X5DRE8_HUMAN Loading...

DiGeorge syndrome critical region 6 isoform F

AlphaFold DB , UniProt , Accession X5DRE8, Species HUMAN (Homo sapiens, Human), Gene DGCR6, Length 97 aa.

						>X5DRE8_HUMAN|X5DRE8|DGCR6
MERYAGALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRGGGAPDP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.4	Low	64.8	Low	203 Å²	203	131.7 Å²	131.7	100%	1	66%	0.663	S	S	*	*				0	-36.9	0	-80.8	-70.9	-97.7	0	0	111.9	R3 Y4	M1-R3 PolarHBondContact O-N 3.3Å; M1-Y4 PolarHBondContact O-N 2.85Å
2	E	55.8	Low	65.7	Low	177 Å²	177	123.9 Å²	123.9	83%	0.827	63%	0.634	S	S	*	*	H	α-helix	trans	-64.3	-35.3	-178.5	-67.8	156.2	146.6	0	0	114.9	Y4 A5 G6	E2-Y4 VanDerWaalsContact C-N 3.28Å; E2-Y4 PolarHBondContact O-N 3.34Å; E2-A5 PolarHBondContact O-N 3.14Å; E2-G6 PolarHBondContact O-N 3.05Å
3	R	62.4	Low	66.8	Low	233 Å²	233	119.8 Å²	119.8	88%	0.879	61%	0.614	S	S	*	*	H	α-helix	trans	-63.8	-28.3	176.6	-86.3	-175.4	166.3	176.8	-4.3	114.7	M1 A7	M1-R3 PolarHBondContact O-N 3.3Å; R3-A7 PolarHBondContact O-N 3.35Å
4	Y	61.9	Low	68.1	Low	178 Å²	178	114 Å²	114	70%	0.698	60%	0.599	S	S	*	*	H	α-helix	trans	-80.2	-31	177.5	-73.8	-80.3	0	0	0	111.7	M1 E2 L8	M1-Y4 PolarHBondContact O-N 2.85Å; E2-Y4 VanDerWaalsContact C-N 3.28Å; E2-Y4 PolarHBondContact O-N 3.34Å; Y4-L8 WeakPolarHBondContact O-CG 3.4Å; Y4-L8 PolarHBondContact O-N 3.28Å
5	A	64.6	Low	69.3	Low	59 Å²	59	110.3 Å²	110.3	49%	0.488	59%	0.591	S	S	.	*	H	α-helix	trans	-65.8	-46.3	174.2	0	0	0	0	0	111.4	E2 A7 L8 E9	E2-A5 PolarHBondContact O-N 3.14Å; A5-A7 PolarHBondContact O-N 3.14Å; A5-L8 PolarHBondContact O-N 3.08Å; A5-E9 PolarHBondContact O-N 3.17Å
6	G	67.8	Low	70.6	Confident	33 Å²	33	112.3 Å²	112.3	34%	0.34	59%	0.588	S	S	.	*	H	α-helix	trans	-63.7	-36	176.6	0	0	0	0	0	113.7	E2 L8 E9 E10	E2-G6 PolarHBondContact O-N 3.05Å; G6-L8 VanDerWaalsContact C-N 3.35Å; G6-L8 PolarHBondContact O-N 3.49Å; G6-E9 PolarHBondContact O-N 3.08Å; G6-E10 VanDerWaalsContact O-CG 3.3Å; G6-E10 WeakPolarHBondContact O-CG 3.33Å; G6-E10 PolarHBondContact O-N 2.89Å
7	A	67.9	Low	71.7	Confident	55 Å²	55	112.5 Å²	112.5	46%	0.455	59%	0.585	S	S	.	*	H	α-helix	trans	-68	-32.8	176.1	0	0	0	0	0	113.1	R3 A5 V11	R3-A7 PolarHBondContact O-N 3.35Å; A5-A7 PolarHBondContact O-N 3.14Å; A7-V11 VanDerWaalsContact O-CG2 3.23Å; A7-V11 WeakPolarHBondContact O-CG2 3.49Å; A7-V11 PolarHBondContact O-N 3.3Å
8	L	66.3	Low	72.8	Confident	128 Å²	128	111.4 Å²	111.4	67%	0.67	58%	0.577	S	S	*	*	H	α-helix	trans	-73.6	-33.5	174.9	-71	172	0	0	0	112	Y4 A5 G6 A12	Y4-L8 WeakPolarHBondContact O-CG 3.4Å; Y4-L8 PolarHBondContact O-N 3.28Å; A5-L8 PolarHBondContact O-N 3.08Å; G6-L8 VanDerWaalsContact C-N 3.35Å; G6-L8 PolarHBondContact O-N 3.49Å; L8-A12 WeakPolarHBondContact O-CB 3.36Å; L8-A12 PolarHBondContact O-N 2.72Å
9	E	67.6	Low	74	Confident	127 Å²	127	111.6 Å²	111.6	59%	0.593	57%	0.574	S	S	*	*	H	α-helix	trans	-68.5	-46.4	176.6	-168.8	164.8	-165.6	0	0	111.7	A5 G6 V11 A12 D13	A5-E9 PolarHBondContact O-N 3.17Å; G6-E9 PolarHBondContact O-N 3.08Å; E9-V11 VanDerWaalsContact C-N 3.31Å; E9-V11 PolarHBondContact O-N 3.49Å; E9-A12 WeakPolarHBondContact O-CB 3.44Å; E9-A12 PolarHBondContact O-N 2.87Å; E9-A12 VanDerWaalsContact O-N 3.07Å; E9-D13 PolarHBondContact O-N 3.35Å
10	E	69.7	Low	75.1	Confident	151 Å²	151	113.7 Å²	113.7	71%	0.706	57%	0.574	S	S	*	*	H	α-helix	trans	-58	-41.2	173.8	-72.2	-83.6	142.4	0	0	112.5	G6 D13 G14	G6-E10 VanDerWaalsContact O-CG 3.3Å; G6-E10 WeakPolarHBondContact O-CG 3.33Å; G6-E10 PolarHBondContact O-N 2.89Å; E10-D13 PolarHBondContact O-N 3.23Å; E10-G14 PolarHBondContact O-N 2.95Å
11	V	72.8	Confident	76.1	Confident	105 Å²	105	108.8 Å²	108.8	64%	0.636	55%	0.55	S	S	*	.	H	α-helix	trans	-67.7	-38.6	175.8	170.5	0	0	0	0	111.3	A7 E9 A15	A7-V11 VanDerWaalsContact O-CG2 3.23Å; A7-V11 WeakPolarHBondContact O-CG2 3.49Å; A7-V11 PolarHBondContact O-N 3.3Å; E9-V11 VanDerWaalsContact C-N 3.31Å; E9-V11 PolarHBondContact O-N 3.49Å; V11-A15 WeakPolarHBondContact O-CB 3.49Å; V11-A15 PolarHBondContact O-N 3.01Å
12	A	74.9	Confident	78	Confident	38 Å²	38	105.5 Å²	105.5	31%	0.314	53%	0.527	S	S	.	.	H	α-helix	trans	-66.6	-38.6	176.7	0	0	0	0	0	111.8	L8 E9 A15 R16	L8-A12 WeakPolarHBondContact O-CB 3.36Å; L8-A12 PolarHBondContact O-N 2.72Å; E9-A12 WeakPolarHBondContact O-CB 3.44Å; E9-A12 PolarHBondContact O-N 2.87Å; E9-A12 VanDerWaalsContact O-N 3.07Å; A12-A15 PolarHBondContact O-N 3.18Å; A12-R16 VanDerWaalsContact O-CG 3.28Å; A12-R16 WeakPolarHBondContact O-CG 3.37Å; A12-R16 PolarHBondContact O-N 3.42Å
13	D	80.8	Confident	80	Confident	70 Å²	70	102.4 Å²	102.4	37%	0.374	51%	0.512	S	S	.	.	H	α-helix	trans	-71	-39.8	177	-74.3	-22	0	0	0	112	E9 E10 A15 R16 Q17	E9-D13 PolarHBondContact O-N 3.35Å; E10-D13 PolarHBondContact O-N 3.23Å; D13-A15 VanDerWaalsContact C-N 3.31Å; D13-A15 PolarHBondContact O-N 3.16Å; D13-R16 PolarHBondContact O-N 3.26Å; D13-R16 IonicContact OD1-CZ 3.8Å; D13-R16 IonicContact OD1-NH1 2.9Å; D13-R16 PolarHBondContact OD1-NH1 3.29Å; D13-Q17 WeakPolarHBondContact O-CB 3.26Å; D13-Q17 PolarHBondContact O-N 3.01Å
14	G	84.1	Confident	81.6	Confident	39 Å²	39	93.9 Å²	93.9	40%	0.402	48%	0.484	S	S	.	.	H	α-helix	trans	-58.2	-42.3	169.1	0	0	0	0	0	112.5	E10 Q17 Q18	E10-G14 PolarHBondContact O-N 2.95Å; G14-Q17 PolarHBondContact O-N 3.15Å; G14-Q18 WeakPolarHBondContact O-CB 3.36Å; G14-Q18 PolarHBondContact O-N 2.86Å
15	A	87.2	Confident	83.3	Confident	58 Å²	58	85.7 Å²	85.7	48%	0.479	45%	0.453	S	S	.	.	H	α-helix	trans	-65.1	-42	177.4	0	0	0	0	0	112.6	V11 A12 D13 Q18 E19	V11-A15 WeakPolarHBondContact O-CB 3.49Å; V11-A15 PolarHBondContact O-N 3.01Å; A12-A15 PolarHBondContact O-N 3.18Å; D13-A15 VanDerWaalsContact C-N 3.31Å; D13-A15 PolarHBondContact O-N 3.16Å; A15-Q18 PolarHBondContact O-N 3.2Å; A15-E19 WeakPolarHBondContact O-CB 3.24Å; A15-E19 PolarHBondContact O-N 3.32Å
