X5DP70_HUMAN Loading...

Dopamine receptor D3 isoform B

AlphaFold DB , UniProt , Accession X5DP70, Species HUMAN (Homo sapiens, Human), Gene DRD3, Length 134 aa.

						>X5DP70_HUMAN|X5DP70|DRD3
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVHCSGHARSLPAWHGTELLSARGPHDHGRLGTGLCCVLPSSVWL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.8	Low	54.6	Low	251 Å²	251	117.4 Å²	117.4	100%	1.236	66%	0.663	S	S	*	*				0	46.3	0	-54.8	-179	-143.7	0	0	111.6
2	A	49	Very low	54.7	Low	78 Å²	78	117.6 Å²	117.6	65%	0.645	66%	0.661	S	S	*	*			trans	-111.6	9.1	-171.4	0	0	0	0	0	114.3
3	S	54	Low	54.5	Low	101 Å²	101	123.2 Å²	123.2	71%	0.706	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.2	-12.2	-163.9	-153.8	0	0	0	0	115.5
4	L	56.9	Low	54.6	Low	151 Å²	151	122 Å²	122	79%	0.791	67%	0.666	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.4	-31.3	-175	-75.9	167.2	0	0	0	113.8	S8	L4-S8 PolarHBondContact O-N 3.08Å; L4-S8 VanDerWaalsContact O-N 3.14Å
5	S	57	Low	54.8	Low	86 Å²	86	120.7 Å²	120.7	60%	0.601	67%	0.668	S	S	*	*	H	α-helix	trans	-72.2	-33.3	176.7	53.6	0	0	0	0	113.1	S8 S9	S5-S8 PolarHBondContact O-N 3.05Å; S5-S9 PolarHBondContact O-N 3.43Å; S5-S9 VanDerWaalsContact O-N 3.08Å; S5-S9 PolarHBondContact O-OG 3.17Å
6	Q	54.2	Low	54.5	Low	142 Å²	142	116.5 Å²	116.5	66%	0.664	66%	0.661	S	S	*	*	H	α-helix	trans	-69.9	-29.8	176.3	-76.6	-72.9	-33.8	0	0	113.1	S9 H10	Q6-S9 PolarHBondContact O-OG 3.33Å; Q6-H10 PolarHBondContact O-N 3.34Å
7	L	55.6	Low	54.4	Low	110 Å²	110	115.9 Å²	115.9	58%	0.576	67%	0.674	S	S	*	*	H	α-helix	trans	-82.1	-34.2	175.9	-151.4	74.6	0	0	0	111.5	H10 L11	L7-H10 PolarHBondContact O-N 2.73Å; L7-L11 WeakPolarHBondContact O-CG 3.34Å; L7-L11 PolarHBondContact O-N 3.11Å
8	S	57	Low	54	Low	77 Å²	77	118.4 Å²	118.4	54%	0.538	68%	0.678	S	S	.	*	H	α-helix	trans	-67	-36.1	175.2	-172.4	0	0	0	0	112.6	L4 S5 N12	L4-S8 PolarHBondContact O-N 3.08Å; L4-S8 VanDerWaalsContact O-N 3.14Å; S5-S8 PolarHBondContact O-N 3.05Å; S8-N12 VanDerWaalsContact O-CB 3.29Å; S8-N12 WeakPolarHBondContact O-CB 3.36Å; S8-N12 PolarHBondContact O-N 3.43Å; S8-N12 VanDerWaalsContact O-N 3.09Å
9	S	55.8	Low	54.1	Low	41 Å²	41	120.6 Å²	120.6	29%	0.287	69%	0.687	S	S	.	*	H	α-helix	trans	-65.6	-48.1	173.5	55.3	0	0	0	0	110	S5 Q6 L11 N12 Y13	S5-S9 PolarHBondContact O-N 3.43Å; S5-S9 VanDerWaalsContact O-N 3.08Å; S5-S9 PolarHBondContact O-OG 3.17Å; Q6-S9 PolarHBondContact O-OG 3.33Å; S9-L11 VanDerWaalsContact C-N 3.3Å; S9-L11 PolarHBondContact O-N 3.01Å; S9-N12 PolarHBondContact O-N 3.12Å; S9-N12 VanDerWaalsContact O-N 3.12Å; S9-Y13 WeakPolarHBondContact O-CD2 3.2Å; S9-Y13 WeakPolarHBondContact O-CE2 3.39Å; S9-Y13 PolarHBondContact O-N 3.33Å
10	H	51.4	Low	53.9	Low	142 Å²	142	118.3 Å²	118.3	66%	0.657	68%	0.679	S	S	*	*	H	α-helix	trans	-60.4	-34.3	-179.5	-154.5	-89.3	0	0	0	114	Q6 L7 T14	Q6-H10 PolarHBondContact O-N 3.34Å; L7-H10 PolarHBondContact O-N 2.73Å; H10-T14 PolarHBondContact O-OG1 3.11Å
11	L	57	Low	53.7	Low	112 Å²	112	119.7 Å²	119.7	59%	0.586	69%	0.69	S	S	*	*	H	α-helix	trans	-81.2	-26.3	176.4	-70.8	171.4	0	0	0	113.6	L7 S9 Y13 T14	L7-L11 WeakPolarHBondContact O-CG 3.34Å; L7-L11 PolarHBondContact O-N 3.11Å; S9-L11 VanDerWaalsContact C-N 3.3Å; S9-L11 PolarHBondContact O-N 3.01Å; L11-Y13 PolarHBondContact O-N 3.27Å; L11-T14 PolarHBondContact O-N 2.93Å; L11-T14 PolarHBondContact O-OG1 3.5Å
12	N	55.5	Low	53.6	Low	120 Å²	120	111 Å²	111	64%	0.642	66%	0.664	S	S	*	*	H	α-helix	trans	-75.5	-9.5	176.8	-159.1	30.9	0	0	0	113.1	S8 S9	S8-N12 VanDerWaalsContact O-CB 3.29Å; S8-N12 WeakPolarHBondContact O-CB 3.36Å; S8-N12 PolarHBondContact O-N 3.43Å; S8-N12 VanDerWaalsContact O-N 3.09Å; S9-N12 PolarHBondContact O-N 3.12Å; S9-N12 VanDerWaalsContact O-N 3.12Å
13	Y	52.5	Low	53.7	Low	191 Å²	191	110.8 Å²	110.8	75%	0.749	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.4	-6.1	173.2	-63.3	-66.6	0	0	0	113.8	S9 L11	S9-Y13 WeakPolarHBondContact O-CD2 3.2Å; S9-Y13 WeakPolarHBondContact O-CE2 3.39Å; S9-Y13 PolarHBondContact O-N 3.33Å; L11-Y13 PolarHBondContact O-N 3.27Å
14	T	56.3	Low	53.8	Low	106 Å²	106	110.6 Å²	110.6	65%	0.65	66%	0.661	S	S	*	*	S	Bend	trans	-102.7	-0.4	-176.2	12.5	0	0	0	0	114.7	H10 L11 G16	H10-T14 PolarHBondContact O-OG1 3.11Å; L11-T14 PolarHBondContact O-N 2.93Å; L11-T14 PolarHBondContact O-OG1 3.5Å; T14-G16 VanDerWaalsContact C-N 3.29Å; T14-G16 PolarHBondContact O-N 3.35Å
15	C	57.2	Low	53.5	Low	103 Å²	103	112.2 Å²	112.2	70%	0.696	67%	0.665	S	S	*	*			trans	-90.6	66.2	169.8	58	0	0	0	0	111.1
16	G	49.8	Very low	53.3	Low	53 Å²	53	109.7 Å²	109.7	55%	0.546	65%	0.649	S	S	.	*			trans	-141.9	62.4	170.1	0	0	0	0	0	108.2	T14 E18	T14-G16 VanDerWaalsContact C-N 3.29Å; T14-G16 PolarHBondContact O-N 3.35Å; G16-E18 PolarHBondContact O-N 2.78Å
17	A	53	Low	53.4	Low	107 Å²	107	112.6 Å²	112.6	88%	0.884	65%	0.654	S	S	*	*			trans	-66.7	69.3	163.8	0	0	0	0	0	108.4	N19	A17-N19 VanDerWaalsContact C-N 3.34Å; A17-N19 PolarHBondContact O-N 3.45Å; A17-N19 VanDerWaalsContact O-N 3.12Å
18	E	46.7	Very low	53.6	Low	161 Å²	161	111 Å²	111	75%	0.752	65%	0.651	S	S	*	*			trans	-79.6	94.7	168.5	-55.5	-160.1	133.1	0	0	106.1	G16 S20	G16-E18 PolarHBondContact O-N 2.78Å; E18-S20 PolarHBondContact O-N 2.94Å
19	N	56.6	Low	53.7	Low	159 Å²	159	114.1 Å²	114.1	85%	0.85	66%	0.656	S	S	*	*			trans	-62.9	67.3	167.1	-168.9	21.2	0	0	0	110.1	A17	A17-N19 VanDerWaalsContact C-N 3.34Å; A17-N19 PolarHBondContact O-N 3.45Å; A17-N19 VanDerWaalsContact O-N 3.12Å
20	S	49.9	Very low	54.5	Low	74 Å²	74	113.7 Å²	113.7	52%	0.517	66%	0.655	S	S	.	*			trans	-143.4	38	-175.2	-62.9	0	0	0	0	110.2	E18 G22	E18-S20 PolarHBondContact O-N 2.94Å; S20-G22 PolarHBondContact O-N 3.49Å
21	T	48.7	Very low	55.7	Low	148 Å²	148	113.9 Å²	113.9	91%	0.908	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68	4	169.9	-32.3	0	0	0	0	112.7
22	G	52.1	Low	56.4	Low	68 Å²	68	115.5 Å²	115.5	70%	0.701	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-122.3	-1.6	-168.7	0	0	0	0	0	118.4	S20	S20-G22 PolarHBondContact O-N 3.49Å
23	A	51	Low	57.5	Low	74 Å²	74	112.4 Å²	112.4	61%	0.612	64%	0.641	S	S	*	*	S	Bend	trans	-129.3	-25.7	-164.6	0	0	0	0	0	118.1
