X5DAU1_HUMAN Loading...

Cytochrome b

AlphaFold DB , UniProt , Accession X5DAU1, Species HUMAN (Homo sapiens, Human), Gene CYTB, Length 76 aa.

						>X5DAU1_HUMAN|X5DAU1|CYTB
PILHMSKQQSMMFRPLSQSLYWLLAADLLILTWVGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKWA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	P	49.8	Very low	49.1	Very low	149 Å²	149	121.9 Å²	121.9	97%	0.968	63%	0.627	S	S	*	*				0	-51.1	0	-7.2	26.5	0	0	0	114
2	I	53.5	Low	48.9	Very low	161 Å²	161	123.6 Å²	123.6	83%	0.826	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.2	-26.3	-176.3	-66.5	161.4	0	0	0	113.2
3	L	45.8	Very low	49	Very low	124 Å²	124	125 Å²	125	65%	0.649	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.5	5.8	176.2	-72.8	168.9	0	0	0	114.2	M5	L3-M5 PolarHBondContact O-N 3.29Å
4	H	43.9	Very low	49.9	Very low	148 Å²	148	116.7 Å²	116.7	69%	0.685	59%	0.59	S	S	*	*			trans	-78.2	92	175.4	-80.6	-77.1	0	0	0	110.3	S6	H4-S6 VanDerWaalsContact C-N 3.34Å
5	M	57.1	Low	51	Low	136 Å²	136	115.4 Å²	115.4	67%	0.67	59%	0.592	S	S	*	*			trans	-92	6	171.4	-69.6	-80.6	157.4	0	0	112.7	L3	L3-M5 PolarHBondContact O-N 3.29Å
6	S	43.6	Very low	52.1	Low	35 Å²	35	112.7 Å²	112.7	25%	0.245	58%	0.579	C	S	.	*			trans	-94.4	127	-178.6	174.8	0	0	0	0	111.8	H4 Q8 R14	H4-S6 VanDerWaalsContact C-N 3.34Å; S6-Q8 PolarHBondContact O-N 2.88Å; S6-Q8 PolarHBondContact OG-N 3.33Å; S6-Q8 PolarHBondContact OG-O 3.29Å; S6-R14 PolarHBondContact OG-NH1 3.05Å
7	K	52.5	Low	53.2	Low	176 Å²	176	106.9 Å²	106.9	77%	0.765	55%	0.551	S	S	*	*	S	Bend	trans	-71.2	-8.5	171.2	-85.2	-171.4	179	177	0	114.1
8	Q	42.8	Very low	54.4	Low	58 Å²	58	105.3 Å²	105.3	27%	0.271	54%	0.541	S	S	.	.			trans	-111.5	129.7	174.4	-82.8	177.1	-49.9	0	0	111.1	S6 S10 W75	S6-Q8 PolarHBondContact O-N 2.88Å; S6-Q8 PolarHBondContact OG-N 3.33Å; S6-Q8 PolarHBondContact OG-O 3.29Å; Q8-S10 VanDerWaalsContact C-N 3.32Å; Q8-W75 HydrophobicContact CG-CZ3 4.03Å
9	Q	52.1	Low	55.8	Low	209 Å²	209	103.3 Å²	103.3	98%	0.977	54%	0.536	S	S	*	.	S	Bend	trans	-78.9	-14.6	178.1	-166.5	170.5	-13.2	0	0	112.7
10	S	45.7	Very low	57.1	Low	63 Å²	63	98.7 Å²	98.7	44%	0.441	51%	0.513	S	S	.	.			trans	-110.4	127.6	-176.9	-179.9	0	0	0	0	111.8	Q8 M12	Q8-S10 VanDerWaalsContact C-N 3.32Å; S10-M12 PolarHBondContact O-N 2.92Å; S10-M12 VanDerWaalsContact OG-CB 3.25Å; S10-M12 WeakPolarHBondContact OG-CB 3.44Å; S10-M12 PolarHBondContact OG-N 3.03Å
11	M	53.3	Low	58.2	Low	82 Å²	82	100 Å²	100	40%	0.404	51%	0.512	S	S	.	.	G	3₁₀ helix	trans	-75.9	4.5	174.5	-143.9	166.6	-147.5	0	0	112.6	F13 S17 Q18 Y21	M11-F13 PolarHBondContact O-N 2.74Å; M11-S17 WeakPolarHBondContact CE-O 3.2Å; M11-Q18 HydrophobicContact CG-CG 4.26Å; M11-Q18 WeakPolarHBondContact O-CG 3.31Å; M11-Q18 PolarHBondContact O-NE2 3.28Å; M11-Y21 HydrophobicContact SD-CD2 4.48Å; M11-Y21 HydrophobicContact SD-CG 4.34Å
12	M	47	Very low	59.8	Low	142 Å²	142	101.7 Å²	101.7	70%	0.7	50%	0.499	S	S	*	.	G	3₁₀ helix	trans	-74.3	-23	-171.8	-165.4	174	-179.6	0	0	114.1	S10	S10-M12 PolarHBondContact O-N 2.92Å; S10-M12 VanDerWaalsContact OG-CB 3.25Å; S10-M12 WeakPolarHBondContact OG-CB 3.44Å; S10-M12 PolarHBondContact OG-N 3.03Å
13	F	50.2	Low	61.4	Low	142 Å²	142	98.1 Å²	98.1	62%	0.623	48%	0.481	S	S	*	.	G	3₁₀ helix	trans	-108	18.2	-176.6	-67.4	-74.8	0	0	0	114.3	M11	M11-F13 PolarHBondContact O-N 2.74Å
14	R	62	Low	63.4	Low	9 Å²	9	93.2 Å²	93.2	3%	0.034	46%	0.456	C	S	.	.			trans	-134.4	80.7	-169.1	-66.5	-178.1	68.4	141.3	29	111.5	S6 L16 S17 Q18 S66 E69	S6-R14 PolarHBondContact OG-NH1 3.05Å; R14-L16 PolarHBondContact O-N 2.99Å; R14-S17 PolarHBondContact NE-OG 3.19Å; R14-S17 VanDerWaalsContact NE-OG 3.15Å; R14-S17 PolarHBondContact O-N 3.34Å; R14-S17 VanDerWaalsContact O-N 3.15Å; R14-Q18 PolarHBondContact O-N 3.01Å; R14-S66 PolarHBondContact NH2-O 3.34Å; R14-E69 WeakPolarHBondContact CA-OE1 3.38Å; R14-E69 VanDerWaalsContact CB-OE1 3.29Å; R14-E69 WeakPolarHBondContact CB-OE1 3.38Å; R14-E69 IonicContact CZ-OE2 3.14Å; R14-E69 IonicContact NE-OE2 2.68Å; R14-E69 PolarHBondContact NE-OE2 3.45Å; R14-E69 IonicContact NH2-OE2 2.76Å; R14-E69 PolarHBondContact NH2-OE2 3.23Å
15	P	65.6	Low	65.5	Low	97 Å²	97	87.5 Å²	87.5	63%	0.63	43%	0.434	S	S	*	.	H	α-helix	trans	-62.3	-27.6	-174.2	24.3	-32.9	0	0	0	113.2	S19	P15-S19 PolarHBondContact O-N 2.96Å; P15-S19 VanDerWaalsContact O-N 3.17Å
16	L	69.3	Low	67.2	Low	72 Å²	72	83.3 Å²	83.3	38%	0.377	42%	0.421	S	S	.	.	H	α-helix	trans	-78	-35.3	176.5	-60.2	168.9	0	0	0	111.6	R14 Q18 S19 L20 I65 E69	R14-L16 PolarHBondContact O-N 2.99Å; L16-Q18 VanDerWaalsContact C-N 3.35Å; L16-S19 PolarHBondContact O-OG 3.21Å; L16-L20 PolarHBondContact O-N 3.44Å; L16-I65 HydrophobicContact CB-CG2 3.69Å; L16-E69 WeakPolarHBondContact CA-OE1 3.29Å; L16-E69 HydrophobicContact CB-CG 4.14Å; L16-E69 VanDerWaalsContact CB-OE1 3.29Å; L16-E69 WeakPolarHBondContact CB-OE1 3.31Å; L16-E69 HydrophobicContact CD1-CG 3.92Å; L16-E69 HydrophobicContact CG-CG 4.43Å; L16-E69 PolarHBondContact N-OE1 3.4Å