16	R	89.6	Confident	84.8	Confident	143 Å²	143	86.1 Å²	86.1	54%	0.54	45%	0.452	S	S	.	.	H	α-helix	trans	-64	-41	175.4	-71	165.9	-178	172.7	-2.9	111.7	A12 D13 E19 R20	A12-R16 VanDerWaalsContact O-CG 3.28Å; A12-R16 WeakPolarHBondContact O-CG 3.37Å; A12-R16 PolarHBondContact O-N 3.42Å; D13-R16 PolarHBondContact O-N 3.26Å; D13-R16 IonicContact OD1-CZ 3.8Å; D13-R16 IonicContact OD1-NH1 2.9Å; D13-R16 PolarHBondContact OD1-NH1 3.29Å; R16-E19 PolarHBondContact O-N 3.34Å; R16-R20 WeakPolarHBondContact O-CG 3.4Å; R16-R20 PolarHBondContact O-N 3.5Å
17	Q	89.1	Confident	86.3	Confident	116 Å²	116	86.9 Å²	86.9	54%	0.542	46%	0.455	S	S	.	.	H	α-helix	trans	-67.3	-40.9	178.5	-168.5	153.8	30.7	0	0	111.3	D13 G14 E19 R20 H21	D13-Q17 WeakPolarHBondContact O-CB 3.26Å; D13-Q17 PolarHBondContact O-N 3.01Å; G14-Q17 PolarHBondContact O-N 3.15Å; Q17-E19 VanDerWaalsContact C-N 3.35Å; Q17-E19 PolarHBondContact O-N 3.4Å; Q17-R20 PolarHBondContact O-N 3.2Å; Q17-H21 WeakPolarHBondContact O-CB 3.48Å; Q17-H21 PolarHBondContact O-N 3.4Å
18	Q	92.3	Very high	87.6	Confident	93 Å²	93	85.4 Å²	85.4	44%	0.435	44%	0.439	S	S	.	.	H	α-helix	trans	-62	-42	173.8	-168.7	65.2	23.7	0	0	111.9	G14 A15 H21 Y22	G14-Q18 WeakPolarHBondContact O-CB 3.36Å; G14-Q18 PolarHBondContact O-N 2.86Å; A15-Q18 PolarHBondContact O-N 3.2Å; Q18-H21 WeakPolarHBondContact O-CB 3.42Å; Q18-H21 PolarHBondContact O-N 3.22Å; Q18-Y22 HydrophobicContact CG-CD2 3.97Å; Q18-Y22 HydrophobicContact CG-CE2 3.63Å; Q18-Y22 PolarHBondContact NE2-OH 2.89Å; Q18-Y22 WeakPolarHBondContact O-CD2 3.34Å; Q18-Y22 PolarHBondContact O-N 2.94Å
19	E	95.2	Very high	89.1	Confident	114 Å²	114	82.5 Å²	82.5	53%	0.533	42%	0.422	S	S	.	.	H	α-helix	trans	-60.2	-48.2	176.1	-172.5	-174.3	-177.3	0	0	111.4	A15 R16 Q17 H21 Y22 Q23	A15-E19 WeakPolarHBondContact O-CB 3.24Å; A15-E19 PolarHBondContact O-N 3.32Å; R16-E19 PolarHBondContact O-N 3.34Å; Q17-E19 VanDerWaalsContact C-N 3.35Å; Q17-E19 PolarHBondContact O-N 3.4Å; E19-H21 VanDerWaalsContact C-N 3.29Å; E19-H21 PolarHBondContact O-N 3.48Å; E19-Y22 PolarHBondContact O-N 3.47Å; E19-Q23 WeakPolarHBondContact O-CG 3.46Å; E19-Q23 PolarHBondContact O-N 3.45Å; E19-Q23 PolarHBondContact OE1-NE2 3.2Å
20	R	95.3	Very high	90.4	Very high	153 Å²	153	79 Å²	79	58%	0.577	41%	0.412	S	S	*	.	H	α-helix	trans	-63.4	-36.4	177.6	-67.1	175.9	-179.3	-173.6	1.8	112.2	R16 Q17 Q23 L24 L56	R16-R20 WeakPolarHBondContact O-CG 3.4Å; R16-R20 PolarHBondContact O-N 3.5Å; Q17-R20 PolarHBondContact O-N 3.2Å; R20-Q23 PolarHBondContact O-N 3.07Å; R20-L24 PolarHBondContact O-N 3.3Å; R20-L56 HydrophobicContact CB-CD1 4.49Å; R20-L56 HydrophobicContact CB-CD2 3.64Å
21	H	96.2	Very high	91.7	Very high	12 Å²	12	76.7 Å²	76.7	6%	0.056	40%	0.404	C	S	.	.	H	α-helix	trans	-60.6	-47.7	174.9	177.2	-94.9	0	0	0	111	Q17 Q18 E19 Q23 L24 L25 S49 L56	Q17-H21 WeakPolarHBondContact O-CB 3.48Å; Q17-H21 PolarHBondContact O-N 3.4Å; Q18-H21 WeakPolarHBondContact O-CB 3.42Å; Q18-H21 PolarHBondContact O-N 3.22Å; E19-H21 VanDerWaalsContact C-N 3.29Å; E19-H21 PolarHBondContact O-N 3.48Å; H21-Q23 PolarHBondContact O-N 2.94Å; H21-L24 PolarHBondContact O-N 2.85Å; H21-L25 VanDerWaalsContact O-CB 3.28Å; H21-L25 WeakPolarHBondContact O-CB 3.32Å; H21-L25 PolarHBondContact O-N 3.37Å; H21-S49 PolarHBondContact CE1-OG 3.49Å; H21-S49 PolarHBondContact NE2-O 3.13Å; H21-S49 PolarHBondContact NE2-OG 3.38Å; H21-L56 HydrophobicContact CB-CD1 3.71Å
22	Y	96.7	Very high	92.8	Very high	133 Å²	133	72.6 Å²	72.6	52%	0.522	38%	0.379	S	S	.	.	H	α-helix	trans	-63.5	-40.2	176.9	-79.4	-59.1	0	0	0	112.9	Q18 E19 L25 S26	Q18-Y22 HydrophobicContact CG-CD2 3.97Å; Q18-Y22 HydrophobicContact CG-CE2 3.63Å; Q18-Y22 PolarHBondContact NE2-OH 2.89Å; Q18-Y22 WeakPolarHBondContact O-CD2 3.34Å; Q18-Y22 PolarHBondContact O-N 2.94Å; E19-Y22 PolarHBondContact O-N 3.47Å; Y22-L25 PolarHBondContact O-N 2.94Å; Y22-S26 VanDerWaalsContact O-CB 3.29Å; Y22-S26 WeakPolarHBondContact O-CB 3.47Å; Y22-S26 PolarHBondContact O-N 3.44Å
23	Q	97.3	Very high	93.7	Very high	112 Å²	112	78 Å²	78	52%	0.523	40%	0.396	S	S	.	.	H	α-helix	trans	-59.9	-48.3	176.1	-71	173.1	10	0	0	111.3	E19 R20 H21 S26 A27	E19-Q23 WeakPolarHBondContact O-CG 3.46Å; E19-Q23 PolarHBondContact O-N 3.45Å; E19-Q23 PolarHBondContact OE1-NE2 3.2Å; R20-Q23 PolarHBondContact O-N 3.07Å; H21-Q23 PolarHBondContact O-N 2.94Å; Q23-S26 PolarHBondContact O-N 3.4Å; Q23-A27 PolarHBondContact O-N 3.07Å; Q23-A27 VanDerWaalsContact O-N 3.07Å
24	L	96.4	Very high	94.4	Very high	55 Å²	55	82.3 Å²	82.3	29%	0.288	41%	0.413	S	S	.	.	H	α-helix	trans	-65.9	-43.9	177.9	-82.2	165.7	0	0	0	112.5	R20 H21 S26 A27 L28 A52 L55 L56	R20-L24 PolarHBondContact O-N 3.3Å; H21-L24 PolarHBondContact O-N 2.85Å; L24-S26 VanDerWaalsContact C-N 3.3Å; L24-S26 PolarHBondContact O-N 3.28Å; L24-A27 WeakPolarHBondContact O-CB 3.28Å; L24-A27 PolarHBondContact O-N 3.01Å; L24-L28 WeakPolarHBondContact O-CB 3.48Å; L24-L28 WeakPolarHBondContact O-CG 3.49Å; L24-L28 PolarHBondContact O-N 2.84Å; L24-A52 HydrophobicContact CB-CB 4.06Å; L24-L55 HydrophobicContact CD1-CB 4.41Å; L24-L56 HydrophobicContact CD1-CD1 4.35Å; L24-L56 HydrophobicContact CD1-CD2 3.52Å; L24-L56 HydrophobicContact CD1-CG 3.54Å
25	L	97.4	Very high	94.9	Very high	6 Å²	6	83.8 Å²	83.8	3%	0.031	41%	0.412	C	S	.	.	H	α-helix	trans	-60.7	-41.1	177.8	-180	58.3	0	0	0	111.6	H21 Y22 L28 Q29 Y45 L48 A52	H21-L25 VanDerWaalsContact O-CB 3.28Å; H21-L25 WeakPolarHBondContact O-CB 3.32Å; H21-L25 PolarHBondContact O-N 3.37Å; Y22-L25 PolarHBondContact O-N 2.94Å; L25-L28 PolarHBondContact O-N 3.39Å; L25-Q29 HydrophobicContact CD1-CG 4.32Å; L25-Q29 WeakPolarHBondContact O-CB 3.45Å; L25-Q29 VanDerWaalsContact O-CG 3.24Å; L25-Q29 WeakPolarHBondContact O-CG 3.44Å; L25-Q29 PolarHBondContact O-N 3.36Å; L25-Y45 HydrophobicContact CD2-CE2 3.73Å; L25-L48 HydrophobicContact CD1-CB 3.74Å; L25-A52 HydrophobicContact CB-CB 4.38Å
