X5DS90_HUMAN Loading...

Cytochrome b

AlphaFold DB , UniProt , Accession X5DS90, Species HUMAN (Homo sapiens, Human), Gene CYTB, Length 76 aa.

						>X5DS90_HUMAN|X5DS90|CYTB
PILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASMLYFTTILILMPTISLIENKMLKWA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	P	49.8	Very low	49.8	Very low	150 Å²	150	118.3 Å²	118.3	97%	0.974	61%	0.609	S	S	*	*				0	-50.8	0	-8.5	27.5	0	0	0	113.9
2	I	54.1	Low	49.6	Very low	160 Å²	160	120.1 Å²	120.1	82%	0.821	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.8	-29.3	-176.4	-65.8	163.4	0	0	0	113.2
3	L	47.6	Very low	49.8	Very low	108 Å²	108	121.6 Å²	121.6	57%	0.565	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91	4.8	176.4	-70.9	170.7	0	0	0	114.1	M5 I58 L59	L3-M5 PolarHBondContact O-N 3.25Å; L3-I58 HydrophobicContact CD1-CG2 4.43Å; L3-L59 HydrophobicContact CD1-CD2 4.47Å
4	H	44.8	Very low	50.7	Low	146 Å²	146	113.8 Å²	113.8	68%	0.676	58%	0.575	S	S	*	*			trans	-77.3	92.1	175.5	-86.6	-75.8	0	0	0	110.2	S6	H4-S6 VanDerWaalsContact C-N 3.32Å
5	M	56.7	Low	51.8	Low	141 Å²	141	112.2 Å²	112.2	70%	0.695	58%	0.576	S	S	*	*			trans	-90.6	6.8	171.8	-67.6	-81.3	174	0	0	112.7	L3	L3-M5 PolarHBondContact O-N 3.25Å
6	S	44.7	Very low	53	Low	29 Å²	29	109.4 Å²	109.4	20%	0.203	56%	0.562	C	S	.	*			trans	-92.9	127.2	-176.9	178.3	0	0	0	0	111.6	H4 Q8 R14	H4-S6 VanDerWaalsContact C-N 3.32Å; S6-Q8 PolarHBondContact O-N 2.9Å; S6-Q8 PolarHBondContact OG-N 3.26Å; S6-Q8 PolarHBondContact OG-O 3.36Å; S6-R14 VanDerWaalsContact CB-NH1 3.26Å; S6-R14 PolarHBondContact OG-NH1 3.03Å
7	K	51.7	Low	54.2	Low	156 Å²	156	103.4 Å²	103.4	68%	0.678	53%	0.531	S	S	*	.	S	Bend	trans	-69.3	-12.7	171.3	-83.1	-174.8	179.2	173.5	0	113.5	W75 A76	K7-W75 HydrophobicContact CB-CE3 4.44Å; K7-W75 HydrophobicContact CB-CZ3 4.36Å; K7-A76 PolarHBondContact NZ-O 2.94Å
8	Q	43.8	Very low	55.3	Low	58 Å²	58	102.1 Å²	102.1	27%	0.271	52%	0.523	S	S	.	.			trans	-109.6	131.3	175	-89.9	173.1	-29.3	0	0	111.3	S6 W75	S6-Q8 PolarHBondContact O-N 2.9Å; S6-Q8 PolarHBondContact OG-N 3.26Å; S6-Q8 PolarHBondContact OG-O 3.36Å; Q8-W75 HydrophobicContact CG-CH2 4.12Å; Q8-W75 HydrophobicContact CG-CZ3 3.86Å
9	Q	52	Low	56.7	Low	208 Å²	208	100.2 Å²	100.2	97%	0.972	52%	0.519	S	S	*	.	S	Bend	trans	-80.1	-18.1	178.6	-166	170.5	-18.1	0	0	112.8