24	S	55	Low	58.7	Low	97 Å²	97	109.1 Å²	109.1	68%	0.678	64%	0.636	S	S	*	*	S	Bend	trans	-118.1	-24.8	-164.2	47.7	0	0	0	0	116.9	A26	S24-A26 VanDerWaalsContact C-N 3.33Å
25	Q	50.6	Low	59.6	Low	186 Å²	186	106 Å²	106	87%	0.869	62%	0.619	S	S	*	*	S	Bend	trans	-93.4	2.7	173.4	-156.7	158.4	3.6	0	0	113.1
26	A	53.6	Low	60.3	Low	33 Å²	33	108.5 Å²	108.5	27%	0.273	62%	0.615	S	S	.	*			trans	-99.1	0.9	-162.5	0	0	0	0	0	114.4	S24 A30	S24-A26 VanDerWaalsContact C-N 3.33Å; A26-A30 HydrophobicContact CB-CB 4.08Å; A26-A30 VanDerWaalsContact O-CA 3.28Å; A26-A30 WeakPolarHBondContact O-CA 3.06Å; A26-A30 WeakPolarHBondContact O-CB 3.35Å; A26-A30 PolarHBondContact O-N 3.41Å
27	R	56.7	Low	61.6	Low	202 Å²	202	109.4 Å²	109.4	76%	0.762	61%	0.612	S	S	*	*	H	α-helix	trans	-68.8	-44.8	-166.9	-54.5	-176.5	95.2	110.2	-2.7	115.2	Y31	R27-Y31 WeakPolarHBondContact O-CB 3.38Å; R27-Y31 PolarHBondContact O-N 2.9Å
28	P	59	Low	62.5	Low	78 Å²	78	107 Å²	107	51%	0.506	59%	0.592	S	S	.	*	H	α-helix	trans	-77.9	-41.8	176.4	27.4	-30.2	0	0	0	112.2	Y31 Y32	P28-Y31 PolarHBondContact O-N 3.32Å; P28-Y32 WeakPolarHBondContact O-CD2 3.28Å; P28-Y32 PolarHBondContact O-N 3.37Å
29	H	60.1	Low	63.8	Low	142 Å²	142	101.7 Å²	101.7	66%	0.657	57%	0.569	S	S	*	*	H	α-helix	trans	-75.4	-33.9	-178.5	-63	-61.5	0	0	0	113.5	Y31 Y32 A33	H29-Y31 VanDerWaalsContact C-N 3.31Å; H29-Y32 PolarHBondContact O-N 2.83Å; H29-A33 WeakPolarHBondContact O-CB 3.25Å; H29-A33 PolarHBondContact O-N 3.1Å
30	A	72.1	Confident	64.6	Low	32 Å²	32	99 Å²	99	26%	0.264	55%	0.553	S	S	.	*	H	α-helix	trans	-71.8	-27.6	173.4	0	0	0	0	0	111.7	A26 Y32 A33 L34	A26-A30 HydrophobicContact CB-CB 4.08Å; A26-A30 VanDerWaalsContact O-CA 3.28Å; A26-A30 WeakPolarHBondContact O-CA 3.06Å; A26-A30 WeakPolarHBondContact O-CB 3.35Å; A26-A30 PolarHBondContact O-N 3.41Å; A30-Y32 VanDerWaalsContact C-N 3.34Å; A30-A33 PolarHBondContact O-N 3.44Å; A30-L34 WeakPolarHBondContact O-CB 3.14Å; A30-L34 WeakPolarHBondContact O-CD1 3.48Å; A30-L34 WeakPolarHBondContact O-CG 3.29Å; A30-L34 PolarHBondContact O-N 2.74Å
31	Y	75.7	Confident	65.7	Low	145 Å²	145	101.3 Å²	101.3	57%	0.569	56%	0.559	S	S	*	*	H	α-helix	trans	-60.8	-46.9	171.8	-178.2	-98.6	0	0	0	110.9	R27 P28 H29 S35	R27-Y31 WeakPolarHBondContact O-CB 3.38Å; R27-Y31 PolarHBondContact O-N 2.9Å; P28-Y31 PolarHBondContact O-N 3.32Å; H29-Y31 VanDerWaalsContact C-N 3.31Å; Y31-S35 WeakPolarHBondContact O-CB 3.29Å; Y31-S35 PolarHBondContact O-N 3.28Å; Y31-S35 PolarHBondContact O-OG 3.14Å
32	Y	72.4	Confident	66.8	Low	147 Å²	147	97.2 Å²	97.2	58%	0.576	54%	0.54	S	S	*	.	H	α-helix	trans	-65.3	-43	173.1	-66.8	-69.2	0	0	0	112.4	P28 H29 A30 L34 S35 Y36	P28-Y32 WeakPolarHBondContact O-CD2 3.28Å; P28-Y32 PolarHBondContact O-N 3.37Å; H29-Y32 PolarHBondContact O-N 2.83Å; A30-Y32 VanDerWaalsContact C-N 3.34Å; Y32-L34 PolarHBondContact O-N 3.14Å; Y32-S35 WeakPolarHBondContact CA-OG 3.46Å; Y32-S35 PolarHBondContact O-N 3.5Å; Y32-S35 PolarHBondContact O-OG 3.06Å; Y32-Y36 WeakPolarHBondContact O-CB 3.35Å; Y32-Y36 WeakPolarHBondContact O-CD2 3.2Å; Y32-Y36 PolarHBondContact O-N 3.46Å
33	A	77.8	Confident	67.5	Low	54 Å²	54	97.2 Å²	97.2	45%	0.446	52%	0.523	S	S	.	.	H	α-helix	trans	-64.6	-40.8	179.3	0	0	0	0	0	112.3	H29 A30 Y36 C37	H29-A33 WeakPolarHBondContact O-CB 3.25Å; H29-A33 PolarHBondContact O-N 3.1Å; A30-A33 PolarHBondContact O-N 3.44Å; A33-Y36 PolarHBondContact O-N 3.01Å; A33-C37 WeakPolarHBondContact O-CB 3.33Å; A33-C37 PolarHBondContact O-N 2.92Å; A33-C37 PolarHBondContact O-SG 3Å
34	L	77.8	Confident	68.4	Low	123 Å²	123	98.3 Å²	98.3	64%	0.644	52%	0.522	S	S	*	.	H	α-helix	trans	-67.7	-39.6	176.4	-73.1	169.9	0	0	0	111.5	A30 Y32 C37 A38	A30-L34 WeakPolarHBondContact O-CB 3.14Å; A30-L34 WeakPolarHBondContact O-CD1 3.48Å; A30-L34 WeakPolarHBondContact O-CG 3.29Å; A30-L34 PolarHBondContact O-N 2.74Å; Y32-L34 PolarHBondContact O-N 3.14Å; L34-C37 PolarHBondContact O-N 3.5Å; L34-A38 WeakPolarHBondContact O-CB 3.48Å; L34-A38 PolarHBondContact O-N 2.96Å
35	S	74.8	Confident	68.8	Low	41 Å²	41	100.6 Å²	100.6	29%	0.287	52%	0.52	S	S	.	.	H	α-helix	trans	-66.3	-41	175.4	68	0	0	0	0	111.6	Y31 Y32 A38 L39	Y31-S35 WeakPolarHBondContact O-CB 3.29Å; Y31-S35 PolarHBondContact O-N 3.28Å; Y31-S35 PolarHBondContact O-OG 3.14Å; Y32-S35 WeakPolarHBondContact CA-OG 3.46Å; Y32-S35 PolarHBondContact O-N 3.5Å; Y32-S35 PolarHBondContact O-OG 3.06Å; S35-A38 PolarHBondContact O-N 2.98Å; S35-L39 WeakPolarHBondContact O-CB 3.44Å; S35-L39 WeakPolarHBondContact O-CG 3.29Å; S35-L39 PolarHBondContact O-N 3.24Å
36	Y	72.4	Confident	69.5	Low	154 Å²	154	93.1 Å²	93.1	60%	0.604	49%	0.494	S	S	*	.	H	α-helix	trans	-62.1	-45.3	172.7	-86.9	-68.9	0	0	0	112.6	Y32 A33 A38 L39 I40	Y32-Y36 WeakPolarHBondContact O-CB 3.35Å; Y32-Y36 WeakPolarHBondContact O-CD2 3.2Å; Y32-Y36 PolarHBondContact O-N 3.46Å; A33-Y36 PolarHBondContact O-N 3.01Å; Y36-A38 PolarHBondContact O-N 3.12Å; Y36-L39 PolarHBondContact O-N 3.26Å; Y36-I40 VanDerWaalsContact O-CG1 3.29Å; Y36-I40 WeakPolarHBondContact O-CG1 3.4Å; Y36-I40 PolarHBondContact O-N 3.43Å
37	C	77.6	Confident	69.6	Low	72 Å²	72	94.4 Å²	94.4	49%	0.486	50%	0.496	S	S	.	.	H	α-helix	trans	-62.2	-42.6	175.2	-73	0	0	0	0	112	A33 L34 I40 L41	A33-C37 WeakPolarHBondContact O-CB 3.33Å; A33-C37 PolarHBondContact O-N 2.92Å; A33-C37 PolarHBondContact O-SG 3Å; L34-C37 PolarHBondContact O-N 3.5Å; C37-I40 PolarHBondContact O-N 3.35Å; C37-L41 WeakPolarHBondContact O-CG 3.43Å; C37-L41 PolarHBondContact O-N 2.84Å
38	A	72.1	Confident	69.8	Low	57 Å²	57	86.5 Å²	86.5	47%	0.471	48%	0.477	S	S	.	.	H	α-helix	trans	-65.4	-39	177.1	0	0	0	0	0	112	L34 S35 Y36 L41 A42	L34-A38 WeakPolarHBondContact O-CB 3.48Å; L34-A38 PolarHBondContact O-N 2.96Å; S35-A38 PolarHBondContact O-N 2.98Å; Y36-A38 PolarHBondContact O-N 3.12Å; A38-L41 PolarHBondContact O-N 3.47Å; A38-A42 WeakPolarHBondContact O-CB 3.36Å; A38-A42 PolarHBondContact O-N 3.35Å