26	S	97.3	Very high	95.3	Very high	67 Å²	67	84.8 Å²	84.8	47%	0.469	41%	0.413	S	S	.	.	H	α-helix	trans	-62.8	-42.9	175.1	-176.6	0	0	0	0	112	Y22 Q23 L24 Q29 S30	Y22-S26 VanDerWaalsContact O-CB 3.29Å; Y22-S26 WeakPolarHBondContact O-CB 3.47Å; Y22-S26 PolarHBondContact O-N 3.44Å; Q23-S26 PolarHBondContact O-N 3.4Å; L24-S26 VanDerWaalsContact C-N 3.3Å; L24-S26 PolarHBondContact O-N 3.28Å; S26-Q29 PolarHBondContact O-N 3.25Å; S26-S30 PolarHBondContact O-N 2.85Å; S26-S30 PolarHBondContact O-OG 3.19Å
27	A	97.6	Very high	95.4	Very high	49 Å²	49	81.9 Å²	81.9	41%	0.405	41%	0.414	S	S	.	.	H	α-helix	trans	-62.7	-47.1	175.2	0	0	0	0	0	111.7	Q23 L24 Q29 S30 L31	Q23-A27 PolarHBondContact O-N 3.07Å; Q23-A27 VanDerWaalsContact O-N 3.07Å; L24-A27 WeakPolarHBondContact O-CB 3.28Å; L24-A27 PolarHBondContact O-N 3.01Å; A27-Q29 PolarHBondContact O-N 2.93Å; A27-S30 WeakPolarHBondContact O-CB 3.48Å; A27-S30 PolarHBondContact O-N 3.16Å; A27-S30 VanDerWaalsContact O-N 3.13Å; A27-L31 WeakPolarHBondContact O-CG 3.48Å; A27-L31 PolarHBondContact O-N 3.39Å
28	L	97	Very high	95.5	Very high	24 Å²	24	79.7 Å²	79.7	13%	0.126	41%	0.412	C	S	.	.	H	α-helix	trans	-59.6	-44.9	176.6	-72.3	174.5	0	0	0	111.9	L24 L25 S30 L31 V32 L48 L51 A52 L55	L24-L28 WeakPolarHBondContact O-CB 3.48Å; L24-L28 WeakPolarHBondContact O-CG 3.49Å; L24-L28 PolarHBondContact O-N 2.84Å; L25-L28 PolarHBondContact O-N 3.39Å; L28-S30 VanDerWaalsContact C-N 3.26Å; L28-S30 PolarHBondContact O-N 3.44Å; L28-L31 PolarHBondContact O-N 2.98Å; L28-V32 WeakPolarHBondContact O-CG2 3.19Å; L28-V32 PolarHBondContact O-N 3.13Å; L28-L48 HydrophobicContact CB-CD2 4.31Å; L28-L48 WeakPolarHBondContact CD1-O 3.41Å; L28-L51 HydrophobicContact CD1-CB 4.23Å; L28-L51 HydrophobicContact CD1-CD2 4.08Å; L28-L51 HydrophobicContact CD1-CG 4.05Å; L28-L51 HydrophobicContact CD2-CD2 3.89Å; L28-A52 HydrophobicContact CD1-CB 3.98Å; L28-L55 HydrophobicContact CD1-CD1 4.37Å; L28-L55 HydrophobicContact CD2-CD1 4.38Å
29	Q	95.8	Very high	95.5	Very high	68 Å²	68	80.3 Å²	80.3	32%	0.318	41%	0.414	S	S	.	.	H	α-helix	trans	-62.4	-35	176.2	-75.4	175.6	-6.6	0	0	112.5	L25 S26 A27 V32 K33 L48	L25-Q29 HydrophobicContact CD1-CG 4.32Å; L25-Q29 WeakPolarHBondContact O-CB 3.45Å; L25-Q29 VanDerWaalsContact O-CG 3.24Å; L25-Q29 WeakPolarHBondContact O-CG 3.44Å; L25-Q29 PolarHBondContact O-N 3.36Å; S26-Q29 PolarHBondContact O-N 3.25Å; A27-Q29 PolarHBondContact O-N 2.93Å; Q29-V32 PolarHBondContact O-N 3.3Å; Q29-K33 WeakPolarHBondContact O-CG 3.47Å; Q29-K33 PolarHBondContact O-N 3.34Å; Q29-L48 HydrophobicContact CG-CD1 4Å
30	S	96.6	Very high	95.3	Very high	54 Å²	54	78.1 Å²	78.1	38%	0.378	40%	0.403	S	S	.	.	H	α-helix	trans	-67.6	-44.5	176.4	-57.4	0	0	0	0	111	S26 A27 L28 V32 K33	S26-S30 PolarHBondContact O-N 2.85Å; S26-S30 PolarHBondContact O-OG 3.19Å; A27-S30 WeakPolarHBondContact O-CB 3.48Å; A27-S30 PolarHBondContact O-N 3.16Å; A27-S30 VanDerWaalsContact O-N 3.13Å; L28-S30 VanDerWaalsContact C-N 3.26Å; L28-S30 PolarHBondContact O-N 3.44Å; S30-V32 VanDerWaalsContact C-N 3.34Å; S30-V32 PolarHBondContact O-N 3.05Å; S30-K33 WeakPolarHBondContact O-CB 3.24Å; S30-K33 PolarHBondContact O-N 3.46Å
31	L	96.5	Very high	95	Very high	101 Å²	101	78.8 Å²	78.8	53%	0.529	41%	0.413	S	S	.	.	H	α-helix	trans	-61.1	-40	174.4	-69.3	169.5	0	0	0	112.4	A27 L28 K33 E34	A27-L31 WeakPolarHBondContact O-CG 3.48Å; A27-L31 PolarHBondContact O-N 3.39Å; L28-L31 PolarHBondContact O-N 2.98Å; L31-K33 VanDerWaalsContact C-N 3.3Å; L31-K33 PolarHBondContact O-N 3.39Å; L31-E34 PolarHBondContact O-N 3.03Å
32	V	95.8	Very high	94.9	Very high	19 Å²	19	87.4 Å²	87.4	12%	0.115	45%	0.445	C	S	.	.	H	α-helix	trans	-63.7	-36.3	177.6	172.2	0	0	0	0	111.8	L28 Q29 S30 E34 L35 Q40 L43 L48	L28-V32 WeakPolarHBondContact O-CG2 3.19Å; L28-V32 PolarHBondContact O-N 3.13Å; Q29-V32 PolarHBondContact O-N 3.3Å; S30-V32 VanDerWaalsContact C-N 3.34Å; S30-V32 PolarHBondContact O-N 3.05Å; V32-E34 PolarHBondContact O-N 3.46Å; V32-L35 WeakPolarHBondContact O-CB 3.37Å; V32-L35 PolarHBondContact O-N 2.9Å; V32-Q40 HydrophobicContact CG1-CB 4.12Å; V32-Q40 HydrophobicContact CG1-CG 3.98Å; V32-Q40 WeakPolarHBondContact O-CG 3.29Å; V32-Q40 PolarHBondContact O-NE2 3.4Å; V32-L43 HydrophobicContact CG1-CB 4.37Å; V32-L43 HydrophobicContact CG1-CD1 4.35Å; V32-L43 HydrophobicContact CG2-CB 4.23Å; V32-L43 HydrophobicContact CG2-CD1 3.67Å; V32-L48 HydrophobicContact CG2-CD1 4.01Å; V32-L48 HydrophobicContact CG2-CD2 3.8Å
33	K	93.9	Very high	94.7	Very high	153 Å²	153	83.9 Å²	83.9	67%	0.665	44%	0.435	S	S	*	.	H	α-helix	trans	-62.5	-23.4	178.2	-71.9	169	-174.3	175.2	0	113.1	Q29 S30 L31 L35 Q40	Q29-K33 WeakPolarHBondContact O-CG 3.47Å; Q29-K33 PolarHBondContact O-N 3.34Å; S30-K33 WeakPolarHBondContact O-CB 3.24Å; S30-K33 PolarHBondContact O-N 3.46Å; L31-K33 VanDerWaalsContact C-N 3.3Å; L31-K33 PolarHBondContact O-N 3.39Å; K33-L35 VanDerWaalsContact C-N 3.32Å; K33-Q40 PolarHBondContact O-NE2 2.61Å
34	E	95.4	Very high	94.6	Very high	159 Å²	159	81 Å²	81	74%	0.743	43%	0.427	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.4	-12.4	177.1	-61.9	177.9	-166.2	0	0	112.9	L31 V32	L31-E34 PolarHBondContact O-N 3.03Å; V32-E34 PolarHBondContact O-N 3.46Å
35	L	93.6	Very high	94.5	Very high	71 Å²	71	84.6 Å²	84.6	37%	0.372	44%	0.438	S	S	.	.	S	Bend	trans	-82.6	155.5	179.8	-59	177.4	0	0	0	112.1	V32 K33 F39 Q40 L43	V32-L35 WeakPolarHBondContact O-CB 3.37Å; V32-L35 PolarHBondContact O-N 2.9Å; K33-L35 VanDerWaalsContact C-N 3.32Å; L35-F39 HydrophobicContact CB-CB 4.23Å; L35-F39 HydrophobicContact CD1-CB 4.36Å; L35-Q40 HydrophobicContact CB-CG 4.35Å; L35-Q40 PolarHBondContact O-NE2 2.93Å; L35-L43 HydrophobicContact CD1-CD1 3.81Å
