X5DQZ7_HUMAN Loading...

Glutathione peroxidase 1 isoform A

AlphaFold DB , UniProt , Accession X5DQZ7, Species HUMAN (Homo sapiens, Human), Gene GPX1, Length 46 aa.

						>X5DQZ7_HUMAN|X5DQZ7|GPX1
MCAARLAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.2	Low	60.6	Low	192 Å²	192	95.9 Å²	95.9	95%	0.946	61%	0.611	S	S	*	*				0	-40.7	0	-74.1	-174.3	-173.7	0	0	113.8	R5	M1-R5 PolarHBondContact O-N 3.28Å; M1-R5 WeakPolarHBondContact O-CG 3.37Å
2	C	60.7	Low	62.4	Low	102 Å²	102	104.8 Å²	104.8	69%	0.689	64%	0.639	S	S	*	*	H	α-helix	trans	-62.7	-48.8	-178.7	-120.2	0	0	0	0	114.1	A4 R5 L6	C2-A4 PolarHBondContact O-N 3.39Å; C2-R5 PolarHBondContact O-N 3.01Å; C2-L6 PolarHBondContact O-N 3.32Å
3	A	59.9	Low	64.6	Low	79 Å²	79	100.7 Å²	100.7	65%	0.653	62%	0.617	S	S	*	*	H	α-helix	trans	-64	-38.9	-177.5	0	0	0	0	0	113.6	L6 A7	A3-L6 PolarHBondContact O-N 3.42Å; A3-A7 WeakPolarHBondContact O-CB 3.5Å; A3-A7 PolarHBondContact O-N 3.13Å
4	A	59.2	Low	66.8	Low	69 Å²	69	97.4 Å²	97.4	57%	0.57	60%	0.597	S	S	*	*	H	α-helix	trans	-67.8	-36	177.3	0	0	0	0	0	112.5	C2 A8	C2-A4 PolarHBondContact O-N 3.39Å; A4-A8 WeakPolarHBondContact O-CB 3.32Å; A4-A8 PolarHBondContact O-N 2.9Å
5	R	60.1	Low	68.6	Low	185 Å²	185	95.5 Å²	95.5	70%	0.698	58%	0.575	S	S	*	*	H	α-helix	trans	-67.4	-40.4	174.2	-76.7	-179.8	170.4	156.9	-1.8	111.9	M1 C2 A9	M1-R5 PolarHBondContact O-N 3.28Å; M1-R5 WeakPolarHBondContact O-CG 3.37Å; C2-R5 PolarHBondContact O-N 3.01Å; R5-A9 WeakPolarHBondContact O-CB 3.46Å; R5-A9 PolarHBondContact O-N 3.05Å
6	L	58.6	Low	70.2	Confident	123 Å²	123	94.3 Å²	94.3	64%	0.644	58%	0.578	S	S	*	*	H	α-helix	trans	-65.8	-42.6	174.9	-78.4	155.6	0	0	0	112	C2 A3 A9 A10	C2-L6 PolarHBondContact O-N 3.32Å; A3-L6 PolarHBondContact O-N 3.42Å; L6-A9 PolarHBondContact O-N 3.35Å; L6-A10 PolarHBondContact O-N 3.45Å
7	A	60.9	Low	71.7	Confident	63 Å²	63	93.7 Å²	93.7	52%	0.521	57%	0.566	S	S	.	*	H	α-helix	trans	-64.5	-41.6	176.6	0	0	0	0	0	112.3	A3 A9 A10 A11	A3-A7 WeakPolarHBondContact O-CB 3.5Å; A3-A7 PolarHBondContact O-N 3.13Å; A7-A9 VanDerWaalsContact C-N 3.35Å; A7-A10 PolarHBondContact O-N 3.15Å; A7-A11 PolarHBondContact O-N 3.35Å; A7-A11 VanDerWaalsContact O-N 3.13Å
8	A	59.8	Low	73	Confident	49 Å²	49	92.7 Å²	92.7	41%	0.405	56%	0.564	S	S	.	*	H	α-helix	trans	-65.5	-37.3	175.2	0	0	0	0	0	112.3	A4 A10 A11 F17	A4-A8 WeakPolarHBondContact O-CB 3.32Å; A4-A8 PolarHBondContact O-N 2.9Å; A8-A10 VanDerWaalsContact C-N 3.28Å; A8-A10 PolarHBondContact O-N 3.26Å; A8-A11 PolarHBondContact O-N 3.17Å; A8-F17 HydrophobicContact CB-CE1 4.25Å; A8-F17 HydrophobicContact CB-CZ 4.35Å
