X5D9J1_HUMAN Loading...

AMP-activated protein kinase beta 2 non-catalytic subunit isoform C

AlphaFold DB , UniProt , Accession X5D9J1, Species HUMAN (Homo sapiens, Human), Gene PRKAB2, Length 53 aa.

						>X5D9J1_HUMAN|X5D9J1|PRKAB2
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.1	Low	65.3	Low	246 Å²	246	131.5 Å²	131.5	100%	1.212	77%	0.769	S	S	*	*				0	99.4	0	-160.9	168.4	-75.5	0	0	106.1
2	G	68.8	Low	64.9	Low	69 Å²	69	134.1 Å²	134.1	71%	0.711	77%	0.768	S	S	*	*			trans	-78.8	134.2	-168.2	0	0	0	0	0	111.6	T4	G2-T4 VanDerWaalsContact O-N 3.13Å; G2-T4 PolarHBondContact O-N 2.78Å
3	N	66.8	Low	64.8	Low	160 Å²	160	141.3 Å²	141.3	86%	0.856	78%	0.775	S	S	*	*			trans	-79.3	91.5	170.2	48.7	11.6	0	0	0	108.6	T5	N3-T5 PolarHBondContact O-N 2.82Å; N3-T5 VanDerWaalsContact O-N 3.1Å
4	T	65.8	Low	64.3	Low	125 Å²	125	142.6 Å²	142.6	77%	0.767	77%	0.773	S	S	*	*			trans	-60.1	111.1	168.1	49.6	0	0	0	0	109.5	G2	G2-T4 VanDerWaalsContact O-N 3.13Å; G2-T4 PolarHBondContact O-N 2.78Å
5	T	65.9	Low	64.3	Low	108 Å²	108	138.8 Å²	138.8	66%	0.663	78%	0.78	S	S	*	*			trans	18.5	130.2	149.5	-15.9	0	0	0	0	118.6	N3 D7	N3-T5 PolarHBondContact O-N 2.82Å; N3-T5 VanDerWaalsContact O-N 3.1Å; T5-D7 VanDerWaalsContact CG2-OD2 3.28Å; T5-D7 WeakPolarHBondContact CG2-OD2 2.88Å
6	S	66.9	Low	64.3	Low	97 Å²	97	135.3 Å²	135.3	68%	0.678	77%	0.774	S	S	*	*			trans	-133.6	82.8	155.5	-71.8	0	0	0	0	108.9	R8	S6-R8 PolarHBondContact O-N 3.06Å
7	D	68.4	Low	64.4	Low	140 Å²	140	139.4 Å²	139.4	75%	0.749	78%	0.781	S	S	*	*			trans	-70	81.6	158.4	-66.8	-63.4	0	0	0	106.8	T5 V9	T5-D7 VanDerWaalsContact CG2-OD2 3.28Å; T5-D7 WeakPolarHBondContact CG2-OD2 2.88Å; D7-V9 PolarHBondContact O-N 3.22Å
8	R	69.4	Low	64.5	Low	219 Å²	219	136.6 Å²	136.6	83%	0.826	78%	0.779	S	S	*	*			trans	-62.8	100.4	164.1	-62	-168.2	-156.8	100.7	2.2	104.7	S6 S10	S6-R8 PolarHBondContact O-N 3.06Å; R8-S10 PolarHBondContact O-N 3.23Å
9	V	60.6	Low	64.4	Low	129 Å²	129	134.3 Å²	134.3	78%	0.782	78%	0.778	S	S	*	*			trans	-33.9	106.6	164	160	0	0	0	0	105.7	D7 G11	D7-V9 PolarHBondContact O-N 3.22Å; V9-G11 PolarHBondContact O-N 3.1Å
10	S	60.8	Low	64.5	Low	111 Å²	111	139.7 Å²	139.7	78%	0.776	78%	0.784	S	S	*	*			trans	-70.7	80.4	167.5	-164.3	0	0	0	0	103.2	R8 E12	R8-S10 PolarHBondContact O-N 3.23Å; S10-E12 PolarHBondContact O-N 2.81Å
11	G	62.3	Low	64.2	Low	43 Å²	43	138.1 Å²	138.1	44%	0.443	78%	0.783	S	S	.	*			trans	-47.8	121	-177.9	0	0	0	0	0	105.4	V9 R13	V9-G11 PolarHBondContact O-N 3.1Å; G11-R13 PolarHBondContact O-N 2.84Å