36	P	95.6	Very high	94.4	Very high	79 Å²	79	88.5 Å²	88.5	51%	0.513	46%	0.462	S	S	.	.			trans	-58.2	147.2	169	-21.6	31.3	0	0	0	112.3	S38 F39 Q40	P36-S38 PolarHBondContact O-N 2.97Å; P36-F39 HydrophobicContact CB-CD2 4.03Å; P36-F39 HydrophobicContact CG-CD2 4.04Å; P36-F39 HydrophobicContact CG-CE2 4.35Å; P36-F39 PolarHBondContact O-N 2.93Å; P36-Q40 PolarHBondContact O-N 3.24Å
37	S	91.7	Very high	94.3	Very high	81 Å²	81	88.3 Å²	88.3	57%	0.566	46%	0.458	S	S	*	.	H	α-helix	trans	-55.6	-31	-173.3	-49.8	0	0	0	0	114.5	F39 Q40 Q41	S37-F39 VanDerWaalsContact C-N 3.25Å; S37-F39 PolarHBondContact O-N 2.99Å; S37-Q40 PolarHBondContact O-N 3.36Å; S37-Q41 WeakPolarHBondContact O-CG 3.34Å; S37-Q41 PolarHBondContact O-N 3.38Å; S37-Q41 VanDerWaalsContact O-N 3.14Å
38	S	92.6	Very high	94.3	Very high	71 Å²	71	86.5 Å²	86.5	50%	0.497	44%	0.442	S	S	.	.	H	α-helix	trans	-61.9	-31	175.6	51.7	0	0	0	0	113.3	P36	P36-S38 PolarHBondContact O-N 2.97Å
39	F	90.9	Very high	94.3	Very high	106 Å²	106	86.2 Å²	86.2	47%	0.465	44%	0.442	S	S	.	.	H	α-helix	trans	-86.2	-35.7	175.8	-64.3	-77	0	0	0	111.6	L35 P36 S37 Q41 R42 L43	L35-F39 HydrophobicContact CB-CB 4.23Å; L35-F39 HydrophobicContact CD1-CB 4.36Å; P36-F39 HydrophobicContact CB-CD2 4.03Å; P36-F39 HydrophobicContact CG-CD2 4.04Å; P36-F39 HydrophobicContact CG-CE2 4.35Å; P36-F39 PolarHBondContact O-N 2.93Å; S37-F39 VanDerWaalsContact C-N 3.25Å; S37-F39 PolarHBondContact O-N 2.99Å; F39-Q41 VanDerWaalsContact C-N 3.28Å; F39-Q41 PolarHBondContact O-N 2.94Å; F39-R42 PolarHBondContact O-N 2.92Å; F39-R42 VanDerWaalsContact O-N 3.08Å; F39-L43 PolarHBondContact O-N 3.41Å
40	Q	91.7	Very high	94.3	Very high	67 Å²	67	87.8 Å²	87.8	31%	0.313	45%	0.452	S	S	.	.	H	α-helix	trans	-56.5	-43.6	176	-60.5	-173.1	9.5	0	0	111.8	V32 K33 L35 P36 S37 R42 L43	V32-Q40 HydrophobicContact CG1-CB 4.12Å; V32-Q40 HydrophobicContact CG1-CG 3.98Å; V32-Q40 WeakPolarHBondContact O-CG 3.29Å; V32-Q40 PolarHBondContact O-NE2 3.4Å; K33-Q40 PolarHBondContact O-NE2 2.61Å; L35-Q40 HydrophobicContact CB-CG 4.35Å; L35-Q40 PolarHBondContact O-NE2 2.93Å; P36-Q40 PolarHBondContact O-N 3.24Å; S37-Q40 PolarHBondContact O-N 3.36Å; Q40-R42 PolarHBondContact O-N 3.3Å; Q40-L43 PolarHBondContact O-N 3.46Å; Q40-L43 VanDerWaalsContact O-N 3.08Å
41	Q	89.7	Confident	94.2	Very high	168 Å²	168	88.8 Å²	88.8	79%	0.785	45%	0.453	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.3	-21.8	179.9	-72.2	178.1	-7.8	0	0	114	S37 F39	S37-Q41 WeakPolarHBondContact O-CG 3.34Å; S37-Q41 PolarHBondContact O-N 3.38Å; S37-Q41 VanDerWaalsContact O-N 3.14Å; F39-Q41 VanDerWaalsContact C-N 3.28Å; F39-Q41 PolarHBondContact O-N 2.94Å
42	R	93.2	Very high	94.2	Very high	192 Å²	192	84 Å²	84	73%	0.725	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.2	-13.4	178.7	-63.3	179.9	63.5	-164.6	-2.1	112.9	F39 Q40	F39-R42 PolarHBondContact O-N 2.92Å; F39-R42 VanDerWaalsContact O-N 3.08Å; Q40-R42 PolarHBondContact O-N 3.3Å
43	L	93.1	Very high	94.2	Very high	59 Å²	59	87.2 Å²	87.2	31%	0.309	44%	0.444	S	S	.	.	S	Bend	trans	-109.1	77.8	-175.3	-63.4	173.4	0	0	0	108.9	V32 L35 F39 Q40 L48	V32-L43 HydrophobicContact CG1-CB 4.37Å; V32-L43 HydrophobicContact CG1-CD1 4.35Å; V32-L43 HydrophobicContact CG2-CB 4.23Å; V32-L43 HydrophobicContact CG2-CD1 3.67Å; L35-L43 HydrophobicContact CD1-CD1 3.81Å; F39-L43 PolarHBondContact O-N 3.41Å; Q40-L43 PolarHBondContact O-N 3.46Å; Q40-L43 VanDerWaalsContact O-N 3.08Å; L43-L48 HydrophobicContact CB-CD2 4.31Å
44	S	94	Very high	94.2	Very high	52 Å²	52	82.2 Å²	82.2	36%	0.364	43%	0.431	S	S	.	.			trans	-66	161.1	178.7	69.1	0	0	0	0	111.5	T46 T47 L48	S44-T46 PolarHBondContact O-N 2.95Å; S44-T46 PolarHBondContact OG-OG1 3.47Å; S44-T47 PolarHBondContact O-N 3.14Å; S44-T47 VanDerWaalsContact O-N 3.15Å; S44-T47 PolarHBondContact OG-N 2.95Å; S44-T47 PolarHBondContact OG-OG1 3.35Å; S44-T47 VanDerWaalsContact OG-OG1 3.14Å; S44-L48 WeakPolarHBondContact O-CG 3.29Å; S44-L48 PolarHBondContact O-N 3.41Å
45	Y	94.6	Very high	94.1	Very high	131 Å²	131	77.3 Å²	77.3	51%	0.514	41%	0.41	S	S	.	.	H	α-helix	trans	-52.4	-42.6	173.2	176	-90.3	0	0	0	112.5	L25 L48 S49	L25-Y45 HydrophobicContact CD2-CE2 3.73Å; Y45-L48 PolarHBondContact O-N 3.27Å; Y45-S49 WeakPolarHBondContact O-CB 3Å; Y45-S49 PolarHBondContact O-N 2.95Å
46	T	96.1	Very high	94.1	Very high	87 Å²	87	76 Å²	76	53%	0.534	40%	0.403	S	S	.	.	H	α-helix	trans	-61.6	-47.4	179.2	54.8	0	0	0	0	110.9	S44 L48 S49 D50	S44-T46 PolarHBondContact O-N 2.95Å; S44-T46 PolarHBondContact OG-OG1 3.47Å; T46-L48 VanDerWaalsContact C-N 3.32Å; T46-L48 PolarHBondContact O-N 3.28Å; T46-S49 WeakPolarHBondContact O-CB 3.23Å; T46-S49 PolarHBondContact O-N 3.42Å; T46-S49 VanDerWaalsContact O-N 3.16Å; T46-D50 WeakPolarHBondContact O-CB 3.36Å; T46-D50 PolarHBondContact O-N 2.92Å
47	T	95.8	Very high	94	Very high	63 Å²	63	77 Å²	77	39%	0.387	40%	0.404	S	S	.	.	H	α-helix	trans	-60	-40.6	176.6	-58.5	0	0	0	0	112.4	S44 L51	S44-T47 PolarHBondContact O-N 3.14Å; S44-T47 VanDerWaalsContact O-N 3.15Å; S44-T47 PolarHBondContact OG-N 2.95Å; S44-T47 PolarHBondContact OG-OG1 3.35Å; S44-T47 VanDerWaalsContact OG-OG1 3.14Å; T47-L51 VanDerWaalsContact O-CB 3.26Å; T47-L51 WeakPolarHBondContact O-CB 3.45Å; T47-L51 PolarHBondContact O-N 3.26Å
48	L	96.8	Very high	94	Very high	11 Å²	11	74 Å²	74	6%	0.058	39%	0.385	C	S	.	.	H	α-helix	trans	-70	-35.6	177.4	-62.7	176.7	0	0	0	112.4	L25 L28 Q29 V32 L43 S44 Y45 T46 A52	L25-L48 HydrophobicContact CD1-CB 3.74Å; L28-L48 HydrophobicContact CB-CD2 4.31Å; L28-L48 WeakPolarHBondContact CD1-O 3.41Å; Q29-L48 HydrophobicContact CG-CD1 4Å; V32-L48 HydrophobicContact CG2-CD1 4.01Å; V32-L48 HydrophobicContact CG2-CD2 3.8Å; L43-L48 HydrophobicContact CB-CD2 4.31Å; S44-L48 WeakPolarHBondContact O-CG 3.29Å; S44-L48 PolarHBondContact O-N 3.41Å; Y45-L48 PolarHBondContact O-N 3.27Å; T46-L48 VanDerWaalsContact C-N 3.32Å; T46-L48 PolarHBondContact O-N 3.28Å; L48-A52 WeakPolarHBondContact O-CB 3.35Å; L48-A52 PolarHBondContact O-N 3.35Å