9	A	60.4	Low	74.3	Confident	89 Å²	89	90.9 Å²	90.9	74%	0.736	56%	0.56	S	S	*	*	H	α-helix	trans	-69.4	-24.5	175.7	0	0	0	0	0	113.3	R5 L6 A7	R5-A9 WeakPolarHBondContact O-CB 3.46Å; R5-A9 PolarHBondContact O-N 3.05Å; L6-A9 PolarHBondContact O-N 3.35Å; A7-A9 VanDerWaalsContact C-N 3.35Å
10	A	62	Low	75.5	Confident	75 Å²	75	95.2 Å²	95.2	62%	0.62	57%	0.565	S	S	*	*	H	α-helix	trans	-87	-19.8	177	0	0	0	0	0	113.6	L6 A7 A8 Q12	L6-A10 PolarHBondContact O-N 3.45Å; A7-A10 PolarHBondContact O-N 3.15Å; A8-A10 VanDerWaalsContact C-N 3.28Å; A8-A10 PolarHBondContact O-N 3.26Å; A10-Q12 PolarHBondContact O-N 3.1Å
11	A	65.6	Low	76.5	Confident	29 Å²	29	93.4 Å²	93.4	24%	0.24	56%	0.556	C	S	.	*			trans	-76.9	103.8	-178.4	0	0	0	0	0	111	A7 A8 S13 A16 F17	A7-A11 PolarHBondContact O-N 3.35Å; A7-A11 VanDerWaalsContact O-N 3.13Å; A8-A11 PolarHBondContact O-N 3.17Å; A11-S13 PolarHBondContact O-N 3.31Å; A11-A16 HydrophobicContact CB-CB 3.8Å; A11-F17 HydrophobicContact CB-CE2 3.57Å; A11-F17 HydrophobicContact CB-CZ 3.5Å; A11-F17 VanDerWaalsContact CB-CZ 3.5Å; A11-F17 HydrophobicContact CB-CE1 4.47Å
12	Q	82.8	Confident	78.3	Confident	203 Å²	203	93 Å²	93	95%	0.949	56%	0.557	S	S	*	*			trans	-73.6	-9.9	-179.8	-64.1	178.1	-24.4	0	0	113.7	A10	A10-Q12 PolarHBondContact O-N 3.1Å
13	S	91.3	Very high	80.1	Confident	51 Å²	51	93.2 Å²	93.2	36%	0.357	57%	0.566	S	S	.	*	S	Bend	trans	-147	151.9	-175.3	176.2	0	0	0	0	111.3	A11 Y15 A16	A11-S13 PolarHBondContact O-N 3.31Å; S13-Y15 PolarHBondContact O-N 3.36Å; S13-Y15 VanDerWaalsContact O-N 3.1Å; S13-Y15 VanDerWaalsContact OG-CD2 3.24Å; S13-Y15 WeakPolarHBondContact OG-CD2 3.34Å; S13-Y15 PolarHBondContact OG-N 3.03Å; S13-A16 PolarHBondContact O-N 3.27Å
14	V	94.1	Very high	81.8	Confident	55 Å²	55	91.2 Å²	91.2	33%	0.333	55%	0.553	S	S	.	*	G	3₁₀ helix	trans	-57.5	-21.7	173.6	-61.7	0	0	0	0	113.1	A16 F17 L30 I40	V14-A16 VanDerWaalsContact O-N 3.15Å; V14-A16 PolarHBondContact O-N 3.42Å; V14-F17 WeakPolarHBondContact O-CD2 3.37Å; V14-F17 PolarHBondContact O-N 3.04Å; V14-F17 VanDerWaalsContact O-N 3.1Å; V14-L30 HydrophobicContact CB-CD1 4.08Å; V14-L30 WeakPolarHBondContact O-CB 3.39Å; V14-I40 HydrophobicContact CG1-CD1 4.49Å
