBondContact O-N 3.41Å; C2-L6 WeakPolarHBondContact O-CG 3.38Å; C2-L6 PolarHBondContact O-N 2.9Å
3	A	67.1	Low	66	Low	77 Å²	77	87.8 Å²	87.8	64%	0.636	57%	0.573	S	S	*	*	H	α-helix	trans	-61.7	-37.7	-179.7	0	0	0	0	0	113.1	L6 A7	A3-L6 PolarHBondContact O-N 3.22Å; A3-A7 WeakPolarHBondContact O-CB 3.39Å; A3-A7 PolarHBondContact O-N 3.39Å
4	A	69	Low	67	Low	70 Å²	70	94.1 Å²	94.1	58%	0.579	59%	0.591	S	S	*	*	H	α-helix	trans	-68.5	-36.4	176.6	0	0	0	0	0	112.4	M1 C2 A8	M1-A4 PolarHBondContact O-N 3.05Å; C2-A4 PolarHBondContact O-N 3.49Å; C2-A4 VanDerWaalsContact C-N 3.32Å; A4-A8 WeakPolarHBondContact O-CB 3.34Å; A4-A8 PolarHBondContact O-N 2.91Å
5	R	68.3	Low	68.6	Low	181 Å²	181	90.2 Å²	90.2	68%	0.683	57%	0.568	S	S	*	*	H	α-helix	trans	-68	-39.9	173.8	-74.7	179.9	174.5	163.8	-1	112.1	M1 C2 A8 A9	M1-R5 PolarHBondContact O-N 2.92Å; C2-R5 PolarHBondContact O-N 3.41Å; R5-A8 PolarHBondContact O-N 2.96Å; R5-A9 WeakPolarHBondContact O-CB 3.33Å; R5-A9 PolarHBondContact O-N 3.36Å
6	L	68.8	Low	70.2	Confident	124 Å²	124	88.1 Å²	88.1	65%	0.649	55%	0.554	S	S	*	*	H	α-helix	trans	-65.6	-42.2	175.5	-74.6	160.5	0	0	0	111.6	C2 A3 A9 A10	C2-L6 WeakPolarHBondContact O-CG 3.38Å; C2-L6 PolarHBondContact O-N 2.9Å; A3-L6 PolarHBondContact O-N 3.22Å; L6-A9 PolarHBondContact O-N 3.22Å; L6-A10 WeakPolarHBondContact O-CB 3.32Å; L6-A10 PolarHBondContact O-N 3.42Å
7	A	67.5	Low	71.6	Confident	61 Å²	61	86.8 Å²	86.8	50%	0.504	54%	0.537	S	S	.	.	H	α-helix	trans	-64.9	-41.6	175.5	0	0	0	0	0	112.4	A3 A10 A11	A3-A7 WeakPolarHBondContact O-CB 3.39Å; A3-A7 PolarHBondContact O-N 3.39Å; A7-A10 PolarHBondContact O-N 3.39Å; A7-A11 WeakPolarHBondContact O-CB 3.34Å; A7-A11 PolarHBondContact O-N 3.18Å
8	A	67	Low	72.8	Confident	62 Å²	62	85.1 Å²	85.1	51%	0.512	53%	0.532	S	S	.	.	H	α-helix	trans	-65.7	-38.8	175.3	0	0	0	0	0	112.4	A4 R5 A12	A4-A8 WeakPolarHBondContact O-CB 3.34Å; A4-A8 PolarHBondContact O-N 2.91Å; R5-A8 PolarHBondContact O-N 2.96Å; A8-A12 WeakPolarHBondContact O-CB 3.45Å; A8-A12 PolarHBondContact O-N 2.88Å
9	A	65.9	Low	73.9	Confident	60 Å²	60	87.2 Å²	87.2	50%	0.496	53%	0.533	S	S	.	.	H	α-helix	trans	-66.8	-40.9	175	0	0	0	0	0	112.1	R5 L6 A12 A13	R5-A9 WeakPolarHBondContact O-CB 3.33Å; R5-A9 PolarHBondContact O-N 3.36Å; L6-A9 PolarHBondContact O-N 3.22Å; A9-A12 PolarHBondContact O-N 3.04Å; A9-A13 WeakPolarHBondContact O-CB 3.46Å; A9-A13 PolarHBondContact O-N 2.92Å