39	L	73.1	Confident	69.8	Low	50 Å²	50	87.4 Å²	87.4	26%	0.262	48%	0.477	S	S	.	.	H	α-helix	trans	-61.7	-46.7	173.6	-75.6	169.6	0	0	0	111.1	S35 Y36 L41 A42 I43 T80	S35-L39 WeakPolarHBondContact O-CB 3.44Å; S35-L39 WeakPolarHBondContact O-CG 3.29Å; S35-L39 PolarHBondContact O-N 3.24Å; Y36-L39 PolarHBondContact O-N 3.26Å; L39-L41 PolarHBondContact O-N 3.44Å; L39-A42 PolarHBondContact O-N 3.46Å; L39-I43 WeakPolarHBondContact O-CB 3.5Å; L39-I43 VanDerWaalsContact O-CD1 3.24Å; L39-I43 WeakPolarHBondContact O-CD1 3.48Å; L39-I43 WeakPolarHBondContact O-CG1 3.43Å; L39-I43 PolarHBondContact O-N 2.93Å; L39-T80 HydrophobicContact CD1-CG2 4.5Å
40	I	75.1	Confident	69.6	Low	103 Å²	103	82.7 Å²	82.7	53%	0.528	46%	0.458	S	S	.	.	H	α-helix	trans	-61.3	-45.4	177.9	-66.7	164.1	0	0	0	111	Y36 C37 I43 V44	Y36-I40 VanDerWaalsContact O-CG1 3.29Å; Y36-I40 WeakPolarHBondContact O-CG1 3.4Å; Y36-I40 PolarHBondContact O-N 3.43Å; C37-I40 PolarHBondContact O-N 3.35Å; I40-I43 PolarHBondContact O-N 2.88Å; I40-V44 WeakPolarHBondContact O-CG2 3.24Å; I40-V44 PolarHBondContact O-N 3.02Å
41	L	72.1	Confident	68.7	Low	121 Å²	121	84.3 Å²	84.3	63%	0.634	47%	0.467	S	S	*	.	H	α-helix	trans	-65.1	-41.1	176.6	-69.9	175.1	0	0	0	112.1	C37 A38 L39 I43 V44 F45	C37-L41 WeakPolarHBondContact O-CG 3.43Å; C37-L41 PolarHBondContact O-N 2.84Å; A38-L41 PolarHBondContact O-N 3.47Å; L39-L41 PolarHBondContact O-N 3.44Å; L41-I43 VanDerWaalsContact C-N 3.33Å; L41-I43 PolarHBondContact O-N 3.29Å; L41-V44 PolarHBondContact O-N 3.48Å; L41-F45 WeakPolarHBondContact O-CB 3.36Å; L41-F45 PolarHBondContact O-N 2.98Å
42	A	71	Confident	67.8	Low	62 Å²	62	84 Å²	84	51%	0.512	47%	0.472	S	S	.	.	H	α-helix	trans	-63.7	-38.7	176.7	0	0	0	0	0	111.8	A38 L39 G46	A38-A42 WeakPolarHBondContact O-CB 3.36Å; A38-A42 PolarHBondContact O-N 3.35Å; L39-A42 PolarHBondContact O-N 3.46Å; A42-G46 WeakPolarHBondContact O-CA 3.34Å; A42-G46 PolarHBondContact O-N 3.37Å
43	I	68.6	Low	67.3	Low	68 Å²	68	79.9 Å²	79.9	35%	0.349	47%	0.469	S	S	.	.	H	α-helix	trans	-62.6	-50.2	173.9	-66.7	158.3	0	0	0	109.9	L39 I40 L41 N47 L76	L39-I43 WeakPolarHBondContact O-CB 3.5Å; L39-I43 VanDerWaalsContact O-CD1 3.24Å; L39-I43 WeakPolarHBondContact O-CD1 3.48Å; L39-I43 WeakPolarHBondContact O-CG1 3.43Å; L39-I43 PolarHBondContact O-N 2.93Å; I40-I43 PolarHBondContact O-N 2.88Å; L41-I43 VanDerWaalsContact C-N 3.33Å; L41-I43 PolarHBondContact O-N 3.29Å; I43-N47 WeakPolarHBondContact CG2-ND2 3.38Å; I43-N47 VanDerWaalsContact O-CB 3.29Å; I43-N47 WeakPolarHBondContact O-CB 3.21Å; I43-N47 VanDerWaalsContact O-CG 3.25Å; I43-N47 PolarHBondContact O-N 2.81Å; I43-N47 PolarHBondContact O-ND2 3.31Å; I43-L76 HydrophobicContact CD1-CD1 3.66Å; I43-L76 HydrophobicContact CG1-CD1 3.76Å
44	V	69.5	Low	65.9	Low	97 Å²	97	79.2 Å²	79.2	59%	0.588	46%	0.459	S	S	*	.	H	α-helix	trans	-65.8	-43.6	-178.4	173.8	0	0	0	0	111.5	I40 L41 G48	I40-V44 WeakPolarHBondContact O-CG2 3.24Å; I40-V44 PolarHBondContact O-N 3.02Å; L41-V44 PolarHBondContact O-N 3.48Å; V44-G48 PolarHBondContact O-N 2.81Å
45	F	63.1	Low	64.8	Low	145 Å²	145	79 Å²	79	64%	0.636	46%	0.458	S	S	*	.	H	α-helix	trans	-73	-38.6	-178.1	-157.3	-106.5	0	0	0	112.2	L41 G48 L49	L41-F45 WeakPolarHBondContact O-CB 3.36Å; L41-F45 PolarHBondContact O-N 2.98Å; F45-G48 PolarHBondContact O-N 3.14Å; F45-L49 HydrophobicContact CD1-CD1 3.4Å; F45-L49 HydrophobicContact CD1-CG 3.98Å; F45-L49 HydrophobicContact CE1-CD1 3.3Å; F45-L49 HydrophobicContact CE1-CD2 4.34Å; F45-L49 HydrophobicContact CE1-CG 3.88Å; F45-L49 HydrophobicContact CG-CD1 4.4Å; F45-L49 HydrophobicContact CZ-CD1 4.22Å; F45-L49 HydrophobicContact CZ-CG 4.37Å; F45-L49 WeakPolarHBondContact O-CB 3.09Å; F45-L49 WeakPolarHBondContact O-CG 3.2Å; F45-L49 PolarHBondContact O-N 3.38Å
46	G	65.1	Low	64.1	Low	30 Å²	30	85.8 Å²	85.8	31%	0.309	48%	0.482	S	S	.	.	H	α-helix	trans	-62.8	-43	173.1	0	0	0	0	0	112	A42 V50	A42-G46 WeakPolarHBondContact O-CA 3.34Å; A42-G46 PolarHBondContact O-N 3.37Å; G46-V50 WeakPolarHBondContact O-CB 3.42Å; G46-V50 WeakPolarHBondContact O-CG2 3.17Å; G46-V50 PolarHBondContact O-N 2.8Å; G46-V50 VanDerWaalsContact O-N 3.14Å
47	N	55.8	Low	63.3	Low	60 Å²	60	85.7 Å²	85.7	32%	0.321	49%	0.487	S	S	.	.	H	α-helix	trans	-65.1	-38.3	173.4	-76.6	-52.4	0	0	0	112.3	I43 C51	I43-N47 WeakPolarHBondContact CG2-ND2 3.38Å; I43-N47 VanDerWaalsContact O-CB 3.29Å; I43-N47 WeakPolarHBondContact O-CB 3.21Å; I43-N47 VanDerWaalsContact O-CG 3.25Å; I43-N47 PolarHBondContact O-N 2.81Å; I43-N47 PolarHBondContact O-ND2 3.31Å; N47-C51 WeakPolarHBondContact O-CB 3.41Å; N47-C51 PolarHBondContact O-N 2.66Å; N47-C51 VanDerWaalsContact O-N 3.11Å; N47-C51 PolarHBondContact O-SG 3.09Å; N47-C51 VanDerWaalsContact O-SG 3.35Å
48	G	61.5	Low	61.9	Low	36 Å²	36	90.5 Å²	90.5	37%	0.371	50%	0.495	S	S	.	.	H	α-helix	trans	-70.6	-43.9	178.5	0	0	0	0	0	113.8	V44 F45 C51 M52	V44-G48 PolarHBondContact O-N 2.81Å; F45-G48 PolarHBondContact O-N 3.14Å; G48-C51 PolarHBondContact O-N 3.4Å; G48-M52 WeakPolarHBondContact O-CB 3.35Å; G48-M52 WeakPolarHBondContact O-CG 3.29Å; G48-M52 PolarHBondContact O-N 3.41Å
49	L	58.9	Low	60.7	Low	97 Å²	97	92.2 Å²	92.2	51%	0.508	51%	0.509	S	S	.	.	H	α-helix	trans	-69	-41.2	-179.3	-79.7	174.5	0	0	0	112.3	F45 M52 A53	F45-L49 HydrophobicContact CD1-CD1 3.4Å; F45-L49 HydrophobicContact CD1-CG 3.98Å; F45-L49 HydrophobicContact CE1-CD1 3.3Å; F45-L49 HydrophobicContact CE1-CD2 4.34Å; F45-L49 HydrophobicContact CE1-CG 3.88Å; F45-L49 HydrophobicContact CG-CD1 4.4Å; F45-L49 HydrophobicContact CZ-CD1 4.22Å; F45-L49 HydrophobicContact CZ-CG 4.37Å; F45-L49 WeakPolarHBondContact O-CB 3.09Å; F45-L49 WeakPolarHBondContact O-CG 3.2Å; F45-L49 PolarHBondContact O-N 3.38Å; L49-M52 PolarHBondContact O-N 2.92Å; L49-A53 VanDerWaalsContact O-CB 3.27Å; L49-A53 WeakPolarHBondContact O-CB 3.32Å; L49-A53 PolarHBondContact O-N 2.84Å
50	V	55.8	Low	59.7	Low	42 Å²	42	96.5 Å²	96.5	26%	0.255	53%	0.532	S	S	.	.	H	α-helix	trans	-69.4	-41.1	176.5	177.1	0	0	0	0	110.5	G46 M52 A53 V54 V68	G46-V50 WeakPolarHBondContact O-CB 3.42Å; G46-V50 WeakPolarHBondContact O-CG2 3.17Å; G46-V50 PolarHBondContact O-N 2.8Å; G46-V50 VanDerWaalsContact O-N 3.14Å; V50-M52 PolarHBondContact O-N 3.44Å; V50-A53 PolarHBondContact O-N 2.85Å; V50-V54 HydrophobicContact CG1-CG2 4.22Å; V50-V54 VanDerWaalsContact O-CB 3.28Å; V50-V54 WeakPolarHBondContact O-CB 3.38Å; V50-V54 VanDerWaalsContact O-CG2 3.25Å; V50-V54 WeakPolarHBondContact O-CG2 3.44Å; V50-V54 PolarHBondContact O-N 3.43Å; V50-V68 HydrophobicContact CB-CG1 3.83Å; V50-V68 HydrophobicContact CB-CG2 4.41Å; V50-V68 HydrophobicContact CG1-CB 3.87Å; V50-V68 HydrophobicContact CG1-CG1 3.53Å; V50-V68 HydrophobicContact CG1-CG2 3.26Å