17	S	71	Confident	69.4	Low	14 Å²	14	82.1 Å²	82.1	10%	0.098	41%	0.412	C	S	.	.	H	α-helix	trans	-67.4	-36	172	-68.6	0	0	0	0	111.9	M11 R14 L20 Y21 E69	M11-S17 WeakPolarHBondContact CE-O 3.2Å; R14-S17 PolarHBondContact NE-OG 3.19Å; R14-S17 VanDerWaalsContact NE-OG 3.15Å; R14-S17 PolarHBondContact O-N 3.34Å; R14-S17 VanDerWaalsContact O-N 3.15Å; S17-L20 PolarHBondContact O-N 3.24Å; S17-Y21 PolarHBondContact O-N 3.5Å; S17-E69 PolarHBondContact N-OE1 3.26Å; S17-E69 PolarHBondContact OG-OE2 2.93Å
18	Q	74.2	Confident	71.2	Confident	79 Å²	79	77.2 Å²	77.2	37%	0.369	39%	0.394	S	S	.	.	H	α-helix	trans	-64.7	-42.3	174.8	-73.9	-178.7	5.1	0	0	112.5	M11 R14 L16 L20 Y21 W22	M11-Q18 HydrophobicContact CG-CG 4.26Å; M11-Q18 WeakPolarHBondContact O-CG 3.31Å; M11-Q18 PolarHBondContact O-NE2 3.28Å; R14-Q18 PolarHBondContact O-N 3.01Å; L16-Q18 VanDerWaalsContact C-N 3.35Å; Q18-L20 VanDerWaalsContact C-N 3.34Å; Q18-L20 PolarHBondContact O-N 3.48Å; Q18-Y21 WeakPolarHBondContact O-CB 3.39Å; Q18-Y21 PolarHBondContact O-N 3.25Å; Q18-W22 VanDerWaalsContact O-CD1 3.27Å; Q18-W22 PolarHBondContact O-N 2.97Å; Q18-W22 VanDerWaalsContact O-N 3.09Å
19	S	80.8	Confident	73.5	Confident	66 Å²	66	80.5 Å²	80.5	46%	0.462	41%	0.412	S	S	.	.	H	α-helix	trans	-64.9	-38.7	177.5	66	0	0	0	0	112	P15 L16 Y21 W22 L23	P15-S19 PolarHBondContact O-N 2.96Å; P15-S19 VanDerWaalsContact O-N 3.17Å; L16-S19 PolarHBondContact O-OG 3.21Å; S19-Y21 VanDerWaalsContact C-N 3.34Å; S19-Y21 PolarHBondContact O-N 2.94Å; S19-W22 PolarHBondContact O-N 3.35Å; S19-L23 WeakPolarHBondContact O-CB 3.42Å; S19-L23 PolarHBondContact O-N 2.95Å
20	L	81.3	Confident	75.3	Confident	12 Å²	12	74.2 Å²	74.2	6%	0.063	38%	0.384	C	S	.	.	H	α-helix	trans	-60.9	-40.2	171.9	-82.2	-179	0	0	0	113.3	L16 S17 Q18 W22 L23 L24 T57 L61 I65	L16-L20 PolarHBondContact O-N 3.44Å; S17-L20 PolarHBondContact O-N 3.24Å; Q18-L20 VanDerWaalsContact C-N 3.34Å; Q18-L20 PolarHBondContact O-N 3.48Å; L20-W22 VanDerWaalsContact C-N 3.35Å; L20-L23 PolarHBondContact O-N 3.45Å; L20-L24 PolarHBondContact O-N 3.49Å; L20-T57 HydrophobicContact CD2-CG2 4.34Å; L20-L61 HydrophobicContact CD1-CB 4.3Å; L20-L61 HydrophobicContact CD2-CB 3.83Å; L20-L61 HydrophobicContact CD2-CD2 3.69Å; L20-L61 HydrophobicContact CD2-CG 4.18Å; L20-I65 HydrophobicContact CD1-CB 3.62Å; L20-I65 HydrophobicContact CD1-CD1 3.29Å; L20-I65 HydrophobicContact CD1-CG1 3.9Å; L20-I65 HydrophobicContact CD1-CG2 3.85Å; L20-I65 HydrophobicContact CD2-CD1 3.78Å; L20-I65 HydrophobicContact CG-CD1 3.49Å; L20-I65 VanDerWaalsContact CG-CD1 3.49Å
21	Y	81.3	Confident	77.3	Confident	125 Å²	125	73.3 Å²	73.3	49%	0.49	37%	0.374	S	S	.	.	H	α-helix	trans	-62.5	-44.6	177.3	176.6	-96.6	0	0	0	111.3	M11 S17 Q18 S19 L23 L24 A25	M11-Y21 HydrophobicContact SD-CD2 4.48Å; M11-Y21 HydrophobicContact SD-CG 4.34Å; S17-Y21 PolarHBondContact O-N 3.5Å; Q18-Y21 WeakPolarHBondContact O-CB 3.39Å; Q18-Y21 PolarHBondContact O-N 3.25Å; S19-Y21 VanDerWaalsContact C-N 3.34Å; S19-Y21 PolarHBondContact O-N 2.94Å; Y21-L23 VanDerWaalsContact C-N 3.32Å; Y21-L23 PolarHBondContact O-N 2.66Å; Y21-L24 PolarHBondContact O-N 3.33Å; Y21-A25 WeakPolarHBondContact O-CB 3.37Å; Y21-A25 PolarHBondContact O-N 3.09Å
22	W	83.4	Confident	79.1	Confident	185 Å²	185	74.5 Å²	74.5	70%	0.701	39%	0.386	S	S	*	.	H	α-helix	trans	-65.4	-35.6	175.1	-80	106.6	0	0	0	112.7	Q18 S19 L20 A25 A26	Q18-W22 VanDerWaalsContact O-CD1 3.27Å; Q18-W22 PolarHBondContact O-N 2.97Å; Q18-W22 VanDerWaalsContact O-N 3.09Å; S19-W22 PolarHBondContact O-N 3.35Å; L20-W22 VanDerWaalsContact C-N 3.35Å; W22-A25 PolarHBondContact O-N 3.14Å; W22-A26 WeakPolarHBondContact O-CB 3.35Å; W22-A26 PolarHBondContact O-N 2.7Å
23	L	86.2	Confident	81.1	Confident	86 Å²	86	74.6 Å²	74.6	45%	0.45	38%	0.379	S	S	.	.	H	α-helix	trans	-63.4	-44.5	173.7	-170.1	151.2	0	0	0	111.3	S19 L20 Y21 A26 D27 T57	S19-L23 WeakPolarHBondContact O-CB 3.42Å; S19-L23 PolarHBondContact O-N 2.95Å; L20-L23 PolarHBondContact O-N 3.45Å; Y21-L23 VanDerWaalsContact C-N 3.32Å; Y21-L23 PolarHBondContact O-N 2.66Å; L23-A26 PolarHBondContact O-N 3.41Å; L23-D27 WeakPolarHBondContact O-CB 3.47Å; L23-D27 PolarHBondContact O-N 2.88Å; L23-T57 HydrophobicContact CD2-CG2 4.15Å