12	E	60	Low	64.2	Low	162 Å²	162	134.6 Å²	134.6	76%	0.757	76%	0.764	S	S	*	*			trans	-18.9	101.9	164.5	-171.1	149.7	87.6	0	0	108.3	S10 H14	S10-E12 PolarHBondContact O-N 2.81Å; E12-H14 PolarHBondContact O-CD2 3.33Å; E12-H14 PolarHBondContact O-N 2.91Å
13	R	64.1	Low	63.5	Low	228 Å²	228	134.1 Å²	134.1	86%	0.86	76%	0.759	S	S	*	*			trans	-66.6	90.5	178.9	-74.7	-173	-68.1	-173	-3.5	103.7	G11 G15	G11-R13 PolarHBondContact O-N 2.84Å; R13-G15 VanDerWaalsContact C-N 3.34Å; R13-G15 WeakPolarHBondContact O-CA 3.43Å; R13-G15 PolarHBondContact O-N 2.59Å
14	H	57.5	Low	63	Low	160 Å²	160	131.4 Å²	131.4	74%	0.741	76%	0.758	S	S	*	*			trans	-45.5	105.5	-177.3	-67.6	172.6	0	0	0	105.9	E12 A16	E12-H14 PolarHBondContact O-CD2 3.33Å; E12-H14 PolarHBondContact O-N 2.91Å; H14-A16 PolarHBondContact O-N 2.93Å
15	G	63.8	Low	62.5	Low	85 Å²	85	128.5 Å²	128.5	88%	0.876	75%	0.753	S	S	*	*			trans	-74.1	36	-170.7	0	0	0	0	0	111.9	R13	R13-G15 VanDerWaalsContact C-N 3.34Å; R13-G15 WeakPolarHBondContact O-CA 3.43Å; R13-G15 PolarHBondContact O-N 2.59Å
16	A	64.3	Low	61.9	Low	83 Å²	83	126.2 Å²	126.2	69%	0.686	75%	0.751	S	S	*	*			trans	-102.3	88.4	171.8	0	0	0	0	0	106.9	H14 A18	H14-A16 PolarHBondContact O-N 2.93Å; A16-A18 PolarHBondContact O-N 3.15Å
17	K	67.3	Low	61.2	Low	204 Å²	204	130.3 Å²	130.3	89%	0.887	76%	0.759	S	S	*	*			trans	-57	114	157.1	-51.3	-173.3	-174.6	-176.2	0	104.4	A19	K17-A19 PolarHBondContact O-N 3.31Å
18	A	65.1	Low	60.5	Low	90 Å²	90	126.2 Å²	126.2	74%	0.744	74%	0.744	S	S	*	*			trans	-50.6	120.3	172.8	0	0	0	0	0	106.9	A16 R20	A16-A18 PolarHBondContact O-N 3.15Å; A18-R20 PolarHBondContact O-N 3.28Å
19	A	63.7	Low	59.8	Low	92 Å²	92	122.4 Å²	122.4	76%	0.76	75%	0.748	S	S	*	*			trans	-54.2	119.5	163.5	0	0	0	0	0	104	K17 S21	K17-A19 PolarHBondContact O-N 3.31Å; A19-S21 PolarHBondContact O-N 3.25Å
20	R	65.4	Low	59.8	Low	242 Å²	242	119.5 Å²	119.5	91%	0.913	75%	0.745	S	S	*	*			trans	-56.8	101.1	162.8	-74	-173.1	165.7	87.8	0.8	103	A18 E22	A18-R20 PolarHBondContact O-N 3.28Å; R20-E22 VanDerWaalsContact C-N 3.25Å; R20-E22 PolarHBondContact O-N 2.84Å
21	S	59.3	Low	59.8	Low	108 Å²	108	122 Å²	122	76%	0.755	74%	0.741	S	S	*	*			trans	-53.4	108.1	166.7	165	0	0	0	0	102.7	A19 G23	A19-S21 PolarHBondContact O-N 3.25Å; S21-G23 PolarHBondContact O-N 2.8Å
22	E	63.1	Low	59.9	Low	172 Å²	172	126.6 Å²	126.6	80%	0.804	75%	0.751	S	S	*	*			trans	-57.7	99.1	161.9	-172.5	-170.7	125.3	0	0	102.7	R20 A24	R20-E22 VanDerWaalsContact C-N 3.25Å; R20-E22 PolarHBondContact O-N 2.84Å; E22-A24 PolarHBondContact O-N 3.45Å