49	S	96.1	Very high	94.2	Very high	19 Å²	19	73.3 Å²	73.3	13%	0.133	38%	0.379	C	S	.	.	H	α-helix	trans	-66.7	-45.1	175.6	-175.2	0	0	0	0	111.5	H21 Y45 T46 L51 A52 L53	H21-S49 PolarHBondContact CE1-OG 3.49Å; H21-S49 PolarHBondContact NE2-O 3.13Å; H21-S49 PolarHBondContact NE2-OG 3.38Å; Y45-S49 WeakPolarHBondContact O-CB 3Å; Y45-S49 PolarHBondContact O-N 2.95Å; T46-S49 WeakPolarHBondContact O-CB 3.23Å; T46-S49 PolarHBondContact O-N 3.42Å; T46-S49 VanDerWaalsContact O-N 3.16Å; S49-L51 VanDerWaalsContact C-N 3.33Å; S49-A52 PolarHBondContact O-N 2.9Å; S49-L53 WeakPolarHBondContact O-CG 3.49Å; S49-L53 PolarHBondContact O-N 3.42Å
50	D	96.1	Very high	94.3	Very high	100 Å²	100	72.6 Å²	72.6	54%	0.535	38%	0.383	S	S	.	.	H	α-helix	trans	-64.6	-40	176.7	-63.5	-22.9	0	0	0	110.7	T46 L53 A54	T46-D50 WeakPolarHBondContact O-CB 3.36Å; T46-D50 PolarHBondContact O-N 2.92Å; D50-L53 PolarHBondContact O-N 2.92Å; D50-A54 PolarHBondContact O-N 3.4Å
51	L	95.6	Very high	94.5	Very high	75 Å²	75	75.3 Å²	75.3	39%	0.393	39%	0.394	S	S	.	.	H	α-helix	trans	-62.7	-44.6	174.1	-178.9	60.2	0	0	0	111.6	L28 T47 S49 L53 A54 L55	L28-L51 HydrophobicContact CD1-CB 4.23Å; L28-L51 HydrophobicContact CD1-CD2 4.08Å; L28-L51 HydrophobicContact CD1-CG 4.05Å; L28-L51 HydrophobicContact CD2-CD2 3.89Å; T47-L51 VanDerWaalsContact O-CB 3.26Å; T47-L51 WeakPolarHBondContact O-CB 3.45Å; T47-L51 PolarHBondContact O-N 3.26Å; S49-L51 VanDerWaalsContact C-N 3.33Å; L51-L53 VanDerWaalsContact C-N 3.3Å; L51-L53 PolarHBondContact O-N 2.92Å; L51-A54 PolarHBondContact O-N 2.96Å; L51-L55 HydrophobicContact CD1-CD1 4.46Å; L51-L55 HydrophobicContact CD1-CG 4.26Å; L51-L55 HydrophobicContact CG-CD1 4.18Å; L51-L55 HydrophobicContact CG-CG 4.42Å; L51-L55 WeakPolarHBondContact O-CB 3.34Å; L51-L55 VanDerWaalsContact O-CG 3.24Å; L51-L55 WeakPolarHBondContact O-CG 3.47Å; L51-L55 PolarHBondContact O-N 3.01Å
52	A	96.4	Very high	94.9	Very high	0 Å²	0	74 Å²	74	0%	0	39%	0.388	C	S	.	.	H	α-helix	trans	-60	-39.6	176.3	0	0	0	0	0	112.2	L24 L25 L28 L48 S49 L55 L56	L24-A52 HydrophobicContact CB-CB 4.06Å; L25-A52 HydrophobicContact CB-CB 4.38Å; L28-A52 HydrophobicContact CD1-CB 3.98Å; L48-A52 WeakPolarHBondContact O-CB 3.35Å; L48-A52 PolarHBondContact O-N 3.35Å; S49-A52 PolarHBondContact O-N 2.9Å; A52-L55 PolarHBondContact O-N 2.86Å; A52-L56 WeakPolarHBondContact O-CG 3.41Å; A52-L56 PolarHBondContact O-N 3.34Å
53	L	95	Very high	95.1	Very high	87 Å²	87	69.6 Å²	69.6	46%	0.455	38%	0.377	S	S	.	.	H	α-helix	trans	-64.9	-45.6	174.6	-70.9	170.8	0	0	0	111.9	S49 D50 L51 L55 L56 D57	S49-L53 WeakPolarHBondContact O-CG 3.49Å; S49-L53 PolarHBondContact O-N 3.42Å; D50-L53 PolarHBondContact O-N 2.92Å; L51-L53 VanDerWaalsContact C-N 3.3Å; L51-L53 PolarHBondContact O-N 2.92Å; L53-L55 VanDerWaalsContact C-N 3.29Å; L53-L55 PolarHBondContact O-N 3.03Å; L53-L56 PolarHBondContact O-N 2.98Å; L53-L56 VanDerWaalsContact O-N 3.16Å; L53-D57 PolarHBondContact O-N 3.36Å
54	A	94.4	Very high	95.3	Very high	48 Å²	48	71 Å²	71	40%	0.397	39%	0.388	S	S	.	.	H	α-helix	trans	-62.9	-35.6	177.3	0	0	0	0	0	112.6	D50 L51 G58	D50-A54 PolarHBondContact O-N 3.4Å; L51-A54 PolarHBondContact O-N 2.96Å; A54-G58 PolarHBondContact O-N 3.32Å
55	L	93.9	Very high	95.5	Very high	57 Å²	57	73.1 Å²	73.1	30%	0.298	39%	0.392	S	S	.	.	H	α-helix	trans	-68.9	-34.8	174.7	-69.6	174.9	0	0	0	112.4	L24 L28 L51 A52 L53 F61	L24-L55 HydrophobicContact CD1-CB 4.41Å; L28-L55 HydrophobicContact CD1-CD1 4.37Å; L28-L55 HydrophobicContact CD2-CD1 4.38Å; L51-L55 HydrophobicContact CD1-CD1 4.46Å; L51-L55 HydrophobicContact CD1-CG 4.26Å; L51-L55 HydrophobicContact CG-CD1 4.18Å; L51-L55 HydrophobicContact CG-CG 4.42Å; L51-L55 WeakPolarHBondContact O-CB 3.34Å; L51-L55 VanDerWaalsContact O-CG 3.24Å; L51-L55 WeakPolarHBondContact O-CG 3.47Å; L51-L55 PolarHBondContact O-N 3.01Å; A52-L55 PolarHBondContact O-N 2.86Å; L53-L55 VanDerWaalsContact C-N 3.29Å; L53-L55 PolarHBondContact O-N 3.03Å; L55-F61 HydrophobicContact CD2-CE2 3.55Å; L55-F61 HydrophobicContact CD2-CZ 3.49Å; L55-F61 VanDerWaalsContact CD2-CZ 3.49Å
56	L	93.4	Very high	95.7	Very high	42 Å²	42	68.2 Å²	68.2	22%	0.22	38%	0.381	C	S	.	.	H	α-helix	trans	-72	-39.2	175.7	-77.9	171.5	0	0	0	113.2	R20 H21 L24 A52 L53 G58	R20-L56 HydrophobicContact CB-CD1 4.49Å; R20-L56 HydrophobicContact CB-CD2 3.64Å; H21-L56 HydrophobicContact CB-CD1 3.71Å; L24-L56 HydrophobicContact CD1-CD1 4.35Å; L24-L56 HydrophobicContact CD1-CD2 3.52Å; L24-L56 HydrophobicContact CD1-CG 3.54Å; A52-L56 WeakPolarHBondContact O-CG 3.41Å; A52-L56 PolarHBondContact O-N 3.34Å; L53-L56 PolarHBondContact O-N 2.98Å; L53-L56 VanDerWaalsContact O-N 3.16Å; L56-G58 PolarHBondContact O-N 2.87Å
57	D	93	Very high	95.8	Very high	102 Å²	102	69.1 Å²	69.1	55%	0.545	38%	0.382	S	S	.	.	H	α-helix	trans	-59.8	-38.6	177.9	177.1	82.8	0	0	0	111.1	L53 T59	L53-D57 PolarHBondContact O-N 3.36Å; D57-T59 PolarHBondContact O-N 3.02Å; D57-T59 WeakPolarHBondContact OD2-CB 3.32Å; D57-T59 PolarHBondContact OD2-N 3.34Å; D57-T59 PolarHBondContact OD2-OG1 3.23Å
58	G	92.6	Very high	95.9	Very high	16 Å²	16	69.2 Å²	69.2	17%	0.165	38%	0.38	C	S	.	.			trans	75	-17.2	170.1	0	0	0	0	0	114.8	A54 L56 V60 F61 E62	A54-G58 PolarHBondContact O-N 3.32Å; L56-G58 PolarHBondContact O-N 2.87Å; G58-V60 PolarHBondContact O-N 3.21Å; G58-V60 VanDerWaalsContact O-N 3.14Å; G58-F61 WeakPolarHBondContact O-CA 3.27Å; G58-F61 WeakPolarHBondContact O-CB 3.4Å; G58-F61 PolarHBondContact O-N 3.31Å; G58-E62 PolarHBondContact O-N 3.35Å; G58-E62 VanDerWaalsContact O-N 3.13Å