15	Y	94.9	Very high	83.5	Confident	69 Å²	69	90.4 Å²	90.4	27%	0.271	55%	0.551	S	S	.	*	G	3₁₀ helix	trans	-67.6	-13.1	-177.5	-55.6	-33.3	0	0	0	114.9	S13 F17 L30 R34	S13-Y15 PolarHBondContact O-N 3.36Å; S13-Y15 VanDerWaalsContact O-N 3.1Å; S13-Y15 VanDerWaalsContact OG-CD2 3.24Å; S13-Y15 WeakPolarHBondContact OG-CD2 3.34Å; S13-Y15 PolarHBondContact OG-N 3.03Å; Y15-F17 PolarHBondContact O-N 3.3Å; Y15-L30 WeakPolarHBondContact CD1-O 3.24Å; Y15-R34 WeakPolarHBondContact OH-CA 3.49Å; Y15-R34 HydrophobicContact CE2-CB 4.31Å; Y15-R34 HydrophobicContact CE1-CB 4.35Å; Y15-R34 HydrophobicContact CE2-CG 3.96Å
16	A	94.5	Very high	85.2	Confident	75 Å²	75	89 Å²	89	62%	0.62	55%	0.553	S	S	*	*	G	3₁₀ helix	trans	-79.1	-6.8	173.8	0	0	0	0	0	113.4	A11 S13 V14	A11-A16 HydrophobicContact CB-CB 3.8Å; S13-A16 PolarHBondContact O-N 3.27Å; V14-A16 VanDerWaalsContact O-N 3.15Å; V14-A16 PolarHBondContact O-N 3.42Å
17	F	94.6	Very high	87.1	Confident	85 Å²	85	85.6 Å²	85.6	37%	0.373	54%	0.538	S	S	.	.			trans	-110.1	154.1	-173.5	-57.1	-85.5	0	0	0	112.2	A8 A11 V14 Y15 L30	A8-F17 HydrophobicContact CB-CE1 4.25Å; A8-F17 HydrophobicContact CB-CZ 4.35Å; A11-F17 HydrophobicContact CB-CE2 3.57Å; A11-F17 HydrophobicContact CB-CZ 3.5Å; A11-F17 VanDerWaalsContact CB-CZ 3.5Å; A11-F17 HydrophobicContact CB-CE1 4.47Å; V14-F17 WeakPolarHBondContact O-CD2 3.37Å; V14-F17 PolarHBondContact O-N 3.04Å; V14-F17 VanDerWaalsContact O-N 3.1Å; Y15-F17 PolarHBondContact O-N 3.3Å; F17-L30 PolarHBondContact O-N 3.06Å; F17-L30 HydrophobicContact CB-CD1 4.25Å
18	S	96.3	Very high	88.9	Confident	75 Å²	75	86.1 Å²	86.1	52%	0.524	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	156.8	169.6	62.1	0	0	0	0	110.5	V28	S18-V28 CarbonylContact C-O 3.57Å; S18-V28 WeakPolarHBondContact CA-O 3.43Å; S18-V28 VanDerWaalsContact CB-O 3.24Å; S18-V28 WeakPolarHBondContact CB-O 3.48Å
19	A	97	Very high	90.7	Very high	60 Å²	60	86.5 Å²	86.5	50%	0.496	53%	0.534	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.8	150.3	177.5	0	0	0	0	0	110.6	P27 V28	A19-P27 WeakPolarHBondContact O-CA 3.48Å; A19-V28 PolarHBondContact N-O 2.68Å; A19-V28 PolarHBondContact O-N 2.98Å
20	R	97.9	Very high	92.4	Very high	176 Å²	176	84.3 Å²	84.3	66%	0.664	51%	0.509	S	S	*	.			trans	-81.3	135.7	174	-73.1	-175.7	-165.9	-82	-0.8	110.3	G25 P27	R20-G25 PolarHBondContact NH1-O 3.5Å; R20-P27 HydrophobicContact CG-CG 4.24Å