10	S	47.4	Very low	58	Low	65 Å²	65	95.7 Å²	95.7	46%	0.455	50%	0.496	S	S	.	.			trans	-106.1	129.3	-178.9	-177.1	0	0	0	0	111.8	M12	S10-M12 PolarHBondContact O-N 3.47Å; S10-M12 WeakPolarHBondContact OG-CB 3.41Å; S10-M12 PolarHBondContact OG-N 3.46Å
11	M	55	Low	59.2	Low	80 Å²	80	97.2 Å²	97.2	39%	0.394	50%	0.496	S	S	.	.	G	3₁₀ helix	trans	-76.1	2.2	175.1	-139.8	169.5	-144.9	0	0	112.6	F13 Q18 Y21	M11-F13 PolarHBondContact O-N 3.24Å; M11-Q18 HydrophobicContact CG-CG 4.33Å; M11-Q18 WeakPolarHBondContact O-CG 3.43Å; M11-Q18 PolarHBondContact O-NE2 2.89Å; M11-Y21 HydrophobicContact SD-CG 4.32Å
12	M	47.8	Very low	60.8	Low	140 Å²	140	98.8 Å²	98.8	69%	0.69	48%	0.483	S	S	*	.	G	3₁₀ helix	trans	-70.2	-25.1	-172.2	-167.4	173.9	177.7	0	0	114	S10	S10-M12 PolarHBondContact O-N 3.47Å; S10-M12 WeakPolarHBondContact OG-CB 3.41Å; S10-M12 PolarHBondContact OG-N 3.46Å
13	F	51.4	Low	62.3	Low	140 Å²	140	95.2 Å²	95.2	61%	0.614	47%	0.465	S	S	*	.	G	3₁₀ helix	trans	-106.7	18.3	-177.6	-67.5	-76.2	0	0	0	114.1	M11	M11-F13 PolarHBondContact O-N 3.24Å
14	R	63.6	Low	64.3	Low	12 Å²	12	91 Å²	91	5%	0.045	44%	0.443	C	S	.	.			trans	-132.7	80.4	-170.7	-69.6	-175.2	65.8	-160.9	-14.9	111.3	S6 L16 S17 Q18 S66 E69	S6-R14 VanDerWaalsContact CB-NH1 3.26Å; S6-R14 PolarHBondContact OG-NH1 3.03Å; R14-L16 PolarHBondContact O-N 3.29Å; R14-S17 PolarHBondContact NE-OG 2.95Å; R14-S17 PolarHBondContact NH2-OG 3.09Å; R14-S17 PolarHBondContact O-N 3.39Å; R14-S17 VanDerWaalsContact O-N 3.12Å; R14-Q18 PolarHBondContact O-N 2.93Å; R14-S66 PolarHBondContact NH1-OG 3.24Å; R14-S66 VanDerWaalsContact NH2-CB 3.31Å; R14-S66 PolarHBondContact NH2-OG 2.88Å; R14-E69 WeakPolarHBondContact CA-OE1 3.49Å; R14-E69 WeakPolarHBondContact CB-OE1 3.49Å; R14-E69 WeakPolarHBondContact CB-OE2 3.39Å; R14-E69 IonicContact CZ-OE2 3.12Å; R14-E69 IonicContact NE-OE2 2.71Å; R14-E69 PolarHBondContact NE-OE2 2.92Å; R14-E69 IonicContact NH2-OE2 2.7Å; R14-E69 PolarHBondContact NH2-OE2 2.78Å
15	P	66.9	Low	66.4	Low	90 Å²	90	85.5 Å²	85.5	58%	0.584	42%	0.423	S	S	*	.	H	α-helix	trans	-62	-28.6	-173.2	24.3	-33.3	0	0	0	113.4	S19	P15-S19 PolarHBondContact O-N 3.46Å