51	C	52.2	Low	58.4	Low	67 Å²	67	99.4 Å²	99.4	45%	0.453	54%	0.543	S	S	.	.	H	α-helix	trans	-58.3	-46.2	170.4	-84.6	0	0	0	0	111.8	N47 G48 V54 L55	N47-C51 WeakPolarHBondContact O-CB 3.41Å; N47-C51 PolarHBondContact O-N 2.66Å; N47-C51 VanDerWaalsContact O-N 3.11Å; N47-C51 PolarHBondContact O-SG 3.09Å; N47-C51 VanDerWaalsContact O-SG 3.35Å; G48-C51 PolarHBondContact O-N 3.4Å; C51-V54 PolarHBondContact O-N 2.94Å; C51-L55 HydrophobicContact CB-CD1 4.45Å; C51-L55 WeakPolarHBondContact O-CB 3.34Å; C51-L55 WeakPolarHBondContact O-CD1 3.33Å; C51-L55 WeakPolarHBondContact O-CG 3.37Å; C51-L55 PolarHBondContact O-N 2.89Å
52	M	56.5	Low	57.6	Low	138 Å²	138	99.6 Å²	99.6	68%	0.68	55%	0.549	S	S	*	.	H	α-helix	trans	-64	-42.4	178.1	-85.5	-69.7	-146	0	0	113	G48 L49 V50 K56	G48-M52 WeakPolarHBondContact O-CB 3.35Å; G48-M52 WeakPolarHBondContact O-CG 3.29Å; G48-M52 PolarHBondContact O-N 3.41Å; L49-M52 PolarHBondContact O-N 2.92Å; V50-M52 PolarHBondContact O-N 3.44Å; M52-K56 VanDerWaalsContact O-CB 3.29Å; M52-K56 WeakPolarHBondContact O-CB 3.27Å; M52-K56 PolarHBondContact O-N 3.46Å; M52-K56 VanDerWaalsContact O-N 3.14Å
53	A	62.1	Low	56.6	Low	61 Å²	61	102 Å²	102	50%	0.504	56%	0.558	S	S	.	*	H	α-helix	trans	-67.7	-36.3	179.1	0	0	0	0	0	112.3	L49 V50	L49-A53 VanDerWaalsContact O-CB 3.27Å; L49-A53 WeakPolarHBondContact O-CB 3.32Å; L49-A53 PolarHBondContact O-N 2.84Å; V50-A53 PolarHBondContact O-N 2.85Å
54	V	49.6	Very low	56.1	Low	39 Å²	39	100.8 Å²	100.8	24%	0.236	55%	0.554	C	S	.	*	H	α-helix	trans	-80.8	-40.1	178.3	168.8	0	0	0	0	112	V50 C51 K56 E57 R58 T64	V50-V54 HydrophobicContact CG1-CG2 4.22Å; V50-V54 VanDerWaalsContact O-CB 3.28Å; V50-V54 WeakPolarHBondContact O-CB 3.38Å; V50-V54 VanDerWaalsContact O-CG2 3.25Å; V50-V54 WeakPolarHBondContact O-CG2 3.44Å; V50-V54 PolarHBondContact O-N 3.43Å; C51-V54 PolarHBondContact O-N 2.94Å; V54-K56 PolarHBondContact O-N 2.92Å; V54-E57 CarbonylContact O-C 3.59Å; V54-E57 WeakPolarHBondContact O-CA 3.5Å; V54-E57 PolarHBondContact O-N 2.83Å; V54-R58 HydrophobicContact CG1-CB 4.16Å; V54-R58 PolarHBondContact O-N 3.28Å; V54-T64 HydrophobicContact CB-CG2 4.17Å; V54-T64 HydrophobicContact CG1-CG2 3.45Å; V54-T64 VanDerWaalsContact CG1-CG2 3.45Å; V54-T64 HydrophobicContact CG2-CG2 3.64Å
55	L	53.7	Low	55.4	Low	119 Å²	119	101.6 Å²	101.6	62%	0.623	56%	0.555	S	S	*	*	H	α-helix	trans	-60.8	-33.4	174.8	-75.6	167.7	0	0	0	111.2	C51 E57	C51-L55 HydrophobicContact CB-CD1 4.45Å; C51-L55 WeakPolarHBondContact O-CB 3.34Å; C51-L55 WeakPolarHBondContact O-CD1 3.33Å; C51-L55 WeakPolarHBondContact O-CG 3.37Å; C51-L55 PolarHBondContact O-N 2.89Å; L55-E57 PolarHBondContact O-N 3.43Å
56	K	59.9	Low	55.1	Low	183 Å²	183	104 Å²	104	80%	0.796	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64	-22.3	171.9	-177.4	175.3	164.4	178.1	0	113.1	M52 V54	M52-K56 VanDerWaalsContact O-CB 3.29Å; M52-K56 WeakPolarHBondContact O-CB 3.27Å; M52-K56 PolarHBondContact O-N 3.46Å; M52-K56 VanDerWaalsContact O-N 3.14Å; V54-K56 PolarHBondContact O-N 2.92Å
57	E	55.7	Low	54.7	Low	153 Å²	153	108.6 Å²	108.6	72%	0.715	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-114.4	-20.7	-174.8	-155.3	73.5	-137.2	0	0	114.1	V54 L55	V54-E57 CarbonylContact O-C 3.59Å; V54-E57 WeakPolarHBondContact O-CA 3.5Å; V54-E57 PolarHBondContact O-N 2.83Å; L55-E57 PolarHBondContact O-N 3.43Å
58	R	48.4	Very low	54.8	Low	173 Å²	173	106.6 Å²	106.6	65%	0.653	57%	0.568	S	S	*	*			trans	-149	73.4	-164.8	-67.9	-68.7	-170.9	-171.9	-2.1	113.5	V54 L60	V54-R58 HydrophobicContact CG1-CB 4.16Å; V54-R58 PolarHBondContact O-N 3.28Å; R58-L60 PolarHBondContact O-N 3.36Å
59	A	48.2	Very low	54.8	Low	92 Å²	92	108.4 Å²	108.4	76%	0.76	57%	0.572	S	S	*	*	S	Bend	trans	-67.1	3.8	172.5	0	0	0	0	0	115.4
60	L	51.4	Low	54.8	Low	140 Å²	140	107.6 Å²	107.6	73%	0.733	57%	0.574	S	S	*	*	S	Bend	trans	-143.3	125.6	176.6	-94.9	95.7	0	0	0	112.4	R58	R58-L60 PolarHBondContact O-N 3.36Å
61	Q	47.5	Very low	55.4	Low	165 Å²	165	110.5 Å²	110.5	77%	0.771	59%	0.587	S	S	*	*			trans	99.9	135.8	155	-64.6	177.3	-24.5	0	0	122.1	T63	Q61-T63 VanDerWaalsContact C-N 3.34Å; Q61-T63 PolarHBondContact O-N 2.75Å; Q61-T63 VanDerWaalsContact O-N 3.08Å
62	T	54.9	Low	56	Low	124 Å²	124	109 Å²	109	76%	0.761	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.9	3.3	-162.5	43.6	0	0	0	0	119.3
63	T	50.5	Low	56.4	Low	114 Å²	114	106 Å²	106	70%	0.699	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83	-29.7	-174.2	-51.5	0	0	0	0	112.7	Q61 N65	Q61-T63 VanDerWaalsContact C-N 3.34Å; Q61-T63 PolarHBondContact O-N 2.75Å; Q61-T63 VanDerWaalsContact O-N 3.08Å; T63-N65 VanDerWaalsContact C-N 3.28Å; T63-N65 PolarHBondContact O-N 2.9Å
64	T	58.4	Low	56.7	Low	42 Å²	42	105.4 Å²	105.4	26%	0.258	56%	0.564	S	S	.	*	H	α-helix	trans	-68.6	-26.4	-177.5	-43.9	0	0	0	0	113.1	V54 Y66 L67 V68	V54-T64 HydrophobicContact CB-CG2 4.17Å; V54-T64 HydrophobicContact CG1-CG2 3.45Å; V54-T64 VanDerWaalsContact CG1-CG2 3.45Å; V54-T64 HydrophobicContact CG2-CG2 3.64Å; T64-Y66 PolarHBondContact O-N 3.37Å; T64-L67 PolarHBondContact O-N 3.35Å; T64-L67 VanDerWaalsContact O-N 3.11Å; T64-V68 HydrophobicContact CG2-CG2 4.24Å; T64-V68 WeakPolarHBondContact O-CG2 3.5Å; T64-V68 PolarHBondContact O-N 2.87Å
65	N	54.8	Low	57.9	Low	114 Å²	114	108.4 Å²	108.4	61%	0.61	58%	0.579	S	S	*	*	H	α-helix	trans	-56.6	-35	-176.9	-162.7	-16	0	0	0	112.9	T63 V69	T63-N65 VanDerWaalsContact C-N 3.28Å; T63-N65 PolarHBondContact O-N 2.9Å; N65-V69 WeakPolarHBondContact O-CG2 2.95Å; N65-V69 PolarHBondContact O-N 3.42Å
66	Y	55.4	Low	58.4	Low	194 Å²	194	105.9 Å²	105.9	76%	0.761	57%	0.566	S	S	*	*	H	α-helix	trans	-74.9	-31.5	179.3	-80.1	-84.7	0	0	0	114.3	T64 S70	T64-Y66 PolarHBondContact O-N 3.37Å; Y66-S70 WeakPolarHBondContact O-CB 3.31Å; Y66-S70 PolarHBondContact O-N 2.76Å; Y66-S70 VanDerWaalsContact O-N 3.12Å