21	P	97.7	Very high	94.1	Very high	57 Å²	57	82 Å²	82	37%	0.37	49%	0.494	S	S	.	.			trans	-60.8	155.7	172.3	-21.9	33.2	0	0	0	112.3	A23 G24 E26 V28	P21-A23 VanDerWaalsContact C-N 3.26Å; P21-A23 PolarHBondContact O-N 3.1Å; P21-G24 WeakPolarHBondContact O-CA 3.38Å; P21-G24 PolarHBondContact O-N 2.97Å; P21-E26 WeakPolarHBondContact CD-O 3.39Å; P21-V28 HydrophobicContact CG-CG2 3.89Å
22	L	96.5	Very high	95.6	Very high	185 Å²	185	84.8 Å²	84.8	97%	0.969	51%	0.511	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.3	-38.6	176.3	-179.4	63.7	0	0	0	112.3	G24	L22-G24 PolarHBondContact O-N 3.09Å; L22-G24 VanDerWaalsContact O-N 3.13Å
23	A	97.4	Very high	96.4	Very high	106 Å²	106	78.3 Å²	78.3	88%	0.876	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71	1.2	176.2	0	0	0	0	0	113.8	P21	P21-A23 VanDerWaalsContact C-N 3.26Å; P21-A23 PolarHBondContact O-N 3.1Å
24	G	95.2	Very high	96.7	Very high	37 Å²	37	84.8 Å²	84.8	38%	0.381	50%	0.499	S	S	.	.			trans	81.8	-167.5	-171.7	0	0	0	0	0	113.2	P21 L22	P21-G24 WeakPolarHBondContact O-CA 3.38Å; P21-G24 PolarHBondContact O-N 2.97Å; L22-G24 PolarHBondContact O-N 3.09Å; L22-G24 VanDerWaalsContact O-N 3.13Å
25	G	95.3	Very high	96.8	Very high	51 Å²	51	85.8 Å²	85.8	53%	0.526	52%	0.521	S	S	.	.			trans	98.2	-159.5	176.8	0	0	0	0	0	115.5	R20	R20-G25 PolarHBondContact NH1-O 3.5Å
26	E	97.4	Very high	97	Very high	157 Å²	157	89.5 Å²	89.5	73%	0.734	54%	0.538	S	S	*	.	S	Bend	trans	-67.2	139.8	-177.5	-72.5	-54.2	129	0	0	111.7	P21 V28	P21-E26 WeakPolarHBondContact CD-O 3.39Å; E26-V28 PolarHBondContact O-N 3.22Å
27	P	98	Very high	97.1	Very high	51 Å²	51	93.1 Å²	93.1	33%	0.331	55%	0.552	S	S	.	*	P	Polyproline II helix	trans	-59.1	133.6	174.4	-22.8	34	0	0	0	112	A19 R20	A19-P27 WeakPolarHBondContact O-CA 3.48Å; R20-P27 HydrophobicContact CG-CG 4.24Å
28	V	97.6	Very high	97.3	Very high	74 Å²	74	92.2 Å²	92.2	45%	0.448	55%	0.551	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.8	121.1	173.7	179.2	0	0	0	0	108.7	S18 A19 P21 E26	S18-V28 CarbonylContact C-O 3.57Å; S18-V28 WeakPolarHBondContact CA-O 3.43Å; S18-V28 VanDerWaalsContact CB-O 3.24Å; S18-V28 WeakPolarHBondContact CB-O 3.48Å; A19-V28 PolarHBondContact N-O 2.68Å; A19-V28 PolarHBondContact O-N 2.98Å; P21-V28 HydrophobicContact CG-CG2 3.89Å; E26-V28 PolarHBondContact O-N 3.22Å
29	S	97.4	Very high	97.4	Very high	56 Å²	56	95.6 Å²	95.6	39%	0.392	56%	0.562	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-73.3	129.6	171.8	174.8	0	0	0	0	110.8	G31 S32	S29-G31 VanDerWaalsContact OG-N 3.09Å; S29-G31 PolarHBondContact OG-N 2.83Å; S29-G31 PolarHBondContact O-N 3.22Å; S29-S32 WeakPolarHBondContact O-CB 3.24Å; S29-S32 PolarHBondContact O-N 3.19Å; S29-S32 PolarHBondContact O-OG 3.21Å