24	L	88.1	Confident	83	Confident	22 Å²	22	68.7 Å²	68.7	12%	0.115	36%	0.355	C	S	.	.	H	α-helix	trans	-62.5	-42	174.5	-169.7	96	0	0	0	111.8	L20 Y21 A26 D27 L28 Y54 T57 I58	L20-L24 PolarHBondContact O-N 3.49Å; Y21-L24 PolarHBondContact O-N 3.33Å; L24-A26 VanDerWaalsContact C-N 3.34Å; L24-D27 PolarHBondContact O-N 3.4Å; L24-L28 WeakPolarHBondContact O-CG 3.11Å; L24-L28 PolarHBondContact O-N 3.41Å; L24-Y54 HydrophobicContact CD1-CD2 4.17Å; L24-Y54 HydrophobicContact CD1-CE2 4.06Å; L24-Y54 HydrophobicContact CG-CE2 4.47Å; L24-T57 HydrophobicContact CD1-CG2 3.98Å; L24-I58 HydrophobicContact CD1-CD1 3.9Å; L24-I58 HydrophobicContact CD1-CG1 3.49Å; L24-I58 VanDerWaalsContact CD1-CG1 3.49Å
25	A	89.3	Confident	84.2	Confident	28 Å²	28	71.4 Å²	71.4	23%	0.231	39%	0.386	C	S	.	.	H	α-helix	trans	-62.6	-42	176.9	0	0	0	0	0	111.5	Y21 W22 L28 L29	Y21-A25 WeakPolarHBondContact O-CB 3.37Å; Y21-A25 PolarHBondContact O-N 3.09Å; W22-A25 PolarHBondContact O-N 3.14Å; A25-L28 PolarHBondContact O-N 3.34Å; A25-L29 WeakPolarHBondContact O-CG 3.29Å; A25-L29 PolarHBondContact O-N 3.03Å; A25-L29 VanDerWaalsContact O-N 3.13Å
26	A	91.4	Very high	85.2	Confident	48 Å²	48	69.8 Å²	69.8	40%	0.397	39%	0.387	S	S	.	.	H	α-helix	trans	-64.4	-42	174.7	0	0	0	0	0	112.1	W22 L23 L24 L28 L29 I30	W22-A26 WeakPolarHBondContact O-CB 3.35Å; W22-A26 PolarHBondContact O-N 2.7Å; L23-A26 PolarHBondContact O-N 3.41Å; L24-A26 VanDerWaalsContact C-N 3.34Å; A26-L28 PolarHBondContact O-N 2.7Å; A26-L29 WeakPolarHBondContact O-CB 3.46Å; A26-L29 PolarHBondContact O-N 2.84Å; A26-I30 WeakPolarHBondContact O-CG1 3.37Å; A26-I30 PolarHBondContact O-N 3.23Å
27	D	90	Very high	85.9	Confident	9 Å²	9	69.7 Å²	69.7	5%	0.048	38%	0.384	C	S	.	.	H	α-helix	trans	-63.2	-40.4	178	-171.2	73.8	0	0	0	112.2	L23 L24 L29 I30 L31 Y54	L23-D27 WeakPolarHBondContact O-CB 3.47Å; L23-D27 PolarHBondContact O-N 2.88Å; L24-D27 PolarHBondContact O-N 3.4Å; D27-L29 PolarHBondContact O-N 3.09Å; D27-I30 PolarHBondContact O-N 2.68Å; D27-L31 PolarHBondContact O-N 2.95Å; D27-Y54 WeakPolarHBondContact OD2-CA 3.34Å; D27-Y54 WeakPolarHBondContact OD2-CB 3.43Å; D27-Y54 PolarHBondContact OD2-N 2.87Å
28	L	89.8	Confident	86.5	Confident	74 Å²	74	73.1 Å²	73.1	39%	0.387	41%	0.406	S	S	.	.	H	α-helix	trans	-63.2	-38.3	172.6	-77.4	174.1	0	0	0	113.1	L24 A25 A26 L31 T32 Y54	L24-L28 WeakPolarHBondContact O-CG 3.11Å; L24-L28 PolarHBondContact O-N 3.41Å; A25-L28 PolarHBondContact O-N 3.34Å; A26-L28 PolarHBondContact O-N 2.7Å; L28-L31 PolarHBondContact O-N 3.48Å; L28-T32 WeakPolarHBondContact O-CB 3.45Å; L28-T32 PolarHBondContact O-N 2.89Å; L28-T32 PolarHBondContact O-OG1 3.45Å; L28-Y54 HydrophobicContact CD2-CD2 4.14Å; L28-Y54 HydrophobicContact CD2-CE2 3.56Å; L28-Y54 HydrophobicContact CG-CD2 4.48Å; L28-Y54 HydrophobicContact CG-CE2 4.01Å
29	L	92.6	Very high	86.8	Confident	127 Å²	127	75.8 Å²	75.8	67%	0.665	43%	0.427	S	S	*	.	H	α-helix	trans	-65	-41.4	174.3	-71.5	172.4	0	0	0	111.2	A25 A26 D27 T32 W33	A25-L29 WeakPolarHBondContact O-CG 3.29Å; A25-L29 PolarHBondContact O-N 3.03Å; A25-L29 VanDerWaalsContact O-N 3.13Å; A26-L29 WeakPolarHBondContact O-CB 3.46Å; A26-L29 PolarHBondContact O-N 2.84Å; D27-L29 PolarHBondContact O-N 3.09Å; L29-T32 PolarHBondContact O-N 2.65Å; L29-W33 WeakPolarHBondContact O-CB 3.4Å; L29-W33 PolarHBondContact O-N 2.76Å
30	I	88.6	Confident	86.8	Confident	76 Å²	76	75 Å²	75	39%	0.39	42%	0.422	S	S	.	.	H	α-helix	trans	-63.9	-45.4	176.2	-66.9	165.3	0	0	0	110.6	A26 D27 T32 W33 V34 I46 A50	A26-I30 WeakPolarHBondContact O-CG1 3.37Å; A26-I30 PolarHBondContact O-N 3.23Å; D27-I30 PolarHBondContact O-N 2.68Å; I30-T32 VanDerWaalsContact C-N 3.34Å; I30-T32 PolarHBondContact O-N 3.19Å; I30-W33 PolarHBondContact O-N 3.15Å; I30-V34 HydrophobicContact CG2-CG2 4.3Å; I30-V34 WeakPolarHBondContact O-CB 3.19Å; I30-V34 VanDerWaalsContact O-CG2 3.3Å; I30-V34 WeakPolarHBondContact O-CG2 3.29Å; I30-V34 PolarHBondContact O-N 2.92Å; I30-I46 HydrophobicContact CG2-CG2 4.29Å; I30-A50 HydrophobicContact CG2-CB 4.3Å
31	L	88.2	Confident	86.8	Confident	44 Å²	44	83.7 Å²	83.7	23%	0.23	46%	0.455	C	S	.	.	H	α-helix	trans	-60.7	-42.1	176.7	-83.9	158.2	0	0	0	112.2	D27 L28 V34 G35 A50 Y54	D27-L31 PolarHBondContact O-N 2.95Å; L28-L31 PolarHBondContact O-N 3.48Å; L31-V34 PolarHBondContact O-N 3.43Å; L31-G35 PolarHBondContact O-N 3.19Å; L31-A50 HydrophobicContact CD2-CB 4.05Å; L31-A50 HydrophobicContact CG-CB 3.95Å; L31-Y54 HydrophobicContact CD1-CD2 4.26Å; L31-Y54 HydrophobicContact CD1-CG 4.3Å
32	T	90.1	Very high	86.8	Confident	107 Å²	107	80.5 Å²	80.5	66%	0.656	45%	0.45	S	S	*	.	H	α-helix	trans	-65.4	-41.8	177.1	-57.5	0	0	0	0	111	L28 L29 I30 G35 G36	L28-T32 WeakPolarHBondContact O-CB 3.45Å; L28-T32 PolarHBondContact O-N 2.89Å; L28-T32 PolarHBondContact O-OG1 3.45Å; L29-T32 PolarHBondContact O-N 2.65Å; I30-T32 VanDerWaalsContact C-N 3.34Å; I30-T32 PolarHBondContact O-N 3.19Å; T32-G35 PolarHBondContact O-N 3.13Å; T32-G36 PolarHBondContact O-N 3.26Å