59	T	95.4	Very high	96	Very high	58 Å²	58	73.6 Å²	73.6	36%	0.356	40%	0.4	S	S	.	.	H	α-helix	trans	-54.6	-39	-175.6	-54.7	0	0	0	0	112.4	D57 F61 E62 I63	D57-T59 PolarHBondContact O-N 3.02Å; D57-T59 WeakPolarHBondContact OD2-CB 3.32Å; D57-T59 PolarHBondContact OD2-N 3.34Å; D57-T59 PolarHBondContact OD2-OG1 3.23Å; T59-F61 VanDerWaalsContact C-N 3.31Å; T59-F61 PolarHBondContact O-N 3.07Å; T59-E62 PolarHBondContact O-N 3.48Å; T59-I63 HydrophobicContact CG2-CD1 3.92Å; T59-I63 HydrophobicContact CG2-CG1 4.39Å; T59-I63 VanDerWaalsContact O-CG1 3.29Å; T59-I63 WeakPolarHBondContact O-CG1 3.35Å; T59-I63 PolarHBondContact O-N 3.07Å
60	V	94.6	Very high	96.1	Very high	91 Å²	91	77.6 Å²	77.6	55%	0.552	42%	0.419	S	S	*	.	H	α-helix	trans	-62	-40.5	178	178.7	0	0	0	0	111.2	G58 I63 V64	G58-V60 PolarHBondContact O-N 3.21Å; G58-V60 VanDerWaalsContact O-N 3.14Å; V60-I63 PolarHBondContact O-N 2.99Å; V60-V64 VanDerWaalsContact O-CG2 3.27Å; V60-V64 WeakPolarHBondContact O-CG2 3.37Å; V60-V64 PolarHBondContact O-N 2.97Å
61	F	95.6	Very high	96.3	Very high	124 Å²	124	77.3 Å²	77.3	54%	0.544	41%	0.414	S	S	.	.	H	α-helix	trans	-67.9	-40	177.2	-65.5	-78	0	0	0	111.6	L55 G58 T59 V64 Q65	L55-F61 HydrophobicContact CD2-CE2 3.55Å; L55-F61 HydrophobicContact CD2-CZ 3.49Å; L55-F61 VanDerWaalsContact CD2-CZ 3.49Å; G58-F61 WeakPolarHBondContact O-CA 3.27Å; G58-F61 WeakPolarHBondContact O-CB 3.4Å; G58-F61 PolarHBondContact O-N 3.31Å; T59-F61 VanDerWaalsContact C-N 3.31Å; T59-F61 PolarHBondContact O-N 3.07Å; F61-V64 PolarHBondContact O-N 3.42Å; F61-Q65 WeakPolarHBondContact O-CB 3.3Å; F61-Q65 PolarHBondContact O-N 3.42Å
62	E	97.6	Very high	96.4	Very high	141 Å²	141	78.6 Å²	78.6	66%	0.659	42%	0.418	S	S	*	.	H	α-helix	trans	-62	-43.9	175.8	-64.7	-175.4	174.1	0	0	111.7	G58 T59 Q65 G66	G58-E62 PolarHBondContact O-N 3.35Å; G58-E62 VanDerWaalsContact O-N 3.13Å; T59-E62 PolarHBondContact O-N 3.48Å; E62-Q65 PolarHBondContact O-N 2.9Å; E62-G66 PolarHBondContact O-N 2.86Å
63	I	97.4	Very high	96.5	Very high	99 Å²	99	84.4 Å²	84.4	51%	0.508	45%	0.449	S	S	.	.	H	α-helix	trans	-60.1	-48.8	175.3	-69	166.5	0	0	0	110.4	T59 V60 Q65 G66 L67	T59-I63 HydrophobicContact CG2-CD1 3.92Å; T59-I63 HydrophobicContact CG2-CG1 4.39Å; T59-I63 VanDerWaalsContact O-CG1 3.29Å; T59-I63 WeakPolarHBondContact O-CG1 3.35Å; T59-I63 PolarHBondContact O-N 3.07Å; V60-I63 PolarHBondContact O-N 2.99Å; I63-Q65 VanDerWaalsContact C-N 3.3Å; I63-Q65 PolarHBondContact O-N 2.93Å; I63-G66 PolarHBondContact O-N 3.32Å; I63-L67 HydrophobicContact CG2-CD1 4.05Å; I63-L67 HydrophobicContact CG2-CG 4.43Å; I63-L67 WeakPolarHBondContact O-CG 3.41Å; I63-L67 PolarHBondContact O-N 2.78Å
64	V	97.9	Very high	96.7	Very high	88 Å²	88	83.6 Å²	83.6	53%	0.533	45%	0.448	S	S	.	.	H	α-helix	trans	-61.2	-41.4	179.6	170.5	0	0	0	0	111.1	V60 F61 L67 L68	V60-V64 VanDerWaalsContact O-CG2 3.27Å; V60-V64 WeakPolarHBondContact O-CG2 3.37Å; V60-V64 PolarHBondContact O-N 2.97Å; F61-V64 PolarHBondContact O-N 3.42Å; V64-L67 PolarHBondContact O-N 2.93Å; V64-L68 WeakPolarHBondContact O-CB 3.43Å; V64-L68 PolarHBondContact O-N 3.44Å
65	Q	97.9	Very high	96.9	Very high	97 Å²	97	86 Å²	86	45%	0.453	45%	0.45	S	S	.	.	H	α-helix	trans	-62.1	-45.9	176.8	-177.7	59.6	32.1	0	0	111.6	F61 E62 I63 L67 L68 E69	F61-Q65 WeakPolarHBondContact O-CB 3.3Å; F61-Q65 PolarHBondContact O-N 3.42Å; E62-Q65 PolarHBondContact O-N 2.9Å; I63-Q65 VanDerWaalsContact C-N 3.3Å; I63-Q65 PolarHBondContact O-N 2.93Å; Q65-L67 PolarHBondContact O-N 3.33Å; Q65-L68 WeakPolarHBondContact O-CB 3.33Å; Q65-L68 PolarHBondContact O-N 3.39Å; Q65-E69 PolarHBondContact NE2-OE1 3.46Å; Q65-E69 WeakPolarHBondContact O-CG 3.28Å; Q65-E69 PolarHBondContact O-N 3Å
66	G	98.1	Very high	97.1	Very high	27 Å²	27	89.9 Å²	89.9	28%	0.278	47%	0.465	S	S	.	.	H	α-helix	trans	-62.2	-41.3	176.3	0	0	0	0	0	112.9	E62 I63 L68 E69 I70	E62-G66 PolarHBondContact O-N 2.86Å; I63-G66 PolarHBondContact O-N 3.32Å; G66-L68 VanDerWaalsContact C-N 3.33Å; G66-L68 PolarHBondContact O-N 3.05Å; G66-E69 PolarHBondContact O-N 3.48Å; G66-I70 WeakPolarHBondContact O-CG1 3.41Å; G66-I70 PolarHBondContact O-N 2.9Å
67	L	98.6	Very high	97.3	Very high	107 Å²	107	91.4 Å²	91.4	56%	0.56	48%	0.479	S	S	*	.	H	α-helix	trans	-64	-38.7	175.6	-69.9	175.6	0	0	0	112.1	I63 V64 Q65 I70 Q71	I63-L67 HydrophobicContact CG2-CD1 4.05Å; I63-L67 HydrophobicContact CG2-CG 4.43Å; I63-L67 WeakPolarHBondContact O-CG 3.41Å; I63-L67 PolarHBondContact O-N 2.78Å; V64-L67 PolarHBondContact O-N 2.93Å; Q65-L67 PolarHBondContact O-N 3.33Å; L67-I70 PolarHBondContact O-N 2.97Å; L67-Q71 PolarHBondContact O-N 3.43Å
68	L	98.5	Very high	97.6	Very high	64 Å²	64	91.2 Å²	91.2	34%	0.335	48%	0.477	S	S	.	.	H	α-helix	trans	-65.6	-39.6	176.9	-173.4	67.9	0	0	0	111.7	V64 Q65 G66 Q71 H72	V64-L68 WeakPolarHBondContact O-CB 3.43Å; V64-L68 PolarHBondContact O-N 3.44Å; Q65-L68 WeakPolarHBondContact O-CB 3.33Å; Q65-L68 PolarHBondContact O-N 3.39Å; G66-L68 VanDerWaalsContact C-N 3.33Å; G66-L68 PolarHBondContact O-N 3.05Å; L68-Q71 WeakPolarHBondContact O-CB 3.43Å; L68-Q71 PolarHBondContact O-N 3.2Å; L68-H72 VanDerWaalsContact O-CG 3.31Å; L68-H72 PolarHBondContact O-N 2.96Å; L68-H72 PolarHBondContact O-ND1 3.34Å
69	E	98.6	Very high	97.9	Very high	103 Å²	103	97.2 Å²	97.2	48%	0.481	50%	0.496	S	S	.	.	H	α-helix	trans	-63.9	-44.1	174.5	-73.4	172.3	-163.8	0	0	112	Q65 G66 Q71 H72 L73	Q65-E69 PolarHBondContact NE2-OE1 3.46Å; Q65-E69 WeakPolarHBondContact O-CG 3.28Å; Q65-E69 PolarHBondContact O-N 3Å; G66-E69 PolarHBondContact O-N 3.48Å; E69-Q71 VanDerWaalsContact C-N 3.3Å; E69-Q71 PolarHBondContact O-N 3.24Å; E69-H72 PolarHBondContact O-N 3.24Å; E69-L73 WeakPolarHBondContact O-CG 3.46Å; E69-L73 PolarHBondContact O-N 3.18Å
70	I	98.6	Very high	98	Very high	103 Å²	103	97.5 Å²	97.5	53%	0.528	50%	0.496	S	S	.	.	H	α-helix	trans	-59.4	-43.9	174.5	-68.5	165.8	0	0	0	110.6	G66 L67 L73 T74	G66-I70 WeakPolarHBondContact O-CG1 3.41Å; G66-I70 PolarHBondContact O-N 2.9Å; L67-I70 PolarHBondContact O-N 2.97Å; I70-L73 PolarHBondContact O-N 3.25Å; I70-T74 WeakPolarHBondContact O-CB 3.47Å; I70-T74 PolarHBondContact O-N 3.36Å; I70-T74 PolarHBondContact O-OG1 3.03Å