30	L	97.5	Very high	97.4	Very high	43 Å²	43	98.5 Å²	98.5	23%	0.225	57%	0.568	C	S	.	*	G	3₁₀ helix	trans	-65.8	-17.9	172.5	-61	-175.9	0	0	0	112	V14 Y15 F17 S32 L33	V14-L30 HydrophobicContact CB-CD1 4.08Å; V14-L30 WeakPolarHBondContact O-CB 3.39Å; Y15-L30 WeakPolarHBondContact CD1-O 3.24Å; F17-L30 PolarHBondContact O-N 3.06Å; F17-L30 HydrophobicContact CB-CD1 4.25Å; L30-S32 PolarHBondContact O-N 3.04Å; L30-L33 HydrophobicContact CD2-CD1 4.41Å; L30-L33 WeakPolarHBondContact O-CB 3.12Å; L30-L33 PolarHBondContact O-N 3.41Å
31	G	97.3	Very high	97.4	Very high	28 Å²	28	96.7 Å²	96.7	29%	0.289	57%	0.567	S	S	.	*	G	3₁₀ helix	trans	-58.5	-26.7	172.7	0	0	0	0	0	113.7	S29 L33 R34	S29-G31 VanDerWaalsContact OG-N 3.09Å; S29-G31 PolarHBondContact OG-N 2.83Å; S29-G31 PolarHBondContact O-N 3.22Å; G31-L33 PolarHBondContact O-N 3Å; G31-R34 PolarHBondContact O-N 3.32Å
32	S	97.9	Very high	97.4	Very high	86 Å²	86	101.8 Å²	101.8	60%	0.601	59%	0.591	S	S	*	*	G	3₁₀ helix	trans	-65.1	-16.6	175.2	65	0	0	0	0	113.9	S29 L30	S29-S32 WeakPolarHBondContact O-CB 3.24Å; S29-S32 PolarHBondContact O-N 3.19Å; S29-S32 PolarHBondContact O-OG 3.21Å; L30-S32 PolarHBondContact O-N 3.04Å
33	L	97.9	Very high	97.4	Very high	67 Å²	67	99 Å²	99	35%	0.351	58%	0.582	S	S	.	*	G	3₁₀ helix	trans	-98	14.9	-178.7	-58.2	175	0	0	0	113.1	L30 G31 G35 K36 L38	L30-L33 HydrophobicContact CD2-CD1 4.41Å; L30-L33 WeakPolarHBondContact O-CB 3.12Å; L30-L33 PolarHBondContact O-N 3.41Å; G31-L33 PolarHBondContact O-N 3Å; L33-G35 PolarHBondContact O-N 3.13Å; L33-K36 WeakPolarHBondContact O-CB 3.47Å; L33-K36 PolarHBondContact O-N 2.94Å; L33-L38 HydrophobicContact CB-CD1 4.1Å; L33-L38 HydrophobicContact CB-CD2 4.12Å; L33-L38 HydrophobicContact CD1-CD1 3.96Å; L33-L38 HydrophobicContact CD1-CD2 3.83Å
34	R	97.3	Very high	97.4	Very high	188 Å²	188	98.7 Å²	98.7	71%	0.709	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.7	133.8	176.3	-170.3	177.5	-177.2	93.3	-0.7	110.9	Y15 G31	Y15-R34 WeakPolarHBondContact OH-CA 3.49Å; Y15-R34 HydrophobicContact CE2-CB 4.31Å; Y15-R34 HydrophobicContact CE1-CB 4.35Å; Y15-R34 HydrophobicContact CE2-CG 3.96Å; G31-R34 PolarHBondContact O-N 3.32Å
35	G	97.2	Very high	97.4	Very high	76 Å²	76	102.9 Å²	102.9	78%	0.784	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	86	2.3	-175.4	0	0	0	0	0	114.6	L33	L33-G35 PolarHBondContact O-N 3.13Å