33	W	88.8	Confident	86.9	Confident	145 Å²	145	73.9 Å²	73.9	55%	0.549	43%	0.426	S	S	.	.	H	α-helix	trans	-64.8	-45.8	177.1	179	65.4	0	0	0	112.1	L29 I30 G35 G36 F43	L29-W33 WeakPolarHBondContact O-CB 3.4Å; L29-W33 PolarHBondContact O-N 2.76Å; I30-W33 PolarHBondContact O-N 3.15Å; W33-G35 VanDerWaalsContact C-N 3.33Å; W33-G35 PolarHBondContact O-N 2.98Å; W33-G36 PolarHBondContact O-N 2.98Å; W33-F43 AromaticContact CH2-CE1 3.9Å; W33-F43 HydrophobicContact CH2-CE1 3.9Å; W33-F43 HydrophobicContact CZ2-CE1 4.41Å; W33-F43 HydrophobicContact CZ3-CE1 4.38Å
34	V	90.4	Very high	86.9	Confident	18 Å²	18	72.4 Å²	72.4	11%	0.109	42%	0.421	C	S	.	.	H	α-helix	trans	-65.6	-35.9	177.5	172.4	0	0	0	0	111.6	I30 L31 G36 Q37 F43 I46	I30-V34 HydrophobicContact CG2-CG2 4.3Å; I30-V34 WeakPolarHBondContact O-CB 3.19Å; I30-V34 VanDerWaalsContact O-CG2 3.3Å; I30-V34 WeakPolarHBondContact O-CG2 3.29Å; I30-V34 PolarHBondContact O-N 2.92Å; L31-V34 PolarHBondContact O-N 3.43Å; V34-G36 PolarHBondContact O-N 2.89Å; V34-Q37 PolarHBondContact O-N 3.24Å; V34-Q37 VanDerWaalsContact O-N 3.08Å; V34-F43 HydrophobicContact CG1-CB 4.49Å; V34-F43 WeakPolarHBondContact CG1-O 3.23Å; V34-I46 HydrophobicContact CG2-CB 4.36Å; V34-I46 HydrophobicContact CG2-CG2 3.79Å
35	G	87.1	Confident	87	Confident	66 Å²	66	75.3 Å²	75.3	68%	0.68	44%	0.436	S	S	*	.	H	α-helix	trans	-63.5	-22.3	177.2	0	0	0	0	0	114.4	L31 T32 W33	L31-G35 PolarHBondContact O-N 3.19Å; T32-G35 PolarHBondContact O-N 3.13Å; W33-G35 VanDerWaalsContact C-N 3.33Å; W33-G35 PolarHBondContact O-N 2.98Å
36	G	86.8	Confident	86.9	Confident	63 Å²	63	77 Å²	77	65%	0.649	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90	-8.8	174.4	0	0	0	0	0	114.8	T32 W33 V34	T32-G36 PolarHBondContact O-N 3.26Å; W33-G36 PolarHBondContact O-N 2.98Å; V34-G36 PolarHBondContact O-N 2.89Å
37	Q	85.4	Confident	86.8	Confident	69 Å²	69	75.4 Å²	75.4	32%	0.322	43%	0.428	S	S	.	.	S	Bend	trans	-87.1	150.7	177.4	-64.1	-57	-47.1	0	0	110.7	V34 F43	V34-Q37 PolarHBondContact O-N 3.24Å; V34-Q37 VanDerWaalsContact O-N 3.08Å; Q37-F43 HydrophobicContact CB-CB 4.38Å; Q37-F43 HydrophobicContact CB-CD1 4.17Å; Q37-F43 HydrophobicContact CB-CD2 4.11Å; Q37-F43 HydrophobicContact CB-CE2 4.45Å; Q37-F43 HydrophobicContact CB-CG 3.96Å; Q37-F43 HydrophobicContact CG-CD1 4.04Å; Q37-F43 HydrophobicContact CG-CE1 4.03Å; Q37-F43 HydrophobicContact CG-CG 4.33Å; Q37-F43 HydrophobicContact CG-CZ 4.31Å
38	P	83.8	Confident	86.8	Confident	87 Å²	87	80.8 Å²	80.8	57%	0.565	45%	0.453	S	S	*	.			trans	-59.8	145.5	171.3	26.2	-33.7	0	0	0	110.2	S40	P38-S40 PolarHBondContact O-N 3.37Å
39	V	79.4	Confident	86.9	Confident	134 Å²	134	81 Å²	81	81%	0.812	46%	0.457	S	S	*	.	S	Bend	trans	-74.4	70.6	178.1	-171	0	0	0	0	109.6
40	S	80.8	Confident	86.8	Confident	51 Å²	51	75.1 Å²	75.1	36%	0.357	43%	0.427	S	S	.	.			trans	-120.2	155.3	174.2	59	0	0	0	0	110.2	P38 F43 T44	P38-S40 PolarHBondContact O-N 3.37Å; S40-F43 PolarHBondContact O-N 3.17Å; S40-T44 PolarHBondContact O-N 3.22Å
41	Y	81.3	Confident	86.8	Confident	193 Å²	193	73.9 Å²	73.9	76%	0.757	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.8	127.8	167.3	-175.5	-90.3	0	0	0	108.4	I45	Y41-I45 HydrophobicContact CD2-CD1 4.02Å; Y41-I45 HydrophobicContact CE2-CD1 3.53Å
42	P	81.2	Confident	87.1	Confident	58 Å²	58	76.3 Å²	76.3	38%	0.377	44%	0.441	S	S	.	.	T	Hydrogen-bonded Turn	cis	-102.8	-0.2	15.4	38.3	-35.3	0	0	0	116.1	T44 I45 I46	P42-T44 VanDerWaalsContact C-N 3.28Å; P42-T44 PolarHBondContact O-N 2.93Å; P42-I45 PolarHBondContact O-N 3.24Å; P42-I45 VanDerWaalsContact O-N 3.17Å; P42-I46 PolarHBondContact O-N 2.98Å
43	F	85.6	Confident	87	Confident	46 Å²	46	75.3 Å²	75.3	20%	0.202	43%	0.431	C	S	.	.	H	α-helix	trans	-64.4	-29.5	-171.9	-60.8	-68.4	0	0	0	113.4	W33 V34 Q37 S40 I45 I46 G47	W33-F43 AromaticContact CH2-CE1 3.9Å; W33-F43 HydrophobicContact CH2-CE1 3.9Å; W33-F43 HydrophobicContact CZ2-CE1 4.41Å; W33-F43 HydrophobicContact CZ3-CE1 4.38Å; V34-F43 HydrophobicContact CG1-CB 4.49Å; V34-F43 WeakPolarHBondContact CG1-O 3.23Å; Q37-F43 HydrophobicContact CB-CB 4.38Å; Q37-F43 HydrophobicContact CB-CD1 4.17Å; Q37-F43 HydrophobicContact CB-CD2 4.11Å; Q37-F43 HydrophobicContact CB-CE2 4.45Å; Q37-F43 HydrophobicContact CB-CG 3.96Å; Q37-F43 HydrophobicContact CG-CD1 4.04Å; Q37-F43 HydrophobicContact CG-CE1 4.03Å; Q37-F43 HydrophobicContact CG-CG 4.33Å; Q37-F43 HydrophobicContact CG-CZ 4.31Å; S40-F43 PolarHBondContact O-N 3.17Å; F43-I45 VanDerWaalsContact C-N 3.34Å; F43-I45 PolarHBondContact O-N 3.48Å; F43-I46 HydrophobicContact CD1-CD1 4.42Å; F43-I46 PolarHBondContact O-N 3.5Å; F43-G47 PolarHBondContact O-N 2.86Å