10	A	64.9	Low	75.1	Confident	51 Å²	51	86.5 Å²	86.5	42%	0.421	53%	0.532	S	S	.	.	H	α-helix	trans	-66.5	-41.5	175.4	0	0	0	0	0	112.2	L6 A7 A12 A13 Q14	L6-A10 WeakPolarHBondContact O-CB 3.32Å; L6-A10 PolarHBondContact O-N 3.42Å; A7-A10 PolarHBondContact O-N 3.39Å; A10-A12 VanDerWaalsContact C-N 3.34Å; A10-A13 PolarHBondContact O-N 3.43Å; A10-Q14 WeakPolarHBondContact O-CG 3.36Å; A10-Q14 PolarHBondContact O-N 2.93Å
11	A	62.2	Low	76.1	Confident	56 Å²	56	85.2 Å²	85.2	46%	0.463	53%	0.531	S	S	.	.	H	α-helix	trans	-66.6	-35.8	175.4	0	0	0	0	0	112.3	A7 Q14 S15	A7-A11 WeakPolarHBondContact O-CB 3.34Å; A7-A11 PolarHBondContact O-N 3.18Å; A11-Q14 PolarHBondContact O-N 3.46Å; A11-S15 PolarHBondContact O-N 3.21Å
12	A	60.8	Low	77.7	Confident	43 Å²	43	84.1 Å²	84.1	36%	0.355	52%	0.516	S	S	.	.	H	α-helix	trans	-65.3	-42.7	170.7	0	0	0	0	0	111.1	A8 A9 A10 Q14 S15 A18	A8-A12 WeakPolarHBondContact O-CB 3.45Å; A8-A12 PolarHBondContact O-N 2.88Å; A9-A12 PolarHBondContact O-N 3.04Å; A10-A12 VanDerWaalsContact C-N 3.34Å; A12-Q14 PolarHBondContact O-N 2.97Å; A12-S15 PolarHBondContact O-N 3.41Å; A12-S15 VanDerWaalsContact O-O 3.12Å; A12-A18 WeakPolarHBondContact O-CB 3.44Å
13	A	60.3	Low	79	Confident	66 Å²	66	82.2 Å²	82.2	55%	0.545	50%	0.502	S	S	.	.	H	α-helix	trans	-64.8	-19.1	176.8	0	0	0	0	0	113.9	A9 A10	A9-A13 WeakPolarHBondContact O-CB 3.46Å; A9-A13 PolarHBondContact O-N 2.92Å; A10-A13 PolarHBondContact O-N 3.43Å
14	Q	79.9	Confident	80.4	Confident	176 Å²	176	87.4 Å²	87.4	82%	0.822	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.7	-3.4	174.5	-71.8	174.9	-18.1	0	0	113.6	A10 A11 A12	A10-Q14 WeakPolarHBondContact O-CG 3.36Å; A10-Q14 PolarHBondContact O-N 2.93Å; A11-Q14 PolarHBondContact O-N 3.46Å; A12-Q14 PolarHBondContact O-N 2.97Å
15	S	91.1	Very high	81.8	Confident	36 Å²	36	89.1 Å²	89.1	25%	0.252	53%	0.532	S	S	.	.	S	Bend	trans	-115.9	153.3	-177.8	-177.2	0	0	0	0	111.4	A11 A12 Y17 A18 F19	A11-S15 PolarHBondContact O-N 3.21Å; A12-S15 PolarHBondContact O-N 3.41Å; A12-S15 VanDerWaalsContact O-O 3.12Å; S15-Y17 WeakPolarHBondContact OG-CD2 3.12Å; S15-Y17 PolarHBondContact OG-N 3.34Å; S15-Y17 VanDerWaalsContact O-N 3.09Å; S15-Y17 PolarHBondContact O-N 3.09Å; S15-A18 PolarHBondContact O-N 3.09Å; S15-F19 WeakPolarHBondContact O-CE2 3.16Å