23	G	53.1	Low	60.5	Low	59 Å²	59	126.5 Å²	126.5	61%	0.608	75%	0.75	S	S	*	*			trans	-58.9	91.1	163.6	0	0	0	0	0	104.8	S21 G25	S21-G23 PolarHBondContact O-N 2.8Å; G23-G25 PolarHBondContact O-N 3.05Å
24	A	57.3	Low	61	Low	102 Å²	102	123.2 Å²	123.2	84%	0.843	74%	0.742	S	S	*	*			trans	-59.6	79.9	154.2	0	0	0	0	0	105.3	E22	E22-A24 PolarHBondContact O-N 3.45Å
25	G	53.8	Low	61.8	Low	64 Å²	64	122.5 Å²	122.5	66%	0.66	74%	0.743	S	S	*	*			trans	-163.5	50.7	-160.3	0	0	0	0	0	109	G23	G23-G25 PolarHBondContact O-N 3.05Å
26	G	54.5	Low	62.2	Low	60 Å²	60	126 Å²	126	62%	0.619	74%	0.738	S	S	*	*			trans	58.2	91.3	152.2	0	0	0	0	0	116.1	A28	G26-A28 PolarHBondContact O-N 2.94Å
27	H	51.4	Low	62.9	Low	183 Å²	183	128.7 Å²	128.7	85%	0.847	75%	0.746	S	S	*	*				-66	83.7	128	-74.1	75.6	0	0	0	106.2
28	A	53.4	Low	63	Low	54 Å²	54	122 Å²	122	45%	0.446	73%	0.734	S	S	.	*			trans	-55.9	130.7	166.4	0	0	0	0	0	106.9	G26 G30	G26-A28 PolarHBondContact O-N 2.94Å; A28-G30 PolarHBondContact O-N 2.94Å
29	P	55.3	Low	63	Low	140 Å²	140	122 Å²	122	91%	0.909	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	89.8	171.4	29.1	-31.2	0	0	0	106.8
30	G	59.5	Low	63.2	Low	68 Å²	68	122.7 Å²	122.7	70%	0.701	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	163.1	-0.5	-175.6	0	0	0	0	0	118.3	A28 E32	A28-G30 PolarHBondContact O-N 2.94Å; G30-E32 PolarHBondContact O-N 2.98Å
31	K	61.2	Low	63.4	Low	162 Å²	162	118.7 Å²	118.7	70%	0.704	72%	0.721	S	S	*	*			trans	-96.3	90.5	168.4	-60.7	-176.6	-167.1	-108.8	0	108.6	H33	K31-H33 PolarHBondContact O-N 3.22Å
32	E	65.6	Low	64.1	Low	141 Å²	141	116.9 Å²	116.9	66%	0.659	70%	0.703	S	S	*	*			trans	-48.2	111.4	162.4	40.6	175.4	-173.4	0	0	109.1	G30 K34	G30-E32 PolarHBondContact O-N 2.98Å; E32-K34 WeakPolarHBondContact OE2-CE 3.29Å; E32-K34 PolarHBondContact OE1-NZ 3.07Å; E32-K34 IonicContact OE1-NZ 2.78Å; E32-K34 PolarHBondContact O-N 2.73Å; E32-K34 VanDerWaalsContact C-N 3.33Å; E32-K34 WeakPolarHBondContact OE1-CE 3.49Å
33	H	72.5	Confident	64.3	Low	159 Å²	159	113.7 Å²	113.7	74%	0.736	70%	0.697	S	S	*	*			trans	-70	94.4	171.5	-62.3	103	0	0	0	107.4	K31 I35	K31-H33 PolarHBondContact O-N 3.22Å; H33-I35 VanDerWaalsContact C-N 3.31Å; H33-I35 PolarHBondContact O-N 2.9Å
34	K	74.5	Confident	65	Low	159 Å²	159	114 Å²	114	69%	0.691	69%	0.69	S	S	*	*			trans	-72.3	91.7	173.8	-65.5	-179.5	-175.5	173.2	0	107.8	E32 M36	E32-K34 WeakPolarHBondContact OE2-CE 3.29Å; E32-K34 PolarHBondContact OE1-NZ 3.07Å; E32-K34 IonicContact OE1-NZ 2.78Å; E32-K34 PolarHBondContact O-N 2.73Å; E32-K34 VanDerWaalsContact C-N 3.33Å; E32-K34 WeakPolarHBondContact OE1-CE 3.49Å; K34-M36 PolarHBondContact O-N 2.78Å