16	L	70.7	Confident	68.1	Low	68 Å²	68	81 Å²	81	36%	0.356	41%	0.408	S	S	.	.	H	α-helix	trans	-77.5	-31.6	177.1	-60.7	169.2	0	0	0	111.8	R14 S19 L20 I65 E69	R14-L16 PolarHBondContact O-N 3.29Å; L16-S19 PolarHBondContact O-OG 3.49Å; L16-L20 PolarHBondContact O-N 3.41Å; L16-I65 HydrophobicContact CB-CD1 4.37Å; L16-I65 HydrophobicContact CB-CG2 3.59Å; L16-E69 WeakPolarHBondContact CA-OE1 3.47Å; L16-E69 HydrophobicContact CB-CG 4.14Å; L16-E69 VanDerWaalsContact CB-OE1 3.31Å; L16-E69 WeakPolarHBondContact CB-OE1 3.37Å; L16-E69 HydrophobicContact CD1-CG 3.96Å; L16-E69 HydrophobicContact CG-CG 4.46Å; L16-E69 PolarHBondContact N-OE1 3.33Å
17	S	72.8	Confident	70.3	Confident	6 Å²	6	80 Å²	80	4%	0.042	40%	0.401	C	S	.	.	H	α-helix	trans	-71.5	-35.4	172.2	-69.7	0	0	0	0	112.8	R14 L20 Y21 E69	R14-S17 PolarHBondContact NE-OG 2.95Å; R14-S17 PolarHBondContact NH2-OG 3.09Å; R14-S17 PolarHBondContact O-N 3.39Å; R14-S17 VanDerWaalsContact O-N 3.12Å; S17-L20 PolarHBondContact O-N 3.14Å; S17-Y21 PolarHBondContact O-N 3.16Å; S17-E69 PolarHBondContact N-OE1 3.11Å; S17-E69 PolarHBondContact OG-OE2 3.01Å
18	Q	75.4	Confident	72.1	Confident	80 Å²	80	76.1 Å²	76.1	37%	0.374	39%	0.387	S	S	.	.	H	α-helix	trans	-64	-42.5	174	-73.3	-178.7	6.2	0	0	111.8	M11 R14 L20 Y21 W22	M11-Q18 HydrophobicContact CG-CG 4.33Å; M11-Q18 WeakPolarHBondContact O-CG 3.43Å; M11-Q18 PolarHBondContact O-NE2 2.89Å; R14-Q18 PolarHBondContact O-N 2.93Å; Q18-L20 PolarHBondContact O-N 2.92Å; Q18-Y21 WeakPolarHBondContact O-CB 3.41Å; Q18-Y21 PolarHBondContact O-N 3.02Å; Q18-W22 VanDerWaalsContact O-CD1 3.23Å; Q18-W22 PolarHBondContact O-N 2.74Å
19	S	81.8	Confident	74.4	Confident	66 Å²	66	79.3 Å²	79.3	46%	0.462	41%	0.405	S	S	.	.	H	α-helix	trans	-64.4	-39.5	176.9	66.8	0	0	0	0	112.1	P15 L16 Y21 W22 L23	P15-S19 PolarHBondContact O-N 3.46Å; L16-S19 PolarHBondContact O-OG 3.49Å; S19-Y21 VanDerWaalsContact C-N 3.34Å; S19-Y21 PolarHBondContact O-N 3.32Å; S19-W22 PolarHBondContact O-N 2.94Å; S19-L23 WeakPolarHBondContact O-CB 3.31Å; S19-L23 PolarHBondContact O-N 3.34Å