16	V	94	Very high	83.1	Confident	57 Å²	57	82.3 Å²	82.3	35%	0.345	52%	0.519	S	S	.	.	G	3₁₀ helix	trans	-57.7	-22.5	171	-61.3	0	0	0	0	112.7	A18 F19 L32 L40 I42	V16-A18 PolarHBondContact O-N 3.2Å; V16-F19 WeakPolarHBondContact O-CD2 3.38Å; V16-F19 PolarHBondContact O-N 3.38Å; V16-F19 VanDerWaalsContact O-N 3.09Å; V16-L32 HydrophobicContact CB-CD1 4.08Å; V16-L32 WeakPolarHBondContact O-CB 3.33Å; V16-L40 HydrophobicContact CG2-CD1 4.35Å; V16-I42 HydrophobicContact CG1-CD1 4.41Å
17	Y	94.1	Very high	84.4	Confident	66 Å²	66	78.8 Å²	78.8	26%	0.259	51%	0.512	S	S	.	.	G	3₁₀ helix	trans	-68.3	-14.3	-176.9	-55.5	-37.5	0	0	0	115	S15 L32 R36	S15-Y17 WeakPolarHBondContact OG-CD2 3.12Å; S15-Y17 PolarHBondContact OG-N 3.34Å; S15-Y17 VanDerWaalsContact O-N 3.09Å; S15-Y17 PolarHBondContact O-N 3.09Å; Y17-L32 WeakPolarHBondContact CD1-O 3.35Å; Y17-L32 VanDerWaalsContact CD1-O 3.31Å; Y17-R36 HydrophobicContact CE2-CB 4.37Å; Y17-R36 HydrophobicContact CE2-CG 3.98Å; Y17-R36 HydrophobicContact CE1-CB 4.33Å
18	A	93.3	Very high	85.8	Confident	55 Å²	55	83.3 Å²	83.3	46%	0.455	52%	0.522	S	S	.	.	G	3₁₀ helix	trans	-77.7	-8.8	172.2	0	0	0	0	0	113.7	A12 S15 V16	A12-A18 WeakPolarHBondContact O-CB 3.44Å; S15-A18 PolarHBondContact O-N 3.09Å; V16-A18 PolarHBondContact O-N 3.2Å
19	F	94.6	Very high	87.3	Confident	126 Å²	126	82.8 Å²	82.8	55%	0.553	51%	0.514	S	S	*	.			trans	-105.2	155.2	-174.5	-55.6	-83.7	0	0	0	112.2	S15 V16 L32	S15-F19 WeakPolarHBondContact O-CE2 3.16Å; V16-F19 WeakPolarHBondContact O-CD2 3.38Å; V16-F19 PolarHBondContact O-N 3.38Å; V16-F19 VanDerWaalsContact O-N 3.09Å; F19-L32 HydrophobicContact CB-CD1 4.3Å; F19-L32 PolarHBondContact O-N 2.99Å
20	S	96.6	Very high	88.8	Confident	73 Å²	73	83.4 Å²	83.4	51%	0.51	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.6	157	169.3	61.8	0	0	0	0	110.1	V30	S20-V30 WeakPolarHBondContact CA-O 3.46Å; S20-V30 VanDerWaalsContact CB-O 3.24Å; S20-V30 WeakPolarHBondContact CB-O 3.24Å
21	A	97.5	Very high	90.3	Very high	60 Å²	60	83.7 Å²	83.7	50%	0.496	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.8	150.4	177.3	0	0	0	0	0	110.3	P29 V30	A21-P29 WeakPolarHBondContact O-CA 3.31Å; A21-V30 PolarHBondContact O-N 3.3Å; A21-V30 VanDerWaalsContact N-O 3.09Å; A21-V30 PolarHBondContact N-O 3.33Å
22	R	98.1	Very high	92	Very high	170 Å²	170	83.1 Å²	83.1	64%	0.642	50%	0.499	S	S	*	.			trans	-81.5	135.2	174.6	-72.5	-174.5	-173.4	-86.4	2.4	110.1	G27 P29	R22-G27 PolarHBondContact NH1-O 3.18Å; R22-P29 HydrophobicContact CG-CG 4.15Å