36	K	98.4	Very high	97	Very high	147 Å²	147	112.4 Å²	112.4	64%	0.639	64%	0.64	S	S	*	*	S	Bend	trans	-104.7	146.9	168.4	-56.7	-63.3	-179.3	-179.7	0	110.7	L33 L38	L33-K36 WeakPolarHBondContact O-CB 3.47Å; L33-K36 PolarHBondContact O-N 2.94Å; K36-L38 HydrophobicContact CB-CD2 4.09Å
37	V	97.9	Very high	96.9	Very high	151 Å²	151	110.2 Å²	110.2	92%	0.915	64%	0.636	S	S	*	*			trans	-82.9	131.2	165.3	179.8	0	0	0	0	107.5
38	L	97.7	Very high	96.9	Very high	66 Å²	66	113.3 Å²	113.3	35%	0.346	65%	0.652	S	S	.	*			trans	-118.5	133.5	-175.3	-55.8	-179.1	0	0	0	110.6	L33 K36	L33-L38 HydrophobicContact CB-CD1 4.1Å; L33-L38 HydrophobicContact CB-CD2 4.12Å; L33-L38 HydrophobicContact CD1-CD1 3.96Å; L33-L38 HydrophobicContact CD1-CD2 3.83Å; K36-L38 HydrophobicContact CB-CD2 4.09Å
39	L	98.2	Very high	96.8	Very high	145 Å²	145	115.5 Å²	115.5	76%	0.759	66%	0.663	S	S	*	*			trans	-106.1	128	163.2	-178.7	62.6	0	0	0	107.6	E41	L39-E41 HydrophobicContact CD2-CG 4.5Å; L39-E41 VanDerWaalsContact CD2-OE1 3.32Å; L39-E41 WeakPolarHBondContact CD2-OE1 3.41Å; L39-E41 HydrophobicContact CG-CG 4.17Å
40	I	97.4	Very high	96.8	Very high	122 Å²	122	119 Å²	119	63%	0.626	68%	0.679	S	S	*	*			trans	-118.9	121.2	-178.2	-61.4	171.6	0	0	0	107.8	V14	V14-I40 HydrophobicContact CG1-CD1 4.49Å
41	E	97.9	Very high	96.8	Very high	138 Å²	138	123.8 Å²	123.8	65%	0.645	71%	0.707	S	S	*	*			trans	-124.1	140.5	-177	-62.9	-175.7	176.2	0	0	110.9	L39	L39-E41 HydrophobicContact CD2-CG 4.5Å; L39-E41 VanDerWaalsContact CD2-OE1 3.32Å; L39-E41 WeakPolarHBondContact CD2-OE1 3.41Å; L39-E41 HydrophobicContact CG-CG 4.17Å
42	N	97	Very high	96.7	Very high	163 Å²	163	130.1 Å²	130.1	87%	0.872	74%	0.735	S	S	*	*			trans	-85	126	165.5	68.5	-76	0	0	0	109
43	V	97	Very high	96.6	Very high	128 Å²	128	133.3 Å²	133.3	78%	0.776	75%	0.745	S	S	*	*			trans	-112.9	155.3	-178.9	-62.3	0	0	0	0	111.4
44	A	97.1	Very high	96.5	Very high	99 Å²	99	138.4 Å²	138.4	82%	0.818	78%	0.775	S	S	*	*			trans	-146	145.1	170.5	0	0	0	0	0	109.3
45	S	95.6	Very high	96.5	Very high	125 Å²	125	134.3 Å²	134.3	87%	0.874	78%	0.781	S	S	*	*			trans	-89	150.3	172	-56.7	0	0	0	0	110.5
46	L	86.5	Confident	96.4	Very high	251 Å²	251	139.5 Å²	139.5	100%	1.314	78%	0.78	S	S	*	*			trans	-86.2	0	172.8	-73.2	164.6	0	0	0	111.7

Retrieved 46 of 46 residues in 16.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).