20	L	82.2	Confident	76.2	Confident	11 Å²	11	72.9 Å²	72.9	6%	0.058	38%	0.376	C	S	.	.	H	α-helix	trans	-62.5	-38.7	172.7	-85.1	177.5	0	0	0	113.4	L16 S17 Q18 L23 L24 T57 L61 I65	L16-L20 PolarHBondContact O-N 3.41Å; S17-L20 PolarHBondContact O-N 3.14Å; Q18-L20 PolarHBondContact O-N 2.92Å; L20-L23 PolarHBondContact O-N 3.16Å; L20-L24 WeakPolarHBondContact O-CB 3.28Å; L20-L24 PolarHBondContact O-N 2.92Å; L20-T57 HydrophobicContact CD2-CG2 4.18Å; L20-L61 HydrophobicContact CD1-CB 4.13Å; L20-L61 HydrophobicContact CD2-CB 3.76Å; L20-L61 HydrophobicContact CD2-CD2 3.56Å; L20-L61 HydrophobicContact CD2-CG 4.25Å; L20-I65 HydrophobicContact CD1-CB 3.57Å; L20-I65 HydrophobicContact CD1-CD1 3.38Å; L20-I65 HydrophobicContact CD1-CG1 3.5Å; L20-I65 HydrophobicContact CD1-CG2 3.95Å; L20-I65 HydrophobicContact CD2-CD1 4.35Å; L20-I65 HydrophobicContact CG-CD1 3.77Å; L20-I65 HydrophobicContact CG-CG1 4.42Å
21	Y	82.3	Confident	78.2	Confident	127 Å²	127	71.8 Å²	71.8	50%	0.498	37%	0.365	S	S	.	.	H	α-helix	trans	-62.5	-45.2	176.3	176.3	-98.3	0	0	0	111.3	M11 S17 Q18 S19 L23 L24 A25	M11-Y21 HydrophobicContact SD-CG 4.32Å; S17-Y21 PolarHBondContact O-N 3.16Å; Q18-Y21 WeakPolarHBondContact O-CB 3.41Å; Q18-Y21 PolarHBondContact O-N 3.02Å; S19-Y21 VanDerWaalsContact C-N 3.34Å; S19-Y21 PolarHBondContact O-N 3.32Å; Y21-L23 VanDerWaalsContact C-N 3.33Å; Y21-L23 PolarHBondContact O-N 3.31Å; Y21-L24 PolarHBondContact O-N 3.21Å; Y21-A25 WeakPolarHBondContact O-CB 3.34Å; Y21-A25 PolarHBondContact O-N 3.29Å
22	W	83.9	Confident	79.8	Confident	184 Å²	184	73.1 Å²	73.1	70%	0.697	38%	0.378	S	S	*	.	H	α-helix	trans	-65.4	-35.6	175.2	-79.3	108.5	0	0	0	112.8	Q18 S19 A25 A26	Q18-W22 VanDerWaalsContact O-CD1 3.23Å; Q18-W22 PolarHBondContact O-N 2.74Å; S19-W22 PolarHBondContact O-N 2.94Å; W22-A25 PolarHBondContact O-N 3.14Å; W22-A26 WeakPolarHBondContact O-CB 3.34Å; W22-A26 PolarHBondContact O-N 3.12Å
23	L	86.5	Confident	81.8	Confident	84 Å²	84	73.7 Å²	73.7	44%	0.44	37%	0.373	S	S	.	.	H	α-helix	trans	-63.2	-44.7	173.7	-169.9	152.2	0	0	0	111.2	S19 L20 Y21 A26 D27 T57	S19-L23 WeakPolarHBondContact O-CB 3.31Å; S19-L23 PolarHBondContact O-N 3.34Å; L20-L23 PolarHBondContact O-N 3.16Å; Y21-L23 VanDerWaalsContact C-N 3.33Å; Y21-L23 PolarHBondContact O-N 3.31Å; L23-A26 PolarHBondContact O-N 3.25Å; L23-D27 WeakPolarHBondContact O-CB 3.4Å; L23-D27 PolarHBondContact O-N 3.2Å; L23-T57 HydrophobicContact CD2-CG2 4.22Å