71	Q	98.4	Very high	98.1	Very high	94 Å²	94	98.4 Å²	98.4	44%	0.439	49%	0.494	S	S	.	.	H	α-helix	trans	-57	-54.6	175.8	178.3	-173.7	13.3	0	0	110.7	L67 L68 E69 L73 T74 E75	L67-Q71 PolarHBondContact O-N 3.43Å; L68-Q71 WeakPolarHBondContact O-CB 3.43Å; L68-Q71 PolarHBondContact O-N 3.2Å; E69-Q71 VanDerWaalsContact C-N 3.3Å; E69-Q71 PolarHBondContact O-N 3.24Å; Q71-L73 VanDerWaalsContact C-N 3.3Å; Q71-L73 PolarHBondContact O-N 3.43Å; Q71-T74 WeakPolarHBondContact O-CB 3.3Å; Q71-T74 PolarHBondContact O-N 2.97Å; Q71-E75 HydrophobicContact CG-CG 4.37Å; Q71-E75 VanDerWaalsContact CG-OE1 3.3Å; Q71-E75 WeakPolarHBondContact CG-OE1 3.4Å; Q71-E75 PolarHBondContact NE2-OE1 3.31Å; Q71-E75 WeakPolarHBondContact O-CG 3.45Å; Q71-E75 PolarHBondContact O-N 3.32Å
72	H	98.6	Very high	98.2	Very high	102 Å²	102	100.2 Å²	100.2	47%	0.472	50%	0.497	S	S	.	.	H	α-helix	trans	-59.3	-39.9	-178.3	-68	148.3	0	0	0	112.7	L68 E69 T74 K76	L68-H72 VanDerWaalsContact O-CG 3.31Å; L68-H72 PolarHBondContact O-N 2.96Å; L68-H72 PolarHBondContact O-ND1 3.34Å; E69-H72 PolarHBondContact O-N 3.24Å; H72-T74 VanDerWaalsContact C-N 3.33Å; H72-K76 WeakPolarHBondContact O-CB 3.33Å; H72-K76 PolarHBondContact O-N 3.27Å
73	L	98.7	Very high	98.1	Very high	122 Å²	122	96.7 Å²	96.7	64%	0.639	48%	0.482	S	S	*	.	H	α-helix	trans	-64	-40.3	175.6	-71.6	174.4	0	0	0	111.9	E69 I70 Q71 K76 S77	E69-L73 WeakPolarHBondContact O-CG 3.46Å; E69-L73 PolarHBondContact O-N 3.18Å; I70-L73 PolarHBondContact O-N 3.25Å; Q71-L73 VanDerWaalsContact C-N 3.3Å; Q71-L73 PolarHBondContact O-N 3.43Å; L73-K76 PolarHBondContact O-N 3.05Å; L73-S77 WeakPolarHBondContact O-CB 3.47Å; L73-S77 PolarHBondContact O-N 3.48Å
74	T	98.6	Very high	98	Very high	71 Å²	71	100.5 Å²	100.5	44%	0.436	49%	0.49	S	S	.	.	H	α-helix	trans	-65.5	-46.8	178	-57.3	0	0	0	0	111.1	I70 Q71 H72 K76 S77 L78	I70-T74 WeakPolarHBondContact O-CB 3.47Å; I70-T74 PolarHBondContact O-N 3.36Å; I70-T74 PolarHBondContact O-OG1 3.03Å; Q71-T74 WeakPolarHBondContact O-CB 3.3Å; Q71-T74 PolarHBondContact O-N 2.97Å; H72-T74 VanDerWaalsContact C-N 3.33Å; T74-K76 VanDerWaalsContact C-N 3.34Å; T74-K76 PolarHBondContact O-N 3.31Å; T74-S77 WeakPolarHBondContact O-CB 3.5Å; T74-S77 PolarHBondContact O-N 2.98Å; T74-L78 HydrophobicContact CG2-CD1 4.1Å; T74-L78 WeakPolarHBondContact O-CG 3.43Å; T74-L78 PolarHBondContact O-N 3.3Å
75	E	98.6	Very high	97.8	Very high	98 Å²	98	100.2 Å²	100.2	46%	0.458	49%	0.485	S	S	.	.	H	α-helix	trans	-59.1	-44.9	176.9	-71.8	174	-178.3	0	0	111.5	Q71 S77 L78 Y79	Q71-E75 HydrophobicContact CG-CG 4.37Å; Q71-E75 VanDerWaalsContact CG-OE1 3.3Å; Q71-E75 WeakPolarHBondContact CG-OE1 3.4Å; Q71-E75 PolarHBondContact NE2-OE1 3.31Å; Q71-E75 WeakPolarHBondContact O-CG 3.45Å; Q71-E75 PolarHBondContact O-N 3.32Å; E75-S77 VanDerWaalsContact C-N 3.35Å; E75-S77 PolarHBondContact O-N 2.99Å; E75-L78 PolarHBondContact O-N 3.38Å; E75-Y79 WeakPolarHBondContact O-CB 3.45Å; E75-Y79 PolarHBondContact O-N 2.94Å
76	K	98.6	Very high	97.6	Very high	138 Å²	138	101.2 Å²	101.2	60%	0.6	49%	0.49	S	S	*	.	H	α-helix	trans	-62.1	-41.1	175.9	-172.2	178.5	-177.8	178.1	0	112.1	H72 L73 T74 N80	H72-K76 WeakPolarHBondContact O-CB 3.33Å; H72-K76 PolarHBondContact O-N 3.27Å; L73-K76 PolarHBondContact O-N 3.05Å; T74-K76 VanDerWaalsContact C-N 3.34Å; T74-K76 PolarHBondContact O-N 3.31Å; K76-N80 WeakPolarHBondContact O-CB 3.37Å; K76-N80 VanDerWaalsContact O-CG 3.32Å; K76-N80 PolarHBondContact O-N 3.45Å; K76-N80 PolarHBondContact O-ND2 3.33Å
77	S	98.3	Very high	97.1	Very high	74 Å²	74	104.2 Å²	104.2	52%	0.517	50%	0.5	S	S	.	.	H	α-helix	trans	-62.8	-49.6	177.5	-173.6	0	0	0	0	111.8	L73 T74 E75 Y79 N80 Q81	L73-S77 WeakPolarHBondContact O-CB 3.47Å; L73-S77 PolarHBondContact O-N 3.48Å; T74-S77 WeakPolarHBondContact O-CB 3.5Å; T74-S77 PolarHBondContact O-N 2.98Å; E75-S77 VanDerWaalsContact C-N 3.35Å; E75-S77 PolarHBondContact O-N 2.99Å; S77-Y79 VanDerWaalsContact C-N 3.35Å; S77-Y79 PolarHBondContact O-N 3.42Å; S77-N80 PolarHBondContact O-N 3.44Å; S77-Q81 WeakPolarHBondContact O-CB 3.39Å; S77-Q81 PolarHBondContact O-N 2.99Å
78	L	98.4	Very high	96.6	Very high	98 Å²	98	105.1 Å²	105.1	51%	0.513	50%	0.501	S	S	.	.	H	α-helix	trans	-62.7	-40.6	178.8	-69.7	172	0	0	0	112.2	T74 E75 Q81 R82	T74-L78 HydrophobicContact CG2-CD1 4.1Å; T74-L78 WeakPolarHBondContact O-CG 3.43Å; T74-L78 PolarHBondContact O-N 3.3Å; E75-L78 PolarHBondContact O-N 3.38Å; L78-Q81 PolarHBondContact O-N 3.44Å; L78-R82 PolarHBondContact O-N 3.16Å
79	Y	98.4	Very high	95.7	Very high	142 Å²	142	109.1 Å²	109.1	56%	0.557	52%	0.518	S	S	*	.	H	α-helix	trans	-60.3	-48	174.5	177.5	-97.7	0	0	0	111.6	E75 S77 Q81 R82 L83	E75-Y79 WeakPolarHBondContact O-CB 3.45Å; E75-Y79 PolarHBondContact O-N 2.94Å; S77-Y79 VanDerWaalsContact C-N 3.35Å; S77-Y79 PolarHBondContact O-N 3.42Å; Y79-Q81 VanDerWaalsContact C-N 3.33Å; Y79-Q81 PolarHBondContact O-N 3.23Å; Y79-R82 PolarHBondContact O-N 3.41Å; Y79-L83 PolarHBondContact O-N 2.89Å
80	N	97.7	Very high	94.3	Very high	65 Å²	65	114.5 Å²	114.5	35%	0.348	53%	0.534	S	S	.	.	H	α-helix	trans	-64	-38.1	178	-75	-38.7	0	0	0	112.4	K76 S77 L83 R84	K76-N80 WeakPolarHBondContact O-CB 3.37Å; K76-N80 VanDerWaalsContact O-CG 3.32Å; K76-N80 PolarHBondContact O-N 3.45Å; K76-N80 PolarHBondContact O-ND2 3.33Å; S77-N80 PolarHBondContact O-N 3.44Å; N80-L83 PolarHBondContact O-N 3.02Å; N80-R84 WeakPolarHBondContact O-CG 3.36Å; N80-R84 PolarHBondContact O-N 3.33Å
81	Q	97.5	Very high	92.5	Very high	110 Å²	110	112.8 Å²	112.8	51%	0.514	54%	0.541	S	S	.	.	H	α-helix	trans	-61.3	-46.1	175.1	-177.1	179.8	-4.7	0	0	111.2	S77 L78 Y79 L83 R84 L85	S77-Q81 WeakPolarHBondContact O-CB 3.39Å; S77-Q81 PolarHBondContact O-N 2.99Å; L78-Q81 PolarHBondContact O-N 3.44Å; Y79-Q81 VanDerWaalsContact C-N 3.33Å; Y79-Q81 PolarHBondContact O-N 3.23Å; Q81-L83 VanDerWaalsContact C-N 3.33Å; Q81-L83 PolarHBondContact O-N 3.1Å; Q81-R84 PolarHBondContact O-N 2.98Å; Q81-L85 WeakPolarHBondContact O-CG 3.47Å; Q81-L85 PolarHBondContact O-N 3.05Å; Q81-L85 VanDerWaalsContact O-N 3.1Å