44	T	85.9	Confident	87.1	Confident	55 Å²	55	71.6 Å²	71.6	34%	0.337	42%	0.418	S	S	.	.	H	α-helix	trans	-59.5	-42.1	174.5	-49.3	0	0	0	0	112.4	S40 P42 G47 Q48	S40-T44 PolarHBondContact O-N 3.22Å; P42-T44 VanDerWaalsContact C-N 3.28Å; P42-T44 PolarHBondContact O-N 2.93Å; T44-G47 PolarHBondContact O-N 3.08Å; T44-Q48 WeakPolarHBondContact O-CG 3.25Å; T44-Q48 PolarHBondContact O-N 3.28Å; T44-Q48 VanDerWaalsContact O-N 3.08Å
45	I	90	Very high	87	Confident	83 Å²	83	76.8 Å²	76.8	43%	0.426	44%	0.439	S	S	.	.	H	α-helix	trans	-71.3	-41.3	-179.8	-64.9	176.3	0	0	0	110.1	Y41 P42 F43 G47 Q48 V49	Y41-I45 HydrophobicContact CD2-CD1 4.02Å; Y41-I45 HydrophobicContact CE2-CD1 3.53Å; P42-I45 PolarHBondContact O-N 3.24Å; P42-I45 VanDerWaalsContact O-N 3.17Å; F43-I45 VanDerWaalsContact C-N 3.34Å; F43-I45 PolarHBondContact O-N 3.48Å; I45-G47 VanDerWaalsContact C-N 3.31Å; I45-G47 PolarHBondContact O-N 3.43Å; I45-Q48 PolarHBondContact O-N 3.46Å; I45-V49 HydrophobicContact CG2-CG2 4.3Å; I45-V49 WeakPolarHBondContact O-CG2 3.46Å; I45-V49 PolarHBondContact O-N 2.91Å
46	I	88.8	Confident	87.1	Confident	65 Å²	65	76.1 Å²	76.1	33%	0.333	42%	0.422	S	S	.	.	H	α-helix	trans	-60.6	-43.8	177	-59.3	172.3	0	0	0	110.1	I30 V34 P42 F43 Q48 V49 A50	I30-I46 HydrophobicContact CG2-CG2 4.29Å; V34-I46 HydrophobicContact CG2-CB 4.36Å; V34-I46 HydrophobicContact CG2-CG2 3.79Å; P42-I46 PolarHBondContact O-N 2.98Å; F43-I46 HydrophobicContact CD1-CD1 4.42Å; F43-I46 PolarHBondContact O-N 3.5Å; I46-Q48 PolarHBondContact O-N 3.41Å; I46-V49 PolarHBondContact O-N 3.47Å; I46-A50 VanDerWaalsContact O-CB 3.23Å; I46-A50 WeakPolarHBondContact O-CB 3.29Å; I46-A50 PolarHBondContact O-N 3.29Å
47	G	89.1	Confident	87	Confident	13 Å²	13	73.3 Å²	73.3	13%	0.134	39%	0.392	C	S	.	.	H	α-helix	trans	-63.3	-39.4	176.5	0	0	0	0	0	113.3	F43 T44 I45 S51	F43-G47 PolarHBondContact O-N 2.86Å; T44-G47 PolarHBondContact O-N 3.08Å; I45-G47 VanDerWaalsContact C-N 3.31Å; I45-G47 PolarHBondContact O-N 3.43Å; G47-S51 WeakPolarHBondContact O-CB 3.49Å; G47-S51 PolarHBondContact O-N 2.89Å; G47-S51 PolarHBondContact O-OG 3.46Å
48	Q	88.9	Confident	86.9	Confident	122 Å²	122	72 Å²	72	57%	0.57	39%	0.387	S	S	*	.	H	α-helix	trans	-65.4	-47.7	175.6	-74.7	175.9	2.1	0	0	111.8	T44 I45 I46 S51 V52	T44-Q48 WeakPolarHBondContact O-CG 3.25Å; T44-Q48 PolarHBondContact O-N 3.28Å; T44-Q48 VanDerWaalsContact O-N 3.08Å; I45-Q48 PolarHBondContact O-N 3.46Å; I46-Q48 PolarHBondContact O-N 3.41Å; Q48-S51 PolarHBondContact O-N 3.01Å; Q48-V52 WeakPolarHBondContact O-CG2 3.39Å; Q48-V52 PolarHBondContact O-N 3.31Å
49	V	92.2	Very high	86.8	Confident	79 Å²	79	72.8 Å²	72.8	48%	0.479	39%	0.386	S	S	.	.	H	α-helix	trans	-63	-44.9	178.3	173.1	0	0	0	0	110.7	I45 I46 S51 V52 L53	I45-V49 HydrophobicContact CG2-CG2 4.3Å; I45-V49 WeakPolarHBondContact O-CG2 3.46Å; I45-V49 PolarHBondContact O-N 2.91Å; I46-V49 PolarHBondContact O-N 3.47Å; V49-S51 VanDerWaalsContact C-N 3.35Å; V49-S51 PolarHBondContact O-N 3.22Å; V49-V52 PolarHBondContact O-N 3.05Å; V49-L53 HydrophobicContact CG1-CD1 3.92Å; V49-L53 HydrophobicContact CG1-CG 4.39Å; V49-L53 WeakPolarHBondContact O-CB 3.29Å; V49-L53 WeakPolarHBondContact O-CG 3.22Å; V49-L53 PolarHBondContact O-N 2.91Å
50	A	89.8	Confident	87.1	Confident	4 Å²	4	70.9 Å²	70.9	3%	0.033	37%	0.37	C	S	.	.	H	α-helix	trans	-61.7	-41.6	176.6	0	0	0	0	0	111.6	I30 L31 I46 V52 L53 Y54	I30-A50 HydrophobicContact CG2-CB 4.3Å; L31-A50 HydrophobicContact CD2-CB 4.05Å; L31-A50 HydrophobicContact CG-CB 3.95Å; I46-A50 VanDerWaalsContact O-CB 3.23Å; I46-A50 WeakPolarHBondContact O-CB 3.29Å; I46-A50 PolarHBondContact O-N 3.29Å; A50-V52 PolarHBondContact O-N 3.18Å; A50-L53 PolarHBondContact O-N 3.33Å; A50-Y54 WeakPolarHBondContact O-CB 3.4Å; A50-Y54 PolarHBondContact O-N 3.44Å
51	S	89.7	Confident	87.1	Confident	49 Å²	49	71.1 Å²	71.1	34%	0.343	37%	0.367	S	S	.	.	H	α-helix	trans	-63.1	-42.2	176.3	-59.2	0	0	0	0	112.2	G47 Q48 V49 Y54 F55	G47-S51 WeakPolarHBondContact O-CB 3.49Å; G47-S51 PolarHBondContact O-N 2.89Å; G47-S51 PolarHBondContact O-OG 3.46Å; Q48-S51 PolarHBondContact O-N 3.01Å; V49-S51 VanDerWaalsContact C-N 3.35Å; V49-S51 PolarHBondContact O-N 3.22Å; S51-Y54 WeakPolarHBondContact O-CB 3.48Å; S51-Y54 PolarHBondContact O-N 3.49Å; S51-F55 VanDerWaalsContact O-CD2 3.29Å; S51-F55 WeakPolarHBondContact O-CD2 3.37Å; S51-F55 PolarHBondContact O-N 2.76Å
52	V	93.5	Very high	87.1	Confident	95 Å²	95	65.7 Å²	65.7	58%	0.576	35%	0.35	S	S	*	.	H	α-helix	trans	-64.4	-42.2	175.5	172.5	0	0	0	0	110.7	Q48 V49 A50 T56	Q48-V52 WeakPolarHBondContact O-CG2 3.39Å; Q48-V52 PolarHBondContact O-N 3.31Å; V49-V52 PolarHBondContact O-N 3.05Å; A50-V52 PolarHBondContact O-N 3.18Å; V52-T56 VanDerWaalsContact O-CB 3.23Å; V52-T56 WeakPolarHBondContact O-CB 3.37Å; V52-T56 PolarHBondContact O-N 3.49Å; V52-T56 PolarHBondContact O-OG1 3.29Å