24	L	88.6	Confident	83.7	Confident	21 Å²	21	68 Å²	68	11%	0.11	35%	0.348	C	S	.	.	H	α-helix	trans	-63.5	-40.7	175.3	-172.9	74.1	0	0	0	111.9	L20 Y21 D27 L28 Y54 T57 I58 M62	L20-L24 WeakPolarHBondContact O-CB 3.28Å; L20-L24 PolarHBondContact O-N 2.92Å; Y21-L24 PolarHBondContact O-N 3.21Å; L24-D27 PolarHBondContact O-N 2.7Å; L24-L28 WeakPolarHBondContact O-CG 3.48Å; L24-L28 PolarHBondContact O-N 2.74Å; L24-Y54 HydrophobicContact CD1-CD2 3.74Å; L24-Y54 HydrophobicContact CD1-CE2 3.77Å; L24-T57 HydrophobicContact CB-CG2 4.39Å; L24-T57 HydrophobicContact CD1-CG2 4.11Å; L24-I58 HydrophobicContact CD1-CD1 4.02Å; L24-I58 HydrophobicContact CD1-CG1 3.74Å; L24-I58 HydrophobicContact CD2-CD1 4.47Å; L24-I58 HydrophobicContact CD2-CG1 4.31Å; L24-M62 HydrophobicContact CD2-CE 4.25Å
25	A	89.6	Confident	84.8	Confident	29 Å²	29	70.7 Å²	70.7	24%	0.24	38%	0.38	C	S	.	.	H	α-helix	trans	-62.7	-42.4	176.1	0	0	0	0	0	111.6	Y21 W22 L28 L29	Y21-A25 WeakPolarHBondContact O-CB 3.34Å; Y21-A25 PolarHBondContact O-N 3.29Å; W22-A25 PolarHBondContact O-N 3.14Å; A25-L28 PolarHBondContact O-N 3.41Å; A25-L29 WeakPolarHBondContact O-CG 3.47Å; A25-L29 PolarHBondContact O-N 2.94Å; A25-L29 VanDerWaalsContact O-N 3.11Å
26	A	91.7	Very high	85.8	Confident	46 Å²	46	69.6 Å²	69.6	38%	0.38	39%	0.385	S	S	.	.	H	α-helix	trans	-64	-41.8	174.6	0	0	0	0	0	112.1	W22 L23 L28 L29 I30	W22-A26 WeakPolarHBondContact O-CB 3.34Å; W22-A26 PolarHBondContact O-N 3.12Å; L23-A26 PolarHBondContact O-N 3.25Å; A26-L28 PolarHBondContact O-N 3.39Å; A26-L29 WeakPolarHBondContact O-CB 3.44Å; A26-L29 PolarHBondContact O-N 2.61Å; A26-I30 VanDerWaalsContact O-CG1 3.32Å; A26-I30 WeakPolarHBondContact O-CG1 3.29Å; A26-I30 PolarHBondContact O-N 2.74Å
27	D	90.6	Very high	86.5	Confident	10 Å²	10	69.6 Å²	69.6	5%	0.053	38%	0.383	C	S	.	.	H	α-helix	trans	-63.5	-40.7	178	-171	72.4	0	0	0	112.2	L23 L24 L29 I30 L31 Y54	L23-D27 WeakPolarHBondContact O-CB 3.4Å; L23-D27 PolarHBondContact O-N 3.2Å; L24-D27 PolarHBondContact O-N 2.7Å; D27-L29 PolarHBondContact O-N 2.71Å; D27-I30 PolarHBondContact O-N 3.42Å; D27-L31 WeakPolarHBondContact O-CB 3.31Å; D27-L31 WeakPolarHBondContact O-CG 3.2Å; D27-L31 PolarHBondContact O-N 2.7Å; D27-Y54 WeakPolarHBondContact OD2-CA 3.37Å; D27-Y54 WeakPolarHBondContact OD2-CB 3.15Å; D27-Y54 PolarHBondContact OD2-N 2.9Å