67	L	56.9	Low	58.7	Low	128 Å²	128	101.5 Å²	101.5	67%	0.67	55%	0.55	S	S	*	*	H	α-helix	trans	-74.6	-35.3	-179.9	-68.5	177.7	0	0	0	111.9	T64 S70 L71	T64-L67 PolarHBondContact O-N 3.35Å; T64-L67 VanDerWaalsContact O-N 3.11Å; L67-S70 PolarHBondContact O-N 3.4Å; L67-L71 PolarHBondContact O-N 2.98Å; L67-L71 VanDerWaalsContact O-N 3.12Å
68	V	58.6	Low	59.4	Low	18 Å²	18	98.4 Å²	98.4	11%	0.109	54%	0.542	C	S	.	.	H	α-helix	trans	-64.3	-46.3	176.4	-177.1	0	0	0	0	111.2	V50 T64 S70 A72	V50-V68 HydrophobicContact CB-CG1 3.83Å; V50-V68 HydrophobicContact CB-CG2 4.41Å; V50-V68 HydrophobicContact CG1-CB 3.87Å; V50-V68 HydrophobicContact CG1-CG1 3.53Å; V50-V68 HydrophobicContact CG1-CG2 3.26Å; T64-V68 HydrophobicContact CG2-CG2 4.24Å; T64-V68 WeakPolarHBondContact O-CG2 3.5Å; T64-V68 PolarHBondContact O-N 2.87Å; V68-S70 VanDerWaalsContact C-N 3.34Å; V68-S70 PolarHBondContact O-N 3.47Å; V68-A72 WeakPolarHBondContact O-CB 2.95Å; V68-A72 PolarHBondContact O-N 3.41Å; V68-A72 VanDerWaalsContact O-N 3.14Å
69	V	62.1	Low	60.4	Low	74 Å²	74	92.6 Å²	92.6	45%	0.448	53%	0.531	S	S	.	.	H	α-helix	trans	-65.5	-39.6	178.5	175.6	0	0	0	0	110.8	N65 A72 V73	N65-V69 WeakPolarHBondContact O-CG2 2.95Å; N65-V69 PolarHBondContact O-N 3.42Å; V69-A72 PolarHBondContact O-N 3.44Å; V69-V73 HydrophobicContact CG1-CG2 4.33Å; V69-V73 WeakPolarHBondContact O-CB 3.23Å; V69-V73 WeakPolarHBondContact O-CG2 3.07Å; V69-V73 PolarHBondContact O-N 2.88Å
70	S	58.3	Low	61.3	Low	79 Å²	79	91.2 Å²	91.2	55%	0.552	51%	0.513	S	S	*	.	H	α-helix	trans	-70	-34.1	-178.1	-161.9	0	0	0	0	113.7	Y66 L67 V68 A74	Y66-S70 WeakPolarHBondContact O-CB 3.31Å; Y66-S70 PolarHBondContact O-N 2.76Å; Y66-S70 VanDerWaalsContact O-N 3.12Å; L67-S70 PolarHBondContact O-N 3.4Å; V68-S70 VanDerWaalsContact C-N 3.34Å; V68-S70 PolarHBondContact O-N 3.47Å; S70-A74 WeakPolarHBondContact O-CB 2.91Å; S70-A74 PolarHBondContact O-N 3.49Å; S70-A74 VanDerWaalsContact O-N 3.1Å
71	L	68.4	Low	62.1	Low	104 Å²	104	89.3 Å²	89.3	55%	0.545	50%	0.503	S	S	.	.	H	α-helix	trans	-70.5	-46.1	174.2	-165.9	86	0	0	0	110.5	L67 V73 A74 D75	L67-L71 PolarHBondContact O-N 2.98Å; L67-L71 VanDerWaalsContact O-N 3.12Å; L71-V73 VanDerWaalsContact C-N 3.26Å; L71-V73 PolarHBondContact O-N 3.48Å; L71-A74 WeakPolarHBondContact O-CB 3.49Å; L71-A74 PolarHBondContact O-N 3.42Å; L71-D75 PolarHBondContact O-N 2.83Å; L71-D75 VanDerWaalsContact O-OD2 3.12Å
72	A	63.9	Low	63.3	Low	36 Å²	36	83.7 Å²	83.7	30%	0.298	48%	0.48	S	S	.	.	H	α-helix	trans	-59.2	-37.5	177.5	0	0	0	0	0	112.5	V68 V69 L76	V68-A72 WeakPolarHBondContact O-CB 2.95Å; V68-A72 PolarHBondContact O-N 3.41Å; V68-A72 VanDerWaalsContact O-N 3.14Å; V69-A72 PolarHBondContact O-N 3.44Å; A72-L76 VanDerWaalsContact O-CB 3.29Å; A72-L76 WeakPolarHBondContact O-CB 3.41Å; A72-L76 PolarHBondContact O-N 3.27Å
73	V	66.5	Low	64.2	Low	74 Å²	74	83.2 Å²	83.2	45%	0.448	47%	0.471	S	S	.	.	H	α-helix	trans	-71.5	-37.9	175.4	171.4	0	0	0	0	111.5	V69 L71 L76 L77	V69-V73 HydrophobicContact CG1-CG2 4.33Å; V69-V73 WeakPolarHBondContact O-CB 3.23Å; V69-V73 WeakPolarHBondContact O-CG2 3.07Å; V69-V73 PolarHBondContact O-N 2.88Å; L71-V73 VanDerWaalsContact C-N 3.26Å; L71-V73 PolarHBondContact O-N 3.48Å; V73-L76 PolarHBondContact O-N 3.41Å; V73-L77 HydrophobicContact CG1-CD1 3.6Å; V73-L77 HydrophobicContact CG1-CG 4.42Å; V73-L77 WeakPolarHBondContact O-CB 3.15Å; V73-L77 WeakPolarHBondContact O-CD1 3.09Å; V73-L77 WeakPolarHBondContact O-CG 3.2Å; V73-L77 PolarHBondContact O-N 2.96Å
74	A	68.1	Low	65.1	Low	49 Å²	49	81.4 Å²	81.4	41%	0.405	46%	0.461	S	S	.	.	H	α-helix	trans	-64.2	-45.3	178.3	0	0	0	0	0	112.5	S70 L71 L77 V78	S70-A74 WeakPolarHBondContact O-CB 2.91Å; S70-A74 PolarHBondContact O-N 3.49Å; S70-A74 VanDerWaalsContact O-N 3.1Å; L71-A74 WeakPolarHBondContact O-CB 3.49Å; L71-A74 PolarHBondContact O-N 3.42Å; A74-L77 PolarHBondContact O-N 2.82Å; A74-V78 WeakPolarHBondContact O-CB 3.31Å; A74-V78 WeakPolarHBondContact O-CG2 3.42Å; A74-V78 PolarHBondContact O-N 2.86Å
75	D	73.3	Confident	65.7	Low	102 Å²	102	86.9 Å²	86.9	55%	0.545	48%	0.477	S	S	.	.	H	α-helix	trans	-67.1	-36.8	177.3	-76.7	-75.5	0	0	0	112.5	L71 V78 A79	L71-D75 PolarHBondContact O-N 2.83Å; L71-D75 VanDerWaalsContact O-OD2 3.12Å; D75-V78 PolarHBondContact O-N 3.45Å; D75-A79 WeakPolarHBondContact O-CB 3.12Å; D75-A79 PolarHBondContact O-N 3.31Å
76	L	65.8	Low	66.5	Low	65 Å²	65	85 Å²	85	34%	0.34	47%	0.469	S	S	.	.	H	α-helix	trans	-68.4	-39.7	177.6	-144.9	163	0	0	0	111.3	I43 A72 V73 T80	I43-L76 HydrophobicContact CD1-CD1 3.66Å; I43-L76 HydrophobicContact CG1-CD1 3.76Å; A72-L76 VanDerWaalsContact O-CB 3.29Å; A72-L76 WeakPolarHBondContact O-CB 3.41Å; A72-L76 PolarHBondContact O-N 3.27Å; V73-L76 PolarHBondContact O-N 3.41Å; L76-T80 HydrophobicContact CD2-CG2 4.06Å; L76-T80 WeakPolarHBondContact O-CB 3.13Å; L76-T80 WeakPolarHBondContact O-CG2 3.21Å; L76-T80 PolarHBondContact O-N 2.95Å; L76-T80 VanDerWaalsContact O-N 3.09Å; L76-T80 PolarHBondContact O-OG1 3.5Å
77	L	64.8	Low	67.4	Low	91 Å²	91	79.8 Å²	79.8	48%	0.476	46%	0.458	S	S	.	.	H	α-helix	trans	-66.2	-43.5	173.5	-80	159	0	0	0	111.6	V73 A74 T80 L81	V73-L77 HydrophobicContact CG1-CD1 3.6Å; V73-L77 HydrophobicContact CG1-CG 4.42Å; V73-L77 WeakPolarHBondContact O-CB 3.15Å; V73-L77 WeakPolarHBondContact O-CD1 3.09Å; V73-L77 WeakPolarHBondContact O-CG 3.2Å; V73-L77 PolarHBondContact O-N 2.96Å; A74-L77 PolarHBondContact O-N 2.82Å; L77-T80 PolarHBondContact O-OG1 3.21Å; L77-L81 HydrophobicContact CB-CD1 4.49Å; L77-L81 HydrophobicContact CD2-CD1 4.12Å; L77-L81 WeakPolarHBondContact O-CB 3.07Å; L77-L81 VanDerWaalsContact O-CG 3.23Å; L77-L81 WeakPolarHBondContact O-CG 3.38Å; L77-L81 PolarHBondContact O-N 2.86Å
78	V	71.4	Confident	68.1	Low	88 Å²	88	79.3 Å²	79.3	53%	0.533	45%	0.448	S	S	.	.	H	α-helix	trans	-63.7	-49.3	177.3	167.7	0	0	0	0	110.6	A74 D75 T80 L81 V82	A74-V78 WeakPolarHBondContact O-CB 3.31Å; A74-V78 WeakPolarHBondContact O-CG2 3.42Å; A74-V78 PolarHBondContact O-N 2.86Å; D75-V78 PolarHBondContact O-N 3.45Å; V78-T80 PolarHBondContact O-N 3.33Å; V78-L81 PolarHBondContact O-N 2.98Å; V78-V82 HydrophobicContact CG1-CG2 3.87Å; V78-V82 WeakPolarHBondContact O-CB 3.16Å; V78-V82 WeakPolarHBondContact O-CG2 3.48Å; V78-V82 PolarHBondContact O-N 3.31Å