53	L	89.6	Confident	86.9	Confident	86 Å²	86	64.9 Å²	64.9	45%	0.45	35%	0.345	S	S	.	.	H	α-helix	trans	-62.2	-42.8	176	-76.9	171.5	0	0	0	111.8	V49 A50 T56 T57	V49-L53 HydrophobicContact CG1-CD1 3.92Å; V49-L53 HydrophobicContact CG1-CG 4.39Å; V49-L53 WeakPolarHBondContact O-CB 3.29Å; V49-L53 WeakPolarHBondContact O-CG 3.22Å; V49-L53 PolarHBondContact O-N 2.91Å; A50-L53 PolarHBondContact O-N 3.33Å; L53-T56 PolarHBondContact O-N 2.98Å; L53-T57 VanDerWaalsContact O-CB 3.25Å; L53-T57 WeakPolarHBondContact O-CB 3.34Å; L53-T57 PolarHBondContact O-N 3.15Å; L53-T57 PolarHBondContact O-OG1 3.48Å
54	Y	89.4	Confident	86.7	Confident	68 Å²	68	65.5 Å²	65.5	27%	0.267	35%	0.352	S	S	.	.	H	α-helix	trans	-55.1	-56.1	176.2	-176.4	-103	0	0	0	111.9	L24 D27 L28 L31 A50 S51 T56 T57 I58	L24-Y54 HydrophobicContact CD1-CD2 4.17Å; L24-Y54 HydrophobicContact CD1-CE2 4.06Å; L24-Y54 HydrophobicContact CG-CE2 4.47Å; D27-Y54 WeakPolarHBondContact OD2-CA 3.34Å; D27-Y54 WeakPolarHBondContact OD2-CB 3.43Å; D27-Y54 PolarHBondContact OD2-N 2.87Å; L28-Y54 HydrophobicContact CD2-CD2 4.14Å; L28-Y54 HydrophobicContact CD2-CE2 3.56Å; L28-Y54 HydrophobicContact CG-CD2 4.48Å; L28-Y54 HydrophobicContact CG-CE2 4.01Å; L31-Y54 HydrophobicContact CD1-CD2 4.26Å; L31-Y54 HydrophobicContact CD1-CG 4.3Å; A50-Y54 WeakPolarHBondContact O-CB 3.4Å; A50-Y54 PolarHBondContact O-N 3.44Å; S51-Y54 WeakPolarHBondContact O-CB 3.48Å; S51-Y54 PolarHBondContact O-N 3.49Å; Y54-T56 PolarHBondContact O-N 3.27Å; Y54-T57 PolarHBondContact O-N 3.37Å; Y54-I58 HydrophobicContact CD1-CD1 4.24Å; Y54-I58 HydrophobicContact CD2-CD1 4.38Å; Y54-I58 HydrophobicContact CE1-CD1 3.6Å; Y54-I58 HydrophobicContact CE2-CD1 3.75Å; Y54-I58 PolarHBondContact O-N 3.27Å; Y54-I58 VanDerWaalsContact O-N 3.13Å; Y54-I58 WeakPolarHBondContact OH-CD1 3.29Å
55	F	88.3	Confident	86.4	Confident	127 Å²	127	64.3 Å²	64.3	56%	0.557	34%	0.343	S	S	*	.	H	α-helix	trans	-65.5	-40.8	-178.9	-80.9	-71.6	0	0	0	112.2	S51 T57 I58 L59	S51-F55 VanDerWaalsContact O-CD2 3.29Å; S51-F55 WeakPolarHBondContact O-CD2 3.37Å; S51-F55 PolarHBondContact O-N 2.76Å; F55-T57 VanDerWaalsContact C-N 3.29Å; F55-T57 PolarHBondContact O-N 3.4Å; F55-I58 PolarHBondContact O-N 2.93Å; F55-L59 HydrophobicContact CD1-CD1 4.35Å; F55-L59 VanDerWaalsContact O-CB 3.29Å; F55-L59 WeakPolarHBondContact O-CB 3.43Å; F55-L59 PolarHBondContact O-N 2.81Å
56	T	89.5	Confident	85.6	Confident	51 Å²	51	61 Å²	61	31%	0.313	33%	0.327	S	S	.	.	H	α-helix	trans	-62.6	-39.2	177	-58.7	0	0	0	0	111.1	V52 L53 Y54 I60 L61	V52-T56 VanDerWaalsContact O-CB 3.23Å; V52-T56 WeakPolarHBondContact O-CB 3.37Å; V52-T56 PolarHBondContact O-N 3.49Å; V52-T56 PolarHBondContact O-OG1 3.29Å; L53-T56 PolarHBondContact O-N 2.98Å; Y54-T56 PolarHBondContact O-N 3.27Å; T56-I60 HydrophobicContact CG2-CB 4.48Å; T56-I60 HydrophobicContact CG2-CD1 4.35Å; T56-I60 WeakPolarHBondContact O-CA 3.43Å; T56-I60 WeakPolarHBondContact O-CB 3.21Å; T56-I60 PolarHBondContact O-N 3.5Å; T56-L61 HydrophobicContact CG2-CD1 4.2Å; T56-L61 PolarHBondContact O-N 2.91Å; T56-L61 VanDerWaalsContact O-N 3.09Å
57	T	84.6	Confident	85	Confident	4 Å²	4	62.6 Å²	62.6	3%	0.025	34%	0.336	C	S	.	.	I	π-helix	trans	-65.7	-46.3	-179.4	-60.1	0	0	0	0	111.4	L20 L23 L24 L53 Y54 F55 L61 M62	L20-T57 HydrophobicContact CD2-CG2 4.34Å; L23-T57 HydrophobicContact CD2-CG2 4.15Å; L24-T57 HydrophobicContact CD1-CG2 3.98Å; L53-T57 VanDerWaalsContact O-CB 3.25Å; L53-T57 WeakPolarHBondContact O-CB 3.34Å; L53-T57 PolarHBondContact O-N 3.15Å; L53-T57 PolarHBondContact O-OG1 3.48Å; Y54-T57 PolarHBondContact O-N 3.37Å; F55-T57 VanDerWaalsContact C-N 3.29Å; F55-T57 PolarHBondContact O-N 3.4Å; T57-L61 WeakPolarHBondContact O-CB 3.37Å; T57-L61 PolarHBondContact O-N 2.91Å; T57-M62 PolarHBondContact O-N 3.17Å
58	I	83.3	Confident	84.6	Confident	42 Å²	42	66 Å²	66	22%	0.215	35%	0.35	C	S	.	.	I	π-helix	trans	-73.5	-46.1	-179.3	-64.6	179.2	0	0	0	112.2	L24 Y54 F55 M62	L24-I58 HydrophobicContact CD1-CD1 3.9Å; L24-I58 HydrophobicContact CD1-CG1 3.49Å; L24-I58 VanDerWaalsContact CD1-CG1 3.49Å; Y54-I58 HydrophobicContact CD1-CD1 4.24Å; Y54-I58 HydrophobicContact CD2-CD1 4.38Å; Y54-I58 HydrophobicContact CE1-CD1 3.6Å; Y54-I58 HydrophobicContact CE2-CD1 3.75Å; Y54-I58 PolarHBondContact O-N 3.27Å; Y54-I58 VanDerWaalsContact O-N 3.13Å; Y54-I58 WeakPolarHBondContact OH-CD1 3.29Å; F55-I58 PolarHBondContact O-N 2.93Å; I58-M62 WeakPolarHBondContact O-CB 3.39Å
59	L	82.9	Confident	83.9	Confident	103 Å²	103	60.5 Å²	60.5	54%	0.539	33%	0.325	S	S	.	.	I	π-helix	trans	-81.9	-33.4	-172.4	-70.4	171.7	0	0	0	113.2	F55 P63	F55-L59 HydrophobicContact CD1-CD1 4.35Å; F55-L59 VanDerWaalsContact O-CB 3.29Å; F55-L59 WeakPolarHBondContact O-CB 3.43Å; F55-L59 PolarHBondContact O-N 2.81Å; L59-P63 WeakPolarHBondContact O-CD 3.36Å; L59-P63 WeakPolarHBondContact O-CG 3.46Å