28	L	90.2	Very high	87	Confident	74 Å²	74	73.3 Å²	73.3	39%	0.387	41%	0.407	S	S	.	.	H	α-helix	trans	-62.8	-39.2	172.5	-77.3	173.2	0	0	0	112.9	L24 A25 A26 L31 T32 Y54	L24-L28 WeakPolarHBondContact O-CG 3.48Å; L24-L28 PolarHBondContact O-N 2.74Å; A25-L28 PolarHBondContact O-N 3.41Å; A26-L28 PolarHBondContact O-N 3.39Å; L28-L31 PolarHBondContact O-N 3.02Å; L28-T32 WeakPolarHBondContact O-CB 3.49Å; L28-T32 PolarHBondContact O-N 3.48Å; L28-T32 PolarHBondContact O-OG1 3.08Å; L28-Y54 HydrophobicContact CD2-CD2 4.1Å; L28-Y54 HydrophobicContact CD2-CE2 3.54Å; L28-Y54 HydrophobicContact CG-CD2 4.44Å; L28-Y54 HydrophobicContact CG-CE2 3.99Å
29	L	93	Very high	87.2	Confident	124 Å²	124	75.9 Å²	75.9	65%	0.649	43%	0.428	S	S	*	.	H	α-helix	trans	-64.3	-41.5	174.7	-71.4	171.7	0	0	0	111.3	A25 A26 D27 T32 W33	A25-L29 WeakPolarHBondContact O-CG 3.47Å; A25-L29 PolarHBondContact O-N 2.94Å; A25-L29 VanDerWaalsContact O-N 3.11Å; A26-L29 WeakPolarHBondContact O-CB 3.44Å; A26-L29 PolarHBondContact O-N 2.61Å; D27-L29 PolarHBondContact O-N 2.71Å; L29-T32 PolarHBondContact O-N 3.36Å; L29-W33 WeakPolarHBondContact O-CB 3.33Å; L29-W33 PolarHBondContact O-N 2.95Å
30	I	88.8	Confident	87.3	Confident	73 Å²	73	75.3 Å²	75.3	37%	0.374	42%	0.424	S	S	.	.	H	α-helix	trans	-63.9	-45.9	176.5	-68.2	165.1	0	0	0	110.7	A26 D27 T32 W33 I34 A50	A26-I30 VanDerWaalsContact O-CG1 3.32Å; A26-I30 WeakPolarHBondContact O-CG1 3.29Å; A26-I30 PolarHBondContact O-N 2.74Å; D27-I30 PolarHBondContact O-N 3.42Å; I30-T32 VanDerWaalsContact C-N 3.35Å; I30-T32 PolarHBondContact O-N 2.92Å; I30-W33 PolarHBondContact O-N 2.9Å; I30-I34 HydrophobicContact CG2-CD1 3.6Å; I30-I34 HydrophobicContact CG2-CG1 4.4Å; I30-I34 VanDerWaalsContact O-CG1 3.27Å; I30-I34 WeakPolarHBondContact O-CG1 3.2Å; I30-I34 PolarHBondContact O-N 3.47Å; I30-A50 HydrophobicContact CG2-CB 4.34Å
31	L	88.6	Confident	87.2	Confident	43 Å²	43	84 Å²	84	23%	0.225	46%	0.457	C	S	.	.	H	α-helix	trans	-60.9	-42.4	176.4	-80.3	162.4	0	0	0	112.2	D27 L28 W33 I34 G35 A50 Y54	D27-L31 WeakPolarHBondContact O-CB 3.31Å; D27-L31 WeakPolarHBondContact O-CG 3.2Å; D27-L31 PolarHBondContact O-N 2.7Å; L28-L31 PolarHBondContact O-N 3.02Å; L31-W33 VanDerWaalsContact C-N 3.34Å; L31-I34 PolarHBondContact O-N 3.15Å; L31-G35 PolarHBondContact O-N 3.44Å; L31-A50 HydrophobicContact CD2-CB 3.89Å; L31-A50 HydrophobicContact CG-CB 3.99Å; L31-Y54 HydrophobicContact CD1-CD2 4.26Å; L31-Y54 HydrophobicContact CD1-CG 4.28Å