23	P	97.9	Very high	93.7	Very high	56 Å²	56	82.3 Å²	82.3	36%	0.364	50%	0.495	S	S	.	.			trans	-61.4	156.6	173.5	-22.3	33.5	0	0	0	112.5	A25 G26 E28 V30	P23-A25 VanDerWaalsContact C-N 3.26Å; P23-A25 PolarHBondContact O-N 2.99Å; P23-G26 WeakPolarHBondContact O-CA 3.47Å; P23-G26 PolarHBondContact O-N 3.19Å; P23-E28 WeakPolarHBondContact CD-O 3.31Å; P23-V30 HydrophobicContact CG-CG2 3.88Å
24	L	97.1	Very high	95.4	Very high	187 Å²	187	83.3 Å²	83.3	98%	0.979	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.5	-38.7	176.5	179.6	63	0	0	0	112.5	G26	L24-G26 PolarHBondContact O-N 3.03Å; L24-G26 VanDerWaalsContact O-N 3.12Å
25	A	97.7	Very high	96.3	Very high	106 Å²	106	78 Å²	78	88%	0.876	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.9	1.5	176.2	0	0	0	0	0	113.8	P23	P23-A25 VanDerWaalsContact C-N 3.26Å; P23-A25 PolarHBondContact O-N 2.99Å
26	G	95.6	Very high	96.5	Very high	38 Å²	38	85.6 Å²	85.6	39%	0.392	50%	0.498	S	S	.	.			trans	80.9	-166.1	-171.3	0	0	0	0	0	113.1	P23 L24	P23-G26 WeakPolarHBondContact O-CA 3.47Å; P23-G26 PolarHBondContact O-N 3.19Å; L24-G26 PolarHBondContact O-N 3.03Å; L24-G26 VanDerWaalsContact O-N 3.12Å
27	G	95.8	Very high	96.6	Very high	49 Å²	49	86.4 Å²	86.4	51%	0.505	52%	0.518	S	S	.	.			trans	95.4	-162.6	177.6	0	0	0	0	0	115.1	R22	R22-G27 PolarHBondContact NH1-O 3.18Å
28	E	97.6	Very high	96.8	Very high	156 Å²	156	90.3 Å²	90.3	73%	0.729	54%	0.536	S	S	*	.	S	Bend	trans	-65.5	140.7	-176	-72.7	-55.3	127.1	0	0	112.2	P23 V30	P23-E28 WeakPolarHBondContact CD-O 3.31Å; E28-V30 PolarHBondContact O-N 3.21Å
29	P	98.1	Very high	97	Very high	52 Å²	52	94.9 Å²	94.9	34%	0.338	56%	0.558	S	S	.	*	P	Polyproline II helix	trans	-58.6	132.9	173.8	-22.5	33.7	0	0	0	111.9	A21 R22	A21-P29 WeakPolarHBondContact O-CA 3.31Å; R22-P29 HydrophobicContact CG-CG 4.15Å
30	V	97.6	Very high	97.2	Very high	73 Å²	73	91.9 Å²	91.9	44%	0.442	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.3	122.3	174	179.7	0	0	0	0	108.5	S20 A21 P23 E28	S20-V30 WeakPolarHBondContact CA-O 3.46Å; S20-V30 VanDerWaalsContact CB-O 3.24Å; S20-V30 WeakPolarHBondContact CB-O 3.24Å; A21-V30 PolarHBondContact O-N 3.3Å; A21-V30 VanDerWaalsContact N-O 3.09Å; A21-V30 PolarHBondContact N-O 3.33Å; P23-V30 HydrophobicContact CG-CG2 3.88Å; E28-V30 PolarHBondContact O-N 3.21Å
31	S	97.1	Very high	97.3	Very high	56 Å²	56	95.3 Å²	95.3	39%	0.392	56%	0.56	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-73.6	129.5	173.2	176.4	0	0	0	0	110.5	G33 S34	S31-G33 PolarHBondContact OG-N 3.23Å; S31-G33 VanDerWaalsContact OG-N 3.13Å; S31-G33 PolarHBondContact O-N 2.85Å; S31-S34 WeakPolarHBondContact O-CB 3.45Å; S31-S34 PolarHBondContact O-N 3.4Å; S31-S34 PolarHBondContact O-OG 2.71Å