79	A	69	Low	68.8	Low	52 Å²	52	82.5 Å²	82.5	43%	0.43	46%	0.464	S	S	.	.	H	α-helix	trans	-63.5	-40	-178.4	0	0	0	0	0	113.3	D75	D75-A79 WeakPolarHBondContact O-CB 3.12Å; D75-A79 PolarHBondContact O-N 3.31Å
80	T	67.6	Low	69	Low	63 Å²	63	85 Å²	85	39%	0.387	47%	0.471	S	S	.	.	H	α-helix	trans	-79.9	-29.3	-179.1	54.2	0	0	0	0	113.6	L39 L76 L77 V78 P84	L39-T80 HydrophobicContact CD1-CG2 4.5Å; L76-T80 HydrophobicContact CD2-CG2 4.06Å; L76-T80 WeakPolarHBondContact O-CB 3.13Å; L76-T80 WeakPolarHBondContact O-CG2 3.21Å; L76-T80 PolarHBondContact O-N 2.95Å; L76-T80 VanDerWaalsContact O-N 3.09Å; L76-T80 PolarHBondContact O-OG1 3.5Å; L77-T80 PolarHBondContact O-OG1 3.21Å; V78-T80 PolarHBondContact O-N 3.33Å; T80-P84 WeakPolarHBondContact O-CD 3.28Å; T80-P84 WeakPolarHBondContact O-CG 3.25Å
81	L	67.1	Low	69.5	Low	99 Å²	99	85.6 Å²	85.6	52%	0.518	47%	0.47	S	S	.	.	H	α-helix	trans	-86.6	-40.5	176.9	-67	170.4	0	0	0	111.8	L77 V78 M83 P84 W85	L77-L81 HydrophobicContact CB-CD1 4.49Å; L77-L81 HydrophobicContact CD2-CD1 4.12Å; L77-L81 WeakPolarHBondContact O-CB 3.07Å; L77-L81 VanDerWaalsContact O-CG 3.23Å; L77-L81 WeakPolarHBondContact O-CG 3.38Å; L77-L81 PolarHBondContact O-N 2.86Å; V78-L81 PolarHBondContact O-N 2.98Å; L81-M83 PolarHBondContact O-N 3.45Å; L81-P84 VanDerWaalsContact O-CD 3.31Å; L81-P84 WeakPolarHBondContact O-CD 3.47Å; L81-P84 WeakPolarHBondContact O-CG 3.37Å; L81-W85 WeakPolarHBondContact O-CA 3.44Å; L81-W85 WeakPolarHBondContact O-CB 3.29Å; L81-W85 PolarHBondContact O-N 3.4Å
82	V	74.6	Confident	69.4	Low	47 Å²	47	85.4 Å²	85.4	29%	0.285	47%	0.467	S	S	.	.	H	α-helix	trans	-60	-48.2	-175.7	160.6	0	0	0	0	112.1	V78 W85 V86 W133	V78-V82 HydrophobicContact CG1-CG2 3.87Å; V78-V82 WeakPolarHBondContact O-CB 3.16Å; V78-V82 WeakPolarHBondContact O-CG2 3.48Å; V78-V82 PolarHBondContact O-N 3.31Å; V82-W85 PolarHBondContact O-N 3.26Å; V82-V86 HydrophobicContact CG1-CG2 4.19Å; V82-V86 WeakPolarHBondContact O-CB 3.15Å; V82-V86 WeakPolarHBondContact O-CG2 3.44Å; V82-V86 PolarHBondContact O-N 3.06Å; V82-W133 HydrophobicContact CG1-CZ2 4.02Å
83	M	73.6	Confident	69.1	Low	115 Å²	115	88 Å²	88	57%	0.567	48%	0.481	S	S	*	.	H	α-helix	trans	-60.9	-51.1	-177	-82.8	-67.9	173.1	0	0	114	L81	L81-M83 PolarHBondContact O-N 3.45Å
84	P	67.8	Low	68.6	Low	76 Å²	76	87.2 Å²	87.2	49%	0.494	48%	0.479	S	S	.	.	H	α-helix	trans	-74.5	-30.4	176.3	26.9	-33	0	0	0	113.3	T80 L81 V87 Y88	T80-P84 WeakPolarHBondContact O-CD 3.28Å; T80-P84 WeakPolarHBondContact O-CG 3.25Å; L81-P84 VanDerWaalsContact O-CD 3.31Å; L81-P84 WeakPolarHBondContact O-CD 3.47Å; L81-P84 WeakPolarHBondContact O-CG 3.37Å; P84-V87 PolarHBondContact O-N 3.43Å; P84-Y88 VanDerWaalsContact O-CB 3.29Å; P84-Y88 WeakPolarHBondContact O-CB 3.27Å; P84-Y88 PolarHBondContact O-N 3.22Å
85	W	72.8	Confident	67.9	Low	156 Å²	156	86.6 Å²	86.6	59%	0.591	48%	0.477	S	S	*	.	H	α-helix	trans	-69.4	-39.2	-179.7	-170.7	-92.6	0	0	0	112.4	L81 V82 V87 Y88 L89	L81-W85 WeakPolarHBondContact O-CA 3.44Å; L81-W85 WeakPolarHBondContact O-CB 3.29Å; L81-W85 PolarHBondContact O-N 3.4Å; V82-W85 PolarHBondContact O-N 3.26Å; W85-V87 PolarHBondContact O-N 3.19Å; W85-Y88 PolarHBondContact O-N 3.42Å; W85-L89 VanDerWaalsContact CD1-CD1 3.46Å; W85-L89 VanDerWaalsContact NE1-CD1 3.28Å; W85-L89 WeakPolarHBondContact O-CB 3.41Å; W85-L89 WeakPolarHBondContact O-CG 3.49Å; W85-L89 PolarHBondContact O-N 3.39Å
86	V	71.4	Confident	66.7	Low	75 Å²	75	88.2 Å²	88.2	46%	0.455	48%	0.482	S	S	.	.	H	α-helix	trans	-60.3	-46.8	175.1	168.9	0	0	0	0	110.6	V82 L89 E90	V82-V86 HydrophobicContact CG1-CG2 4.19Å; V82-V86 WeakPolarHBondContact O-CB 3.15Å; V82-V86 WeakPolarHBondContact O-CG2 3.44Å; V82-V86 PolarHBondContact O-N 3.06Å; V86-L89 PolarHBondContact O-N 2.83Å; V86-E90 WeakPolarHBondContact O-CB 3.02Å; V86-E90 PolarHBondContact O-N 2.77Å
87	V	73.6	Confident	66	Low	85 Å²	85	88 Å²	88	52%	0.515	49%	0.489	S	S	.	.	H	α-helix	trans	-65.8	-41.7	177	175.1	0	0	0	0	111.3	P84 W85 L89 E90 V91	P84-V87 PolarHBondContact O-N 3.43Å; W85-V87 PolarHBondContact O-N 3.19Å; V87-L89 PolarHBondContact O-N 2.95Å; V87-E90 PolarHBondContact O-N 2.73Å; V87-V91 HydrophobicContact CG1-CG2 4.36Å; V87-V91 WeakPolarHBondContact O-CB 2.93Å; V87-V91 VanDerWaalsContact O-CG2 3.25Å; V87-V91 WeakPolarHBondContact O-CG2 3.47Å; V87-V91 PolarHBondContact O-N 3.06Å
88	Y	72.7	Confident	65.2	Low	118 Å²	118	93.7 Å²	93.7	46%	0.463	50%	0.504	S	S	.	.	H	α-helix	trans	-61.2	-45	177.3	-178.6	-91.3	0	0	0	111.9	P84 W85 V91 H92	P84-Y88 VanDerWaalsContact O-CB 3.29Å; P84-Y88 WeakPolarHBondContact O-CB 3.27Å; P84-Y88 PolarHBondContact O-N 3.22Å; W85-Y88 PolarHBondContact O-N 3.42Å; Y88-V91 PolarHBondContact O-N 2.89Å; Y88-H92 AromaticContact CD1-ND1 3.91Å; Y88-H92 AromaticContact CD2-CE1 3.75Å; Y88-H92 AromaticContact CD2-ND1 3.59Å; Y88-H92 HydrophobicContact CE1-CB 4.37Å; Y88-H92 AromaticContact CE1-CE1 3.99Å; Y88-H92 AromaticContact CE1-CG 3.82Å; Y88-H92 AromaticContact CE1-ND1 3.62Å; Y88-H92 AromaticContact CE2-CE1 3.07Å; Y88-H92 WeakPolarHBondContact CE2-CE1 3.37Å; Y88-H92 AromaticContact CE2-ND1 3.31Å; Y88-H92 VanDerWaalsContact CE2-ND1 3.31Å; Y88-H92 WeakPolarHBondContact CE2-ND1 2.82Å; Y88-H92 AromaticContact CE2-NE2 3.89Å; Y88-H92 AromaticContact CG-ND1 3.9Å; Y88-H92 AromaticContact CZ-CD2 3.94Å; Y88-H92 AromaticContact CZ-CE1 3.2Å; Y88-H92 AromaticContact CZ-CG 3.78Å; Y88-H92 AromaticContact CZ-ND1 3.31Å; Y88-H92 VanDerWaalsContact CZ-ND1 3.31Å; Y88-H92 AromaticContact CZ-NE2 3.61Å; Y88-H92 VanDerWaalsContact O-CB 3.27Å; Y88-H92 WeakPolarHBondContact O-CB 3.5Å; Y88-H92 PolarHBondContact O-N 3.37Å; Y88-H92 PolarHBondContact O-ND1 2.82Å; Y88-H92 PolarHBondContact OH-CE1 3.41Å; Y88-H92 PolarHBondContact OH-NE2 3.46Å
89	L	71.4	Confident	64	Low	84 Å²	84	93.2 Å²	93.2	44%	0.44	51%	0.505	S	S	.	.	H	α-helix	trans	-66.1	-41.5	175.7	-74.5	-178.9	0	0	0	111.8	W85 V86 V87 V91 C93	W85-L89 VanDerWaalsContact CD1-CD1 3.46Å; W85-L89 VanDerWaalsContact NE1-CD1 3.28Å; W85-L89 WeakPolarHBondContact O-CB 3.41Å; W85-L89 WeakPolarHBondContact O-CG 3.49Å; W85-L89 PolarHBondContact O-N 3.39Å; V86-L89 PolarHBondContact O-N 2.83Å; V87-L89 PolarHBondContact O-N 2.95Å; L89-V91 VanDerWaalsContact C-N 3.3Å; L89-V91 PolarHBondContact O-N 2.89Å; L89-C93 WeakPolarHBondContact O-CA 3.34Å; L89-C93 WeakPolarHBondContact O-CB 3.24Å; L89-C93 PolarHBondContact O-N 3.43Å