82	R	97	Very high	90.4	Very high	162 Å²	162	111.5 Å²	111.5	61%	0.611	55%	0.553	S	S	*	*	H	α-helix	trans	-59.2	-45	175.4	-178.6	-178.7	-63.9	158.5	1.9	111.7	L78 Y79 R84 L85 Q86	L78-R82 PolarHBondContact O-N 3.16Å; Y79-R82 PolarHBondContact O-N 3.41Å; R82-R84 VanDerWaalsContact C-N 3.34Å; R82-R84 PolarHBondContact O-N 3.48Å; R82-L85 PolarHBondContact O-N 3.02Å; R82-Q86 WeakPolarHBondContact O-CG 3.48Å; R82-Q86 PolarHBondContact O-N 2.7Å
83	L	96.1	Very high	88.2	Confident	67 Å²	67	109.5 Å²	109.5	35%	0.351	56%	0.56	S	S	.	*	H	α-helix	trans	-62.6	-41.4	-179.9	-174.8	64.2	0	0	0	111.9	Y79 N80 Q81 Q86 N87	Y79-L83 PolarHBondContact O-N 2.89Å; N80-L83 PolarHBondContact O-N 3.02Å; Q81-L83 VanDerWaalsContact C-N 3.33Å; Q81-L83 PolarHBondContact O-N 3.1Å; L83-Q86 PolarHBondContact O-N 3.45Å; L83-N87 WeakPolarHBondContact O-CB 3.48Å; L83-N87 PolarHBondContact O-N 3.01Å; L83-N87 PolarHBondContact O-ND2 2.92Å
84	R	94.8	Very high	86.2	Confident	178 Å²	178	107.5 Å²	107.5	67%	0.672	56%	0.561	S	S	*	*	H	α-helix	trans	-58.6	-50.3	174.7	-74.1	177.3	-178.1	-172.8	0.5	111.5	N80 Q81 R82 Q86 N87 E88	N80-R84 WeakPolarHBondContact O-CG 3.36Å; N80-R84 PolarHBondContact O-N 3.33Å; Q81-R84 PolarHBondContact O-N 2.98Å; R82-R84 VanDerWaalsContact C-N 3.34Å; R82-R84 PolarHBondContact O-N 3.48Å; R84-Q86 VanDerWaalsContact C-N 3.34Å; R84-Q86 PolarHBondContact O-N 3.45Å; R84-N87 PolarHBondContact O-N 3.33Å; R84-N87 VanDerWaalsContact O-N 3.16Å; R84-E88 WeakPolarHBondContact O-CG 3.38Å; R84-E88 PolarHBondContact O-N 3.02Å
85	L	94.3	Very high	84.1	Confident	82 Å²	82	110 Å²	110	43%	0.429	58%	0.579	S	S	.	*	H	α-helix	trans	-58.1	-46.8	177.2	-69.2	171.2	0	0	0	111.1	Q81 R82 N87 E88 H89	Q81-L85 WeakPolarHBondContact O-CG 3.47Å; Q81-L85 PolarHBondContact O-N 3.05Å; Q81-L85 VanDerWaalsContact O-N 3.1Å; R82-L85 PolarHBondContact O-N 3.02Å; L85-N87 VanDerWaalsContact C-N 3.3Å; L85-N87 PolarHBondContact O-N 3.35Å; L85-E88 PolarHBondContact O-N 3.28Å; L85-H89 PolarHBondContact O-N 3.25Å; L85-H89 PolarHBondContact O-ND1 2.97Å
86	Q	92.3	Very high	82	Confident	118 Å²	118	112.9 Å²	112.9	55%	0.551	60%	0.597	S	S	*	*	H	α-helix	trans	-59.9	-40.6	177.9	-75.6	-176.6	-23.6	0	0	112.8	R82 L83 R84 H89 R90	R82-Q86 WeakPolarHBondContact O-CG 3.48Å; R82-Q86 PolarHBondContact O-N 2.7Å; L83-Q86 PolarHBondContact O-N 3.45Å; R84-Q86 VanDerWaalsContact C-N 3.34Å; R84-Q86 PolarHBondContact O-N 3.45Å; Q86-H89 PolarHBondContact O-N 3.36Å; Q86-R90 WeakPolarHBondContact O-CB 3.37Å; Q86-R90 PolarHBondContact O-N 3.34Å
87	N	88.8	Confident	80.4	Confident	91 Å²	91	115.6 Å²	115.6	49%	0.487	63%	0.629	S	S	.	*	H	α-helix	trans	-67.4	-39.6	177.8	-69.3	-23.1	0	0	0	112	L83 R84 L85 R90 G91	L83-N87 WeakPolarHBondContact O-CB 3.48Å; L83-N87 PolarHBondContact O-N 3.01Å; L83-N87 PolarHBondContact O-ND2 2.92Å; R84-N87 PolarHBondContact O-N 3.33Å; R84-N87 VanDerWaalsContact O-N 3.16Å; L85-N87 VanDerWaalsContact C-N 3.3Å; L85-N87 PolarHBondContact O-N 3.35Å; N87-R90 PolarHBondContact O-N 2.96Å; N87-G91 PolarHBondContact O-N 3.23Å
88	E	88.8	Confident	79.5	Confident	126 Å²	126	117.7 Å²	117.7	59%	0.589	64%	0.635	S	S	*	*	H	α-helix	trans	-59.9	-47.5	173.8	-72.4	167.5	-175.5	0	0	111.3	R84 L85 R90 G91 G92	R84-E88 WeakPolarHBondContact O-CG 3.38Å; R84-E88 PolarHBondContact O-N 3.02Å; L85-E88 PolarHBondContact O-N 3.28Å; E88-R90 VanDerWaalsContact C-N 3.28Å; E88-R90 PolarHBondContact O-N 3.27Å; E88-G91 PolarHBondContact O-N 3.08Å; E88-G92 PolarHBondContact O-N 3.31Å; E88-G92 VanDerWaalsContact O-N 3.08Å
89	H	78.1	Confident	78.5	Confident	147 Å²	147	118.7 Å²	118.7	68%	0.681	64%	0.641	S	S	*	*	H	α-helix	trans	-64.8	-31.2	177.5	-69.7	90.1	0	0	0	112.9	L85 Q86	L85-H89 PolarHBondContact O-N 3.25Å; L85-H89 PolarHBondContact O-ND1 2.97Å; Q86-H89 PolarHBondContact O-N 3.36Å
90	R	70.6	Confident	77.4	Confident	216 Å²	216	117.4 Å²	117.4	82%	0.815	65%	0.646	S	S	*	*	H	α-helix	trans	-80.8	-28.2	178.7	-163.9	175.9	170.5	-168.5	-3.5	112.9	Q86 N87 E88	Q86-R90 WeakPolarHBondContact O-CB 3.37Å; Q86-R90 PolarHBondContact O-N 3.34Å; N87-R90 PolarHBondContact O-N 2.96Å; E88-R90 VanDerWaalsContact C-N 3.28Å; E88-R90 PolarHBondContact O-N 3.27Å
91	G	59	Low	76.2	Confident	67 Å²	67	120.5 Å²	120.5	69%	0.691	66%	0.664	S	S	*	*	H	α-helix	trans	-79.7	-22	173.7	0	0	0	0	0	114.2	N87 E88 G93	N87-G91 PolarHBondContact O-N 3.23Å; E88-G91 PolarHBondContact O-N 3.08Å; G91-G93 VanDerWaalsContact C-N 3.32Å
92	G	55.2	Low	74.9	Confident	67 Å²	67	121.2 Å²	121.2	69%	0.691	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.8	1	176	0	0	0	0	0	115.5	E88	E88-G92 PolarHBondContact O-N 3.31Å; E88-G92 VanDerWaalsContact O-N 3.08Å
93	G	53.4	Low	73.4	Confident	60 Å²	60	118.5 Å²	118.5	62%	0.619	68%	0.677	S	S	*	*			trans	-101.8	52.7	177.5	0	0	0	0	0	112.7	G91	G91-G93 VanDerWaalsContact C-N 3.32Å
94	A	54.7	Low	71.8	Confident	80 Å²	80	122.1 Å²	122.1	66%	0.661	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-77.7	126.1	157	0	0	0	0	0	107	D96	A94-D96 PolarHBondContact O-N 2.91Å
95	P	55	Low	70	Confident	124 Å²	124	117.8 Å²	117.8	81%	0.805	70%	0.703	S	S	*	*	P	Polyproline II helix	trans	-62.1	123.6	168.7	26.1	-30.2	0	0	0	108
96	D	55.7	Low	68	Low	158 Å²	158	120.8 Å²	120.8	85%	0.845	73%	0.726	S	S	*	*	P	Polyproline II helix	trans	-55	147.3	165.3	-90.6	-36.9	0	0	0	109.7	A94	A94-D96 PolarHBondContact O-N 2.91Å
97	P	63.9	Low	65.8	Low	196 Å²	196	121.1 Å²	121.1	100%	1.273	74%	0.741	S	S	*	*			trans	-61.6	0	-164.5	25.8	-36.7	0	0	0	115.8

Retrieved 97 of 97 residues in 20.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).