35	I	73.2	Confident	65.4	Low	145 Å²	145	113.9 Å²	113.9	74%	0.744	68%	0.678	S	S	*	*			trans	-52.4	123	169.6	-60.7	165	0	0	0	106.5	H33 V37	H33-I35 VanDerWaalsContact C-N 3.31Å; H33-I35 PolarHBondContact O-N 2.9Å; I35-V37 PolarHBondContact O-N 2.73Å
36	M	73.6	Confident	66.2	Low	158 Å²	158	119 Å²	119	78%	0.778	68%	0.683	S	S	*	*			trans	-72.4	93.9	-176.3	-158.5	-177.1	-33.3	0	0	108.8	K34 G38	K34-M36 PolarHBondContact O-N 2.78Å; M36-G38 PolarHBondContact O-N 2.83Å
37	V	77.4	Confident	66.9	Low	140 Å²	140	120.5 Å²	120.5	85%	0.848	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.8	115.3	177.2	175.4	0	0	0	0	108.1	I35	I35-V37 PolarHBondContact O-N 2.73Å
38	G	70.8	Confident	67.7	Low	63 Å²	63	118.8 Å²	118.8	65%	0.649	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	115.4	15.2	173.1	0	0	0	0	0	117.1	M36 T40	M36-G38 PolarHBondContact O-N 2.83Å; G38-T40 PolarHBondContact O-N 2.73Å
39	S	64.5	Low	68.6	Low	91 Å²	91	121.6 Å²	121.6	64%	0.636	69%	0.694	S	S	*	*			trans	-72.2	72.5	162.4	65.1	0	0	0	0	109	D41	S39-D41 PolarHBondContact O-N 3.01Å
40	T	68.5	Low	69	Low	106 Å²	106	122.4 Å²	122.4	65%	0.65	69%	0.69	S	S	*	*			trans	-66.4	101.5	173.2	-78.9	0	0	0	0	107.6	G38 D42	G38-T40 PolarHBondContact O-N 2.73Å; T40-D42 HydrophobicContact CG2-CB 3.26Å; T40-D42 VanDerWaalsContact O-N 3.15Å; T40-D42 PolarHBondContact O-N 2.99Å
41	D	68.4	Low	69.1	Low	158 Å²	158	125 Å²	125	85%	0.845	70%	0.698	S	S	*	*			trans	-78.6	42.3	164.7	-117.1	-57.9	0	0	0	109.2	S39 P43	S39-D41 PolarHBondContact O-N 3.01Å; D41-P43 WeakPolarHBondContact O-CD 3.07Å
42	D	73.4	Confident	68.6	Low	70 Å²	70	125.2 Å²	125.2	37%	0.374	70%	0.699	S	S	.	*			trans	-80.3	108	178.2	-176.8	3.1	0	0	0	108.4	T40 S44 V45	T40-D42 HydrophobicContact CG2-CB 3.26Å; T40-D42 VanDerWaalsContact O-N 3.15Å; T40-D42 PolarHBondContact O-N 2.99Å; D42-S44 PolarHBondContact O-N 2.78Å; D42-S44 WeakPolarHBondContact OD1-CB 3.31Å; D42-S44 PolarHBondContact OD1-N 3.01Å; D42-S44 PolarHBondContact OD1-OG 3.06Å; D42-V45 HydrophobicContact CB-CG1 4.44Å; D42-V45 PolarHBondContact O-N 2.83Å; D42-V45 WeakPolarHBondContact O-CG2 3.48Å; D42-V45 VanDerWaalsContact O-CG2 3.31Å; D42-V45 WeakPolarHBondContact O-CG1 3.1Å
43	P	68.7	Low	68.2	Low	106 Å²	106	126.9 Å²	126.9	69%	0.688	72%	0.722	S	S	*	*	G	3₁₀ helix	trans	-63.6	-15.2	179	29.5	-36.6	0	0	0	112.3	D41 V45 F46	D41-P43 WeakPolarHBondContact O-CD 3.07Å; P43-V45 PolarHBondContact O-N 2.71Å; P43-F46 PolarHBondContact O-N 2.85Å