60	I	84.1	Confident	82.9	Confident	95 Å²	95	58.6 Å²	58.6	49%	0.487	31%	0.312	S	S	.	.	I	π-helix	trans	-113.4	-52.3	-170.7	-54.8	-179.8	0	0	0	111.4	T56 P63 T64	T56-I60 HydrophobicContact CG2-CB 4.48Å; T56-I60 HydrophobicContact CG2-CD1 4.35Å; T56-I60 WeakPolarHBondContact O-CA 3.43Å; T56-I60 WeakPolarHBondContact O-CB 3.21Å; T56-I60 PolarHBondContact O-N 3.5Å; I60-P63 VanDerWaalsContact O-CD 3.29Å; I60-P63 WeakPolarHBondContact O-CD 3.23Å; I60-P63 WeakPolarHBondContact O-CG 3.49Å; I60-T64 HydrophobicContact CG2-CG2 4.34Å; I60-T64 WeakPolarHBondContact O-CB 3.3Å; I60-T64 WeakPolarHBondContact O-CG2 3.34Å; I60-T64 PolarHBondContact O-N 2.98Å; I60-T64 VanDerWaalsContact O-N 3.14Å; I60-T64 PolarHBondContact O-OG1 3.2Å
61	L	81.1	Confident	82	Confident	56 Å²	56	66.4 Å²	66.4	29%	0.293	35%	0.345	S	S	.	.	I	π-helix	trans	-68.6	-41.7	-175.7	-91.7	57.1	0	0	0	112.5	L20 T56 T57 T64 I65	L20-L61 HydrophobicContact CD1-CB 4.3Å; L20-L61 HydrophobicContact CD2-CB 3.83Å; L20-L61 HydrophobicContact CD2-CD2 3.69Å; L20-L61 HydrophobicContact CD2-CG 4.18Å; T56-L61 HydrophobicContact CG2-CD1 4.2Å; T56-L61 PolarHBondContact O-N 2.91Å; T56-L61 VanDerWaalsContact O-N 3.09Å; T57-L61 WeakPolarHBondContact O-CB 3.37Å; T57-L61 PolarHBondContact O-N 2.91Å; L61-T64 VanDerWaalsContact CA-OG1 3.31Å; L61-T64 WeakPolarHBondContact CA-OG1 3.42Å; L61-T64 PolarHBondContact O-N 3.34Å; L61-T64 PolarHBondContact O-OG1 3.49Å; L61-I65 WeakPolarHBondContact O-CB 3.46Å; L61-I65 PolarHBondContact O-N 2.93Å
62	M	81.5	Confident	81.1	Confident	78 Å²	78	70.6 Å²	70.6	38%	0.384	36%	0.361	S	S	.	.	H	α-helix	trans	-55.7	-54.7	176.9	-87.3	-167	172.5	0	0	112.9	T57 I58 S66	T57-M62 PolarHBondContact O-N 3.17Å; I58-M62 WeakPolarHBondContact O-CB 3.39Å; M62-S66 WeakPolarHBondContact O-CB 3.45Å; M62-S66 PolarHBondContact O-N 3.31Å
63	P	77.1	Confident	80.1	Confident	42 Å²	42	70.5 Å²	70.5	27%	0.273	36%	0.356	S	S	.	.	H	α-helix	trans	-67.8	-37.4	179.9	23.3	-31.7	0	0	0	112.6	L59 I60 S66 L67	L59-P63 WeakPolarHBondContact O-CD 3.36Å; L59-P63 WeakPolarHBondContact O-CG 3.46Å; I60-P63 VanDerWaalsContact O-CD 3.29Å; I60-P63 WeakPolarHBondContact O-CD 3.23Å; I60-P63 WeakPolarHBondContact O-CG 3.49Å; P63-S66 WeakPolarHBondContact CA-OG 3.25Å; P63-S66 WeakPolarHBondContact O-CB 3.43Å; P63-S66 PolarHBondContact O-N 3.32Å; P63-S66 PolarHBondContact O-OG 3.43Å; P63-L67 VanDerWaalsContact O-CG 3.31Å; P63-L67 WeakPolarHBondContact O-CG 3.48Å; P63-L67 PolarHBondContact O-N 3.49Å
64	T	81.1	Confident	78.6	Confident	59 Å²	59	75.3 Å²	75.3	36%	0.362	37%	0.374	S	S	.	.	H	α-helix	trans	-67	-48.2	-178.8	52	0	0	0	0	112.5	I60 L61 S66 L67 I68	I60-T64 HydrophobicContact CG2-CG2 4.34Å; I60-T64 WeakPolarHBondContact O-CB 3.3Å; I60-T64 WeakPolarHBondContact O-CG2 3.34Å; I60-T64 PolarHBondContact O-N 2.98Å; I60-T64 VanDerWaalsContact O-N 3.14Å; I60-T64 PolarHBondContact O-OG1 3.2Å; L61-T64 VanDerWaalsContact CA-OG1 3.31Å; L61-T64 WeakPolarHBondContact CA-OG1 3.42Å; L61-T64 PolarHBondContact O-N 3.34Å; L61-T64 PolarHBondContact O-OG1 3.49Å; T64-S66 PolarHBondContact O-N 2.92Å; T64-L67 PolarHBondContact O-N 3.09Å; T64-I68 VanDerWaalsContact O-CG1 3.29Å; T64-I68 WeakPolarHBondContact O-CG1 3.47Å; T64-I68 PolarHBondContact O-N 2.97Å
65	I	80.7	Confident	77.1	Confident	30 Å²	30	79.6 Å²	79.6	15%	0.154	39%	0.39	C	S	.	.	H	α-helix	trans	-64.7	-32.2	173.6	-74.1	176.4	0	0	0	110.1	L16 L20 L61 L67 I68 E69	L16-I65 HydrophobicContact CB-CG2 3.69Å; L20-I65 HydrophobicContact CD1-CB 3.62Å; L20-I65 HydrophobicContact CD1-CD1 3.29Å; L20-I65 HydrophobicContact CD1-CG1 3.9Å; L20-I65 HydrophobicContact CD1-CG2 3.85Å; L20-I65 HydrophobicContact CD2-CD1 3.78Å; L20-I65 HydrophobicContact CG-CD1 3.49Å; L20-I65 VanDerWaalsContact CG-CD1 3.49Å; L61-I65 WeakPolarHBondContact O-CB 3.46Å; L61-I65 PolarHBondContact O-N 2.93Å; I65-L67 VanDerWaalsContact C-N 3.28Å; I65-L67 PolarHBondContact O-N 2.91Å; I65-I68 PolarHBondContact O-N 3.46Å; I65-E69 HydrophobicContact CG2-CG 4.48Å; I65-E69 PolarHBondContact O-N 2.76Å
66	S	73.4	Confident	75	Confident	12 Å²	12	81 Å²	81	8%	0.084	43%	0.425	C	S	.	.	H	α-helix	trans	-59	-42.5	175.8	85.2	0	0	0	0	112.6	R14 M62 P63 T64 N70	R14-S66 PolarHBondContact NH2-O 3.34Å; M62-S66 WeakPolarHBondContact O-CB 3.45Å; M62-S66 PolarHBondContact O-N 3.31Å; P63-S66 WeakPolarHBondContact CA-OG 3.25Å; P63-S66 WeakPolarHBondContact O-CB 3.43Å; P63-S66 PolarHBondContact O-N 3.32Å; P63-S66 PolarHBondContact O-OG 3.43Å; T64-S66 PolarHBondContact O-N 2.92Å; S66-N70 PolarHBondContact O-N 3.39Å; S66-N70 PolarHBondContact O-ND2 3.31Å; S66-N70 PolarHBondContact O-OD1 3.35Å