32	L	97	Very high	97.3	Very high	44 Å²	44	98.1 Å²	98.1	23%	0.23	57%	0.565	C	S	.	*	G	3₁₀ helix	trans	-65.6	-19.2	172.5	-61.5	-175.6	0	0	0	112	V16 Y17 F19 S34 L35	V16-L32 HydrophobicContact CB-CD1 4.08Å; V16-L32 WeakPolarHBondContact O-CB 3.33Å; Y17-L32 WeakPolarHBondContact CD1-O 3.35Å; Y17-L32 VanDerWaalsContact CD1-O 3.31Å; F19-L32 HydrophobicContact CB-CD1 4.3Å; F19-L32 PolarHBondContact O-N 2.99Å; L32-S34 PolarHBondContact O-N 3.13Å; L32-L35 HydrophobicContact CD2-CD1 4.41Å; L32-L35 WeakPolarHBondContact O-CB 3.14Å; L32-L35 PolarHBondContact O-N 2.76Å
33	G	96.3	Very high	97.3	Very high	27 Å²	27	96.5 Å²	96.5	28%	0.278	57%	0.565	S	S	.	*	G	3₁₀ helix	trans	-57.9	-26.2	173.5	0	0	0	0	0	113.9	S31 L35 R36	S31-G33 PolarHBondContact OG-N 3.23Å; S31-G33 VanDerWaalsContact OG-N 3.13Å; S31-G33 PolarHBondContact O-N 2.85Å; G33-L35 PolarHBondContact O-N 3.12Å; G33-R36 PolarHBondContact O-N 3.09Å
34	S	97.1	Very high	97.3	Very high	86 Å²	86	101.6 Å²	101.6	60%	0.601	59%	0.589	S	S	*	*	G	3₁₀ helix	trans	-63.9	-17.4	175.1	64.8	0	0	0	0	113.8	S31 L32	S31-S34 WeakPolarHBondContact O-CB 3.45Å; S31-S34 PolarHBondContact O-N 3.4Å; S31-S34 PolarHBondContact O-OG 2.71Å; L32-S34 PolarHBondContact O-N 3.13Å
35	L	97.3	Very high	97.3	Very high	65 Å²	65	98.9 Å²	98.9	34%	0.34	58%	0.58	S	S	.	*	G	3₁₀ helix	trans	-98.1	12.7	-177.2	-58.5	174.3	0	0	0	113.3	L32 G33 G37 K38 L40	L32-L35 HydrophobicContact CD2-CD1 4.41Å; L32-L35 WeakPolarHBondContact O-CB 3.14Å; L32-L35 PolarHBondContact O-N 2.76Å; G33-L35 PolarHBondContact O-N 3.12Å; L35-G37 PolarHBondContact O-N 2.92Å; L35-K38 VanDerWaalsContact O-CB 3.31Å; L35-K38 WeakPolarHBondContact O-CB 3.45Å; L35-K38 PolarHBondContact O-N 3.3Å; L35-L40 HydrophobicContact CB-CD1 4.22Å; L35-L40 HydrophobicContact CB-CD2 4.08Å; L35-L40 HydrophobicContact CD1-CD1 4.11Å; L35-L40 HydrophobicContact CD1-CD2 3.81Å
36	R	96.3	Very high	97.3	Very high	196 Å²	196	98.6 Å²	98.6	74%	0.74	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.5	131.3	178.7	-169.1	179	-172.4	107.5	-0.6	111.1	Y17 G33	Y17-R36 HydrophobicContact CE2-CB 4.37Å; Y17-R36 HydrophobicContact CE2-CG 3.98Å; Y17-R36 HydrophobicContact CE1-CB 4.33Å; G33-R36 PolarHBondContact O-N 3.09Å