32	T	90.4	Very high	87.2	Confident	108 Å²	108	80.8 Å²	80.8	66%	0.663	45%	0.452	S	S	*	.	H	α-helix	trans	-63.7	-42.3	177	-55.1	0	0	0	0	111	L28 L29 I30 G35	L28-T32 WeakPolarHBondContact O-CB 3.49Å; L28-T32 PolarHBondContact O-N 3.48Å; L28-T32 PolarHBondContact O-OG1 3.08Å; L29-T32 PolarHBondContact O-N 3.36Å; I30-T32 VanDerWaalsContact C-N 3.35Å; I30-T32 PolarHBondContact O-N 2.92Å; T32-G35 PolarHBondContact O-N 3.31Å
33	W	89.3	Confident	87.3	Confident	151 Å²	151	74.4 Å²	74.4	57%	0.572	43%	0.429	S	S	*	.	H	α-helix	trans	-64.9	-43.7	177.4	178.4	58.5	0	0	0	112.2	L29 I30 L31 G35 G36 F43	L29-W33 WeakPolarHBondContact O-CB 3.33Å; L29-W33 PolarHBondContact O-N 2.95Å; I30-W33 PolarHBondContact O-N 2.9Å; L31-W33 VanDerWaalsContact C-N 3.34Å; W33-G35 VanDerWaalsContact C-N 3.34Å; W33-G35 PolarHBondContact O-N 3.01Å; W33-G36 PolarHBondContact O-N 2.81Å; W33-F43 HydrophobicContact CH2-CE1 4.49Å
34	I	90.7	Very high	87.3	Confident	21 Å²	21	73.2 Å²	73.2	11%	0.108	43%	0.425	C	S	.	.	H	α-helix	trans	-67.5	-34.2	178.2	-67.7	166.2	0	0	0	111.6	I30 L31 G36 Q37 I46	I30-I34 HydrophobicContact CG2-CD1 3.6Å; I30-I34 HydrophobicContact CG2-CG1 4.4Å; I30-I34 VanDerWaalsContact O-CG1 3.27Å; I30-I34 WeakPolarHBondContact O-CG1 3.2Å; I30-I34 PolarHBondContact O-N 3.47Å; L31-I34 PolarHBondContact O-N 3.15Å; I34-G36 PolarHBondContact O-N 2.98Å; I34-G36 VanDerWaalsContact O-N 3.17Å; I34-Q37 PolarHBondContact O-N 3.28Å; I34-I46 HydrophobicContact CD1-CB 3.91Å; I34-I46 HydrophobicContact CD1-CG2 3.39Å; I34-I46 HydrophobicContact CG1-CG2 4.48Å
35	G	87.6	Confident	87.4	Confident	69 Å²	69	76.1 Å²	76.1	71%	0.711	44%	0.44	S	S	*	.	H	α-helix	trans	-61	-22.2	176.4	0	0	0	0	0	114.1	L31 T32 W33	L31-G35 PolarHBondContact O-N 3.44Å; T32-G35 PolarHBondContact O-N 3.31Å; W33-G35 VanDerWaalsContact C-N 3.34Å; W33-G35 PolarHBondContact O-N 3.01Å
36	G	86.8	Confident	87.3	Confident	66 Å²	66	78.1 Å²	78.1	68%	0.68	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.2	-7.6	174.4	0	0	0	0	0	114.9	W33 I34	W33-G36 PolarHBondContact O-N 2.81Å; I34-G36 PolarHBondContact O-N 2.98Å; I34-G36 VanDerWaalsContact O-N 3.17Å