67	L	76.3	Confident	74.3	Confident	99 Å²	99	82.5 Å²	82.5	52%	0.518	43%	0.43	S	S	.	.	H	α-helix	trans	-74	-39.2	178.9	-68.9	167.5	0	0	0	112.7	P63 T64 I65 N70 K71	P63-L67 VanDerWaalsContact O-CG 3.31Å; P63-L67 WeakPolarHBondContact O-CG 3.48Å; P63-L67 PolarHBondContact O-N 3.49Å; T64-L67 PolarHBondContact O-N 3.09Å; I65-L67 VanDerWaalsContact C-N 3.28Å; I65-L67 PolarHBondContact O-N 2.91Å; L67-N70 PolarHBondContact O-N 2.88Å; L67-K71 WeakPolarHBondContact O-CG 3.41Å; L67-K71 PolarHBondContact O-N 3.49Å
68	I	80	Confident	73.8	Confident	85 Å²	85	86.6 Å²	86.6	44%	0.436	45%	0.452	S	S	.	.	H	α-helix	trans	-63.2	-47.8	179.3	-69.8	164.3	0	0	0	110.4	T64 I65 N70 K71 M72	T64-I68 VanDerWaalsContact O-CG1 3.29Å; T64-I68 WeakPolarHBondContact O-CG1 3.47Å; T64-I68 PolarHBondContact O-N 2.97Å; I65-I68 PolarHBondContact O-N 3.46Å; I68-N70 PolarHBondContact O-N 3.13Å; I68-K71 PolarHBondContact O-N 3.27Å; I68-M72 HydrophobicContact CG2-SD 4.35Å; I68-M72 PolarHBondContact O-N 3.45Å
69	E	73.4	Confident	73.2	Confident	7 Å²	7	89.1 Å²	89.1	3%	0.033	47%	0.465	C	S	.	.	H	α-helix	trans	-66.9	-36.4	178.1	-79.5	177	140.7	0	0	111.9	R14 L16 S17 I65 K71 M72 L73	R14-E69 WeakPolarHBondContact CA-OE1 3.38Å; R14-E69 VanDerWaalsContact CB-OE1 3.29Å; R14-E69 WeakPolarHBondContact CB-OE1 3.38Å; R14-E69 IonicContact CZ-OE2 3.14Å; R14-E69 IonicContact NE-OE2 2.68Å; R14-E69 PolarHBondContact NE-OE2 3.45Å; R14-E69 IonicContact NH2-OE2 2.76Å; R14-E69 PolarHBondContact NH2-OE2 3.23Å; L16-E69 WeakPolarHBondContact CA-OE1 3.29Å; L16-E69 HydrophobicContact CB-CG 4.14Å; L16-E69 VanDerWaalsContact CB-OE1 3.29Å; L16-E69 WeakPolarHBondContact CB-OE1 3.31Å; L16-E69 HydrophobicContact CD1-CG 3.92Å; L16-E69 HydrophobicContact CG-CG 4.43Å; L16-E69 PolarHBondContact N-OE1 3.4Å; S17-E69 PolarHBondContact N-OE1 3.26Å; S17-E69 PolarHBondContact OG-OE2 2.93Å; I65-E69 HydrophobicContact CG2-CG 4.48Å; I65-E69 PolarHBondContact O-N 2.76Å; E69-K71 VanDerWaalsContact C-N 3.32Å; E69-K71 PolarHBondContact O-N 3.45Å; E69-M72 PolarHBondContact O-N 2.9Å; E69-L73 WeakPolarHBondContact O-CB 3.47Å; E69-L73 WeakPolarHBondContact O-CG 3.47Å; E69-L73 PolarHBondContact O-N 2.86Å
70	N	71.4	Confident	72.7	Confident	38 Å²	38	88.3 Å²	88.3	20%	0.203	46%	0.461	C	S	.	.	H	α-helix	trans	-60.1	-43.1	172.7	-72.4	-10.2	0	0	0	111.4	S66 L67 I68 L73 K74 W75	S66-N70 PolarHBondContact O-N 3.39Å; S66-N70 PolarHBondContact O-ND2 3.31Å; S66-N70 PolarHBondContact O-OD1 3.35Å; L67-N70 PolarHBondContact O-N 2.88Å; I68-N70 PolarHBondContact O-N 3.13Å; N70-L73 PolarHBondContact O-N 3.49Å; N70-K74 PolarHBondContact O-N 3.08Å; N70-W75 PolarHBondContact O-N 3.24Å
71	K	72.3	Confident	71.9	Confident	168 Å²	168	87.9 Å²	87.9	73%	0.73	46%	0.459	S	S	*	.	H	α-helix	trans	-66.1	-41.2	175.9	-76.2	178.5	178.5	-71.8	0	112.3	L67 I68 E69 K74	L67-K71 WeakPolarHBondContact O-CG 3.41Å; L67-K71 PolarHBondContact O-N 3.49Å; I68-K71 PolarHBondContact O-N 3.27Å; E69-K71 VanDerWaalsContact C-N 3.32Å; E69-K71 PolarHBondContact O-N 3.45Å; K71-K74 PolarHBondContact O-N 3.47Å
72	M	70.5	Confident	71.3	Confident	138 Å²	138	90 Å²	90	68%	0.68	47%	0.47	S	S	*	.	H	α-helix	trans	-64.3	-38.5	177.2	-80.5	-176.7	64.3	0	0	112.6	I68 E69 K74	I68-M72 HydrophobicContact CG2-SD 4.35Å; I68-M72 PolarHBondContact O-N 3.45Å; E69-M72 PolarHBondContact O-N 2.9Å; M72-K74 PolarHBondContact O-N 3.48Å
73	L	70.9	Confident	70.6	Confident	92 Å²	92	90.9 Å²	90.9	48%	0.482	48%	0.476	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.7	5.4	179.6	-67.7	171	0	0	0	113.5	E69 N70 W75	E69-L73 WeakPolarHBondContact O-CB 3.47Å; E69-L73 WeakPolarHBondContact O-CG 3.47Å; E69-L73 PolarHBondContact O-N 2.86Å; N70-L73 PolarHBondContact O-N 3.49Å; L73-W75 PolarHBondContact O-N 2.8Å; L73-W75 VanDerWaalsContact O-N 3.09Å
74	K	58.7	Low	70.1	Confident	188 Å²	188	94.6 Å²	94.6	82%	0.817	49%	0.492	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.6	31	178.6	-69.5	-175.7	176.8	179.2	0	114.2	N70 K71 M72 A76	N70-K74 PolarHBondContact O-N 3.08Å; K71-K74 PolarHBondContact O-N 3.47Å; M72-K74 PolarHBondContact O-N 3.48Å; K74-A76 PolarHBondContact O-N 2.96Å
75	W	57.6	Low	69.2	Low	157 Å²	157	97.6 Å²	97.6	60%	0.595	50%	0.502	S	S	*	.			trans	-85.7	100.1	162	-83.3	-1.9	0	0	0	107.8	Q8 N70 L73	Q8-W75 HydrophobicContact CG-CZ3 4.03Å; N70-W75 PolarHBondContact O-N 3.24Å; L73-W75 PolarHBondContact O-N 2.8Å; L73-W75 VanDerWaalsContact O-N 3.09Å
76	A	45.2	Very low	68.1	Low	157 Å²	157	103.7 Å²	103.7	100%	1.298	53%	0.534	S	S	*	.			trans	-62	0	165.1	0	0	0	0	0	110.9	K74	K74-A76 PolarHBondContact O-N 2.96Å

Retrieved 76 of 76 residues in 99.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).