44	S	67.1	Low	68	Low	65 Å²	65	125.3 Å²	125.3	46%	0.455	72%	0.721	S	S	.	*	G	3₁₀ helix	trans	-70.2	-12.1	179.6	-38.1	0	0	0	0	113.3	D42 F46 S47	D42-S44 PolarHBondContact O-N 2.78Å; D42-S44 WeakPolarHBondContact OD1-CB 3.31Å; D42-S44 PolarHBondContact OD1-N 3.01Å; D42-S44 PolarHBondContact OD1-OG 3.06Å; S44-F46 PolarHBondContact O-N 3.04Å; S44-S47 VanDerWaalsContact O-CB 3.29Å; S44-S47 WeakPolarHBondContact O-CB 3.28Å; S44-S47 PolarHBondContact O-N 2.66Å; S44-S47 PolarHBondContact O-OG 2.77Å
45	V	66.8	Low	67.6	Low	99 Å²	99	123.5 Å²	123.5	60%	0.6	72%	0.723	S	S	*	*	G	3₁₀ helix	trans	-64.3	-20.2	172.6	-58.5	0	0	0	0	112.8	D42 P43	D42-V45 HydrophobicContact CB-CG1 4.44Å; D42-V45 PolarHBondContact O-N 2.83Å; D42-V45 WeakPolarHBondContact O-CG2 3.48Å; D42-V45 VanDerWaalsContact O-CG2 3.31Å; D42-V45 WeakPolarHBondContact O-CG1 3.1Å; P43-V45 PolarHBondContact O-N 2.71Å
46	F	69.1	Low	67.3	Low	173 Å²	173	122.3 Å²	122.3	76%	0.759	72%	0.722	S	S	*	*	G	3₁₀ helix	trans	-103.5	11.9	174.7	-60.3	-75	0	0	0	113	P43 S44 L48	P43-F46 PolarHBondContact O-N 2.85Å; S44-F46 PolarHBondContact O-N 3.04Å; F46-L48 VanDerWaalsContact C-N 3.35Å; F46-L48 PolarHBondContact O-N 2.8Å
47	S	69.4	Low	67	Low	90 Å²	90	120.2 Å²	120.2	63%	0.629	72%	0.718	S	S	*	*			trans	-61.2	102	169.3	-67.4	0	0	0	0	108.1	S44	S44-S47 VanDerWaalsContact O-CB 3.29Å; S44-S47 WeakPolarHBondContact O-CB 3.28Å; S44-S47 PolarHBondContact O-N 2.66Å; S44-S47 PolarHBondContact O-OG 2.77Å
48	L	69.2	Low	66.3	Low	147 Å²	147	119 Å²	119	77%	0.77	71%	0.71	S	S	*	*			trans	-57.6	139.8	169.2	-74.5	113.3	0	0	0	107.6	F46 D50	F46-L48 VanDerWaalsContact C-N 3.35Å; F46-L48 PolarHBondContact O-N 2.8Å; L48-D50 PolarHBondContact O-N 3.13Å; L48-D50 VanDerWaalsContact O-N 3.1Å
49	P	71.3	Confident	66	Low	114 Å²	114	122.7 Å²	122.7	74%	0.74	71%	0.714	S	S	*	*			trans	-52.2	126.7	173.3	23.2	-32.2	0	0	0	107.4	S51	P49-S51 PolarHBondContact O-N 2.92Å
50	D	64.2	Low	66.1	Low	157 Å²	157	125 Å²	125	84%	0.84	72%	0.72	S	S	*	*			trans	-39.6	109.1	175.3	-96.5	-72.8	0	0	0	108	L48 K52	L48-D50 PolarHBondContact O-N 3.13Å; L48-D50 VanDerWaalsContact O-N 3.1Å; D50-K52 PolarHBondContact O-N 3.1Å
51	S	61.5	Low	65.9	Low	123 Å²	123	126.5 Å²	126.5	86%	0.86	73%	0.725	S	S	*	*			trans	-72.5	87.1	175.5	-69.7	0	0	0	0	106.3	P49	P49-S51 PolarHBondContact O-N 2.92Å
52	K	51.2	Low	65.7	Low	165 Å²	165	123.8 Å²	123.8	72%	0.717	72%	0.715	S	S	*	*			trans	-126.1	124.1	172.9	-164.7	168.5	179.6	57.2	0	107.9	D50	D50-K52 PolarHBondContact O-N 3.1Å
53	P	56.8	Low	65	Low	177 Å²	177	128.7 Å²	128.7	100%	1.149	75%	0.746	S	S	*	*				-91.3	0	64.7	-17.6	33.4	0	0	0	117.2

Retrieved 53 of 53 residues in 12.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).