37	G	96.2	Very high	97.3	Very high	74 Å²	74	102.8 Å²	102.8	76%	0.763	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	88.1	2.7	-176.5	0	0	0	0	0	114.2	L35	L35-G37 PolarHBondContact O-N 2.92Å
38	K	98.3	Very high	96.9	Very high	147 Å²	147	112.5 Å²	112.5	64%	0.639	64%	0.64	S	S	*	*	S	Bend	trans	-101.1	150.3	167.4	-56.6	-58	-172.7	-178.5	0	110.8	L35 L40	L35-K38 VanDerWaalsContact O-CB 3.31Å; L35-K38 WeakPolarHBondContact O-CB 3.45Å; L35-K38 PolarHBondContact O-N 3.3Å; K38-L40 HydrophobicContact CB-CD2 4.12Å
39	V	97.9	Very high	96.8	Very high	151 Å²	151	110.3 Å²	110.3	92%	0.915	64%	0.635	S	S	*	*			trans	-83.4	130.5	164.8	177	0	0	0	0	107.5
40	L	97.8	Very high	96.8	Very high	64 Å²	64	113.4 Å²	113.4	34%	0.335	65%	0.651	S	S	.	*			trans	-116.6	130.1	-177.1	-55.5	-178.4	0	0	0	109.9	V16 L35 K38	V16-L40 HydrophobicContact CG2-CD1 4.35Å; L35-L40 HydrophobicContact CB-CD1 4.22Å; L35-L40 HydrophobicContact CB-CD2 4.08Å; L35-L40 HydrophobicContact CD1-CD1 4.11Å; L35-L40 HydrophobicContact CD1-CD2 3.81Å; K38-L40 HydrophobicContact CB-CD2 4.12Å
41	L	98.2	Very high	96.7	Very high	145 Å²	145	115.6 Å²	115.6	76%	0.759	66%	0.662	S	S	*	*			trans	-103.8	127.1	162.1	-178.3	63.9	0	0	0	107.4	E43	L41-E43 WeakPolarHBondContact CD2-OE1 3.41Å; L41-E43 HydrophobicContact CG-CG 4.19Å
42	I	97.7	Very high	96.7	Very high	119 Å²	119	119.1 Å²	119.1	61%	0.61	68%	0.678	S	S	*	*			trans	-119.6	122.6	-178.1	-61.5	170.4	0	0	0	107.6	V16	V16-I42 HydrophobicContact CG1-CD1 4.41Å
43	E	98.3	Very high	96.7	Very high	136 Å²	136	123.8 Å²	123.8	64%	0.636	71%	0.706	S	S	*	*			trans	-125.8	139.7	-177.2	-62.8	-176.8	177.4	0	0	110.7	L41	L41-E43 WeakPolarHBondContact CD2-OE1 3.41Å; L41-E43 HydrophobicContact CG-CG 4.19Å
44	N	97.6	Very high	96.7	Very high	163 Å²	163	130.3 Å²	130.3	87%	0.872	74%	0.735	S	S	*	*			trans	-83.4	124	165.5	62.8	-73.1	0	0	0	108.9
45	V	97.6	Very high	96.7	Very high	130 Å²	130	133.4 Å²	133.4	79%	0.788	74%	0.744	S	S	*	*			trans	-111.2	155.8	-178.3	-62.6	0	0	0	0	111.6
46	A	97.4	Very high	96.6	Very high	99 Å²	99	138.7 Å²	138.7	82%	0.818	78%	0.775	S	S	*	*			trans	-147.5	148.9	170.8	0	0	0	0	0	109.7
47	S	95.9	Very high	96.6	Very high	126 Å²	126	133.9 Å²	133.9	88%	0.881	78%	0.778	S	S	*	*			trans	-97	151	173.2	-57	0	0	0	0	110.5
48	L	86.9	Confident	96.7	Very high	253 Å²	253	139.4 Å²	139.4	100%	1.325	78%	0.78	S	S	*	*			trans	-88.5	0	174.2	-71.7	167.3	0	0	0	111.9

Retrieved 48 of 48 residues in 13.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).