90	E	66.6	Low	63.1	Low	128 Å²	128	96.6 Å²	96.6	60%	0.598	52%	0.515	S	S	*	.	H	α-helix	trans	-60.9	-42.3	177.1	-173.6	174	-178.7	0	0	111.2	V86 V87 S94	V86-E90 WeakPolarHBondContact O-CB 3.02Å; V86-E90 PolarHBondContact O-N 2.77Å; V87-E90 PolarHBondContact O-N 2.73Å; E90-S94 WeakPolarHBondContact O-CB 3.12Å; E90-S94 PolarHBondContact O-N 2.84Å; E90-S94 PolarHBondContact O-OG 3.3Å
91	V	69.8	Low	62.1	Low	90 Å²	90	99.6 Å²	99.6	55%	0.545	54%	0.535	S	S	.	.	H	α-helix	trans	-75	-42.5	179.6	175.8	0	0	0	0	112.2	V87 Y88 L89 G95	V87-V91 HydrophobicContact CG1-CG2 4.36Å; V87-V91 WeakPolarHBondContact O-CB 2.93Å; V87-V91 VanDerWaalsContact O-CG2 3.25Å; V87-V91 WeakPolarHBondContact O-CG2 3.47Å; V87-V91 PolarHBondContact O-N 3.06Å; Y88-V91 PolarHBondContact O-N 2.89Å; L89-V91 VanDerWaalsContact C-N 3.3Å; L89-V91 PolarHBondContact O-N 2.89Å; V91-G95 PolarHBondContact O-N 3.14Å
92	H	65.9	Low	61.4	Low	101 Å²	101	98.5 Å²	98.5	47%	0.468	54%	0.541	S	S	.	.	H	α-helix	trans	-73.2	-38.7	178.7	-87.5	74.7	0	0	0	112.6	Y88 G95 H96	Y88-H92 AromaticContact CD1-ND1 3.91Å; Y88-H92 AromaticContact CD2-CE1 3.75Å; Y88-H92 AromaticContact CD2-ND1 3.59Å; Y88-H92 HydrophobicContact CE1-CB 4.37Å; Y88-H92 AromaticContact CE1-CE1 3.99Å; Y88-H92 AromaticContact CE1-CG 3.82Å; Y88-H92 AromaticContact CE1-ND1 3.62Å; Y88-H92 AromaticContact CE2-CE1 3.07Å; Y88-H92 WeakPolarHBondContact CE2-CE1 3.37Å; Y88-H92 AromaticContact CE2-ND1 3.31Å; Y88-H92 VanDerWaalsContact CE2-ND1 3.31Å; Y88-H92 WeakPolarHBondContact CE2-ND1 2.82Å; Y88-H92 AromaticContact CE2-NE2 3.89Å; Y88-H92 AromaticContact CG-ND1 3.9Å; Y88-H92 AromaticContact CZ-CD2 3.94Å; Y88-H92 AromaticContact CZ-CE1 3.2Å; Y88-H92 AromaticContact CZ-CG 3.78Å; Y88-H92 AromaticContact CZ-ND1 3.31Å; Y88-H92 VanDerWaalsContact CZ-ND1 3.31Å; Y88-H92 AromaticContact CZ-NE2 3.61Å; Y88-H92 VanDerWaalsContact O-CB 3.27Å; Y88-H92 WeakPolarHBondContact O-CB 3.5Å; Y88-H92 PolarHBondContact O-N 3.37Å; Y88-H92 PolarHBondContact O-ND1 2.82Å; Y88-H92 PolarHBondContact OH-CE1 3.41Å; Y88-H92 PolarHBondContact OH-NE2 3.46Å; H92-G95 CarbonylContact O-C 3.47Å; H92-G95 WeakPolarHBondContact O-CA 3.41Å; H92-G95 PolarHBondContact O-N 3.47Å; H92-H96 PolarHBondContact O-N 3.17Å
93	C	57.6	Low	59.9	Low	90 Å²	90	105 Å²	105	61%	0.608	56%	0.56	S	S	*	*	H	α-helix	trans	-72.4	-38	176.5	-154.1	0	0	0	0	110.6	L89 G95 H96 A97	L89-C93 WeakPolarHBondContact O-CA 3.34Å; L89-C93 WeakPolarHBondContact O-CB 3.24Å; L89-C93 PolarHBondContact O-N 3.43Å; C93-G95 VanDerWaalsContact C-N 3.25Å; C93-G95 PolarHBondContact O-N 3.31Å; C93-H96 PolarHBondContact O-N 3.08Å; C93-A97 VanDerWaalsContact O-CB 3.24Å; C93-A97 WeakPolarHBondContact O-CB 2.78Å; C93-A97 PolarHBondContact O-N 3.41Å
94	S	55.5	Low	58.5	Low	57 Å²	57	109.7 Å²	109.7	40%	0.399	58%	0.58	S	S	.	*	H	α-helix	trans	-68.4	-23.2	167.9	-67.1	0	0	0	0	113.5	E90 R98	E90-S94 WeakPolarHBondContact O-CB 3.12Å; E90-S94 PolarHBondContact O-N 2.84Å; E90-S94 PolarHBondContact O-OG 3.3Å; S94-R98 PolarHBondContact O-N 3.17Å; S94-R98 PolarHBondContact O-NE 3.35Å
95	G	53.4	Low	57.5	Low	36 Å²	36	108 Å²	108	37%	0.371	58%	0.576	S	S	.	*	H	α-helix	trans	-72	-43.1	171.2	0	0	0	0	0	111.6	V91 H92 C93 R98 S99	V91-G95 PolarHBondContact O-N 3.14Å; H92-G95 CarbonylContact O-C 3.47Å; H92-G95 WeakPolarHBondContact O-CA 3.41Å; H92-G95 PolarHBondContact O-N 3.47Å; C93-G95 VanDerWaalsContact C-N 3.25Å; C93-G95 PolarHBondContact O-N 3.31Å; G95-R98 PolarHBondContact O-N 3.12Å; G95-S99 PolarHBondContact O-OG 2.78Å
96	H	49	Very low	56.3	Low	137 Å²	137	106.4 Å²	106.4	63%	0.634	58%	0.584	S	S	*	*	H	α-helix	trans	-79	-29.3	179.6	-134.1	55.2	0	0	0	113.4	H92 C93 R98 S99 L100	H92-H96 PolarHBondContact O-N 3.17Å; C93-H96 PolarHBondContact O-N 3.08Å; H96-R98 VanDerWaalsContact C-N 3.27Å; H96-R98 PolarHBondContact O-N 3.09Å; H96-S99 WeakPolarHBondContact CA-OG 3.29Å; H96-S99 PolarHBondContact O-N 3.34Å; H96-S99 VanDerWaalsContact O-N 3.17Å; H96-S99 PolarHBondContact O-OG 3.12Å; H96-L100 PolarHBondContact O-N 3.49Å
97	A	50.7	Low	55.1	Low	60 Å²	60	111.2 Å²	111.2	50%	0.496	60%	0.602	S	S	.	*	H	α-helix	trans	-70.8	-20.3	171	0	0	0	0	0	113.1	C93	C93-A97 VanDerWaalsContact O-CB 3.24Å; C93-A97 WeakPolarHBondContact O-CB 2.78Å; C93-A97 PolarHBondContact O-N 3.41Å
98	R	47.8	Very low	53.9	Low	211 Å²	211	114.9 Å²	114.9	80%	0.796	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.6	-15.6	168.8	-86.5	-171.6	-84	-166.3	-6.4	113.8	S94 G95 H96	S94-R98 PolarHBondContact O-N 3.17Å; S94-R98 PolarHBondContact O-NE 3.35Å; G95-R98 PolarHBondContact O-N 3.12Å; H96-R98 VanDerWaalsContact C-N 3.27Å; H96-R98 PolarHBondContact O-N 3.09Å
99	S	46.1	Very low	52.7	Low	77 Å²	77	117.1 Å²	117.1	54%	0.538	64%	0.637	S	S	.	*	T	Hydrogen-bonded Turn	trans	-99.6	-9.6	175	45.4	0	0	0	0	114.3	G95 H96	G95-S99 PolarHBondContact O-OG 2.78Å; H96-S99 WeakPolarHBondContact CA-OG 3.29Å; H96-S99 PolarHBondContact O-N 3.34Å; H96-S99 VanDerWaalsContact O-N 3.17Å; H96-S99 PolarHBondContact O-OG 3.12Å
100	L	50.1	Low	51.4	Low	123 Å²	123	119 Å²	119	64%	0.644	66%	0.657	S	S	*	*	S	Bend	trans	-77.9	121.8	161.3	-81.5	154.2	0	0	0	107.3	H96 A102	H96-L100 PolarHBondContact O-N 3.49Å; L100-A102 VanDerWaalsContact C-N 3.25Å; L100-A102 PolarHBondContact O-N 3.44Å
101	P	46.6	Very low	50	Low	126 Å²	126	116.6 Å²	116.6	82%	0.818	66%	0.659	S	S	*	*			trans	-64.7	91.8	178	27	-32.5	0	0	0	108.6	W103	P101-W103 VanDerWaalsContact C-N 3.26Å; P101-W103 PolarHBondContact O-N 3.2Å
102	A	52.3	Low	48.6	Very low	76 Å²	76	124.6 Å²	124.6	63%	0.628	68%	0.679	S	S	*	*			trans	-69.2	90.4	167.5	0	0	0	0	0	107.3	L100	L100-A102 VanDerWaalsContact C-N 3.25Å; L100-A102 PolarHBondContact O-N 3.44Å
103	W	43.3	Very low	47.5	Very low	185 Å²	185	123.1 Å²	123.1	70%	0.701	69%	0.692	S	S	*	*			trans	71.7	80.8	150.7	-47.1	100	0	0	0	117.4	P101 G105 T106	P101-W103 VanDerWaalsContact C-N 3.26Å; P101-W103 PolarHBondContact O-N 3.2Å; W103-G105 VanDerWaalsContact C-N 3.3Å; W103-T106 HydrophobicContact CB-CG2 4.25Å
104	H	44.8	Very low	47.5	Very low	212 Å²	212	124.4 Å²	124.4	98%	0.981	70%	0.699	S	S	*	*	S	Bend	trans	-90.4	77.6	130.8	-150.6	18.2	0	0	0	106.9
105	G	45.8	Very low	47.3	Very low	40 Å²	40	130.2 Å²	130.2	41%	0.412	72%	0.719	S	S	.	*			trans	175.7	28.5	-172.2	0	0	0	0	0	116.9	W103 E107	W103-G105 VanDerWaalsContact C-N 3.3Å; G105-E107 PolarHBondContact O-N 3.15Å
106	T	48	Very low	46.5	Very low	124 Å²	124	135.8 Å²	135.8	76%	0.761	74%	0.741	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.5	11.9	171.4	44	0	0	0	0	113.8	W103	W103-T106 HydrophobicContact CB-CG2 4.25Å
107	E	47.4	Very low	46.7	Very low	175 Å²	175	138.5 Å²	138.5	82%	0.818	75%	0.753	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.9	4.6	-176.6	-61.6	-151.7	103.1	0	0	115.7	G105	G105-E107 PolarHBondContact O-N 3.15Å
108	L	46.3	Very low	46.4	Very low	163 Å²	163	139.3 Å²	139.3	85%	0.853	77%	0.768	S	S	*	*	S	Bend	trans	-126.7	33.4	-178.4	-75.5	175.6	0	0	0	115.6
109	L	47.6	Very low	46.1	Very low	164 Å²	164	139.4 Å²	139.4	86%	0.859	77%	0.768	S	S	*	*			trans	-121.6	31.2	161.1	-95.6	147.4	0	0	0	111.8	A111	L109-A111 PolarHBondContact O-N 3.26Å
110	S	44.3	Very low	46.1	Very low	123 Å²	123	143.6 Å²	143.6	86%	0.86	78%	0.784	S	S	*	*			trans	-87.2	50.5	156.4	-177.2	0	0	0	0	110.8
111	A	37.2	Very low	46	Very low	79 Å²	79	140.3 Å²	140.3	65%	0.653	78%	0.779	S	S	*	*			trans	-145.5	76.2	173.7	0	0	0	0	0	111.3	L109	L109-A111 PolarHBondContact O-N 3.26Å
112	R	42.1	Very low	46.1	Very low	257 Å²	257	139.7 Å²	139.7	97%	0.97	77%	0.773	S	S	*	*			trans	8.8	117.4	137.2	-157.8	177.4	-163.9	-175.6	3.4	116.8
113	G	41	Very low	45.6	Very low	70 Å²	70	138.3 Å²	138.3	72%	0.722	77%	0.766	S	S	*	*			trans	178	113.5	160.4	0	0	0	0	0	112.8
114	P	58.9	Low	45.7	Very low	117 Å²	117	133.7 Å²	133.7	76%	0.76	76%	0.755	S	S	*	*			trans	-85.9	158.2	179	36.6	-32.2	0	0	0	110.9
115	H	50.1	Low	45.8	Very low	179 Å²	179	129.3 Å²	129.3	83%	0.829	75%	0.747	S	S	*	*			trans	82.6	98.3	-172.6	-74.6	-114.2	0	0	0	115.1
116	D	37.7	Very low	45.7	Very low	153 Å²	153	132.7 Å²	132.7	82%	0.818	76%	0.763	S	S	*	*				-172.7	146.5	100.3	-112.6	-42.9	0	0	0	113.1
117	H	51.8	Low	45.6	Very low	194 Å²	194	131.3 Å²	131.3	90%	0.898	75%	0.754	S	S	*	*			trans	-57.4	129	173.9	-90.3	-110.1	0	0	0	111
118	G	45.4	Very low	45.6	Very low	78 Å²	78	127.3 Å²	127.3	80%	0.804	74%	0.738	S	S	*	*			trans	145.9	20.1	163	0	0	0	0	0	119.2
119	R	41.1	Very low	45.8	Very low	213 Å²	213	123.7 Å²	123.7	80%	0.804	72%	0.724	S	S	*	*			trans	-127.1	44.5	179.1	-116.9	179	-177.2	-114	4	115.2	G121	R119-G121 PolarHBondContact O-N 3.23Å
120	L	47.4	Very low	45.8	Very low	165 Å²	165	120 Å²	120	86%	0.864	71%	0.712	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.4	81	146.8	-97.2	86.9	0	0	0	107.6	L124	L120-L124 HydrophobicContact CD2-CD1 4.42Å
121	G	47.9	Very low	45.9	Very low	54 Å²	54	117.5 Å²	117.5	56%	0.557	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-144	-24.6	-178.4	0	0	0	0	0	115.1	R119	R119-G121 PolarHBondContact O-N 3.23Å
122	T	47	Very low	46.6	Very low	112 Å²	112	119.3 Å²	119.3	69%	0.687	70%	0.697	S	S	*	*	S	Bend	trans	-118.9	0.5	-170.7	55.6	0	0	0	0	114.1
123	G	42.8	Very low	46.7	Very low	47 Å²	47	116 Å²	116	49%	0.485	69%	0.685	S	S	.	*	S	Bend	trans	-100.7	-15.2	173.6	0	0	0	0	0	114.6
124	L	45.9	Very low	46.5	Very low	89 Å²	89	123.2 Å²	123.2	47%	0.466	71%	0.706	S	S	.	*	H	α-helix	trans	-74.6	-30	-173.5	-95.3	83.4	0	0	0	113.5	L120 C126 V127 L128	L120-L124 HydrophobicContact CD2-CD1 4.42Å; L124-C126 VanDerWaalsContact C-N 3.27Å; L124-C126 PolarHBondContact O-N 2.73Å; L124-V127 PolarHBondContact O-N 3.2Å; L124-L128 HydrophobicContact CB-CD1 4.28Å; L124-L128 HydrophobicContact CD2-CD1 4.23Å; L124-L128 HydrophobicContact CG-CD1 4.36Å; L124-L128 WeakPolarHBondContact O-CD1 3.4Å; L124-L128 PolarHBondContact O-N 3.33Å
125	C	46.2	Very low	45.9	Very low	119 Å²	119	123.6 Å²	123.6	80%	0.804	70%	0.703	S	S	*	*	H	α-helix	trans	-66.3	-24.2	-176.2	-83.6	0	0	0	0	114.5
126	C	43.8	Very low	45.6	Very low	112 Å²	112	120.6 Å²	120.6	76%	0.757	70%	0.697	S	S	*	*	H	α-helix	trans	-95.9	-13.9	178.1	-57.2	0	0	0	0	113.4	L124 P129	L124-C126 VanDerWaalsContact C-N 3.27Å; L124-C126 PolarHBondContact O-N 2.73Å; C126-P129 WeakPolarHBondContact O-CD 3.37Å
127	V	46.2	Very low	46.1	Very low	94 Å²	94	118.8 Å²	118.8	57%	0.57	69%	0.69	S	S	*	*	H	α-helix	trans	-96.2	-11.5	178.9	-178.4	0	0	0	0	112	L124 S131	L124-V127 PolarHBondContact O-N 3.2Å; V127-S131 PolarHBondContact O-OG 2.94Å
128	L	48	Very low	45.7	Very low	92 Å²	92	114.4 Å²	114.4	48%	0.482	68%	0.678	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.2	-16.9	-178.9	-110.1	74.9	0	0	0	117.8	L124 S130	L124-L128 HydrophobicContact CB-CD1 4.28Å; L124-L128 HydrophobicContact CD2-CD1 4.23Å; L124-L128 HydrophobicContact CG-CD1 4.36Å; L124-L128 WeakPolarHBondContact O-CD1 3.4Å; L124-L128 PolarHBondContact O-N 3.33Å; L128-S130 VanDerWaalsContact C-N 3.29Å; L128-S130 PolarHBondContact O-N 3.4Å
129	P	49.6	Very low	45.8	Very low	86 Å²	86	116.7 Å²	116.7	56%	0.558	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.8	-18.7	178.9	29.3	-29.3	0	0	0	112.6	C126	C126-P129 WeakPolarHBondContact O-CD 3.37Å
130	S	47.5	Very low	46.1	Very low	86 Å²	86	110.3 Å²	110.3	60%	0.601	66%	0.661	S	S	*	*	S	Bend	trans	-87.4	-14.7	179.3	-10.8	0	0	0	0	113.8	L128	L128-S130 VanDerWaalsContact C-N 3.29Å; L128-S130 PolarHBondContact O-N 3.4Å
131	S	45.8	Very low	46	Very low	72 Å²	72	106.4 Å²	106.4	50%	0.503	65%	0.646	S	S	.	*	S	Bend	trans	-103.8	0.1	-174.1	25.7	0	0	0	0	114.1	V127	V127-S131 PolarHBondContact O-OG 2.94Å
132	V	52.3	Low	45.8	Very low	117 Å²	117	110.4 Å²	110.4	71%	0.709	65%	0.653	S	S	*	*	S	Bend	trans	-93.6	-7.2	172.9	172.9	0	0	0	0	112.1
133	W	44.6	Very low	45.7	Very low	187 Å²	187	110.3 Å²	110.3	71%	0.708	65%	0.65	S	S	*	*			trans	-107.2	19.9	-178.9	-76.9	102.2	0	0	0	114.3	V82	V82-W133 HydrophobicContact CG1-CZ2 4.02Å
134	L	36.4	Very low	46	Very low	222 Å²	222	116 Å²	116	100%	1.162	67%	0.666	S	S	*	*			trans	-132.4	0	175.7	-102.4	153.2	0	0	0	111.6

Retrieved 134 of 134 residues in 31.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).