37	Q	85.9	Confident	87.2	Confident	68 Å²	68	76.5 Å²	76.5	32%	0.318	43%	0.434	S	S	.	.	S	Bend	trans	-87.2	150	178.2	-65.2	-57.7	-46.8	0	0	110.9	I34 F43	I34-Q37 PolarHBondContact O-N 3.28Å; Q37-F43 HydrophobicContact CB-CB 4.49Å; Q37-F43 HydrophobicContact CB-CD1 4.35Å; Q37-F43 HydrophobicContact CB-CD2 4.32Å; Q37-F43 HydrophobicContact CB-CG 4.14Å; Q37-F43 HydrophobicContact CG-CD1 4.25Å; Q37-F43 HydrophobicContact CG-CE1 4.3Å
38	P	83.7	Confident	87.1	Confident	84 Å²	84	82.1 Å²	82.1	55%	0.545	46%	0.46	S	S	.	.			trans	-61	145.3	172	26.7	-33.7	0	0	0	110.4	S40	P38-S40 PolarHBondContact O-N 3.36Å
39	V	80.1	Confident	87.2	Confident	135 Å²	135	82.4 Å²	82.4	82%	0.818	47%	0.465	S	S	*	.	S	Bend	trans	-75.6	71.3	178.7	-169	0	0	0	0	109.6
40	S	82.2	Confident	87.1	Confident	53 Å²	53	76.7 Å²	76.7	37%	0.371	44%	0.436	S	S	.	.			trans	-120.5	155.1	174.2	58.8	0	0	0	0	110.5	P38 F43 T44	P38-S40 PolarHBondContact O-N 3.36Å; S40-F43 PolarHBondContact O-N 3.32Å; S40-T44 PolarHBondContact O-N 3.49Å
41	Y	81.9	Confident	87.2	Confident	193 Å²	193	75.6 Å²	75.6	76%	0.757	44%	0.435	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.7	128.3	167.3	-175.8	-90.8	0	0	0	108.4	I45	Y41-I45 HydrophobicContact CD2-CD1 4.08Å; Y41-I45 HydrophobicContact CE2-CD1 3.56Å
42	P	81.2	Confident	87.4	Confident	60 Å²	60	80.2 Å²	80.2	39%	0.39	46%	0.456	S	S	.	.	T	Hydrogen-bonded Turn	cis	-101.9	-0.8	15.1	37.9	-35.3	0	0	0	116	T44 I45 I46	P42-T44 VanDerWaalsContact C-N 3.27Å; P42-T44 PolarHBondContact O-N 2.9Å; P42-I45 PolarHBondContact O-N 3.49Å; P42-I45 VanDerWaalsContact O-N 3.15Å; P42-I46 PolarHBondContact O-N 3.06Å
43	F	86.1	Confident	87.4	Confident	51 Å²	51	79.1 Å²	79.1	22%	0.224	45%	0.446	C	S	.	.	H	α-helix	trans	-63	-29.9	-171.6	-59.8	-67.4	0	0	0	113.6	W33 Q37 S40 I45 I46 G47	W33-F43 HydrophobicContact CH2-CE1 4.49Å; Q37-F43 HydrophobicContact CB-CB 4.49Å; Q37-F43 HydrophobicContact CB-CD1 4.35Å; Q37-F43 HydrophobicContact CB-CD2 4.32Å; Q37-F43 HydrophobicContact CB-CG 4.14Å; Q37-F43 HydrophobicContact CG-CD1 4.25Å; Q37-F43 HydrophobicContact CG-CE1 4.3Å; S40-F43 PolarHBondContact O-N 3.32Å; F43-I45 VanDerWaalsContact C-N 3.35Å; F43-I45 PolarHBondContact O-N 3.44Å; F43-I46 PolarHBondContact O-N 3.24Å; F43-G47 PolarHBondContact O-N 2.87Å
44	T	86.5	Confident	87.5	Confident	58 Å²	58	75.4 Å²	75.4	36%	0.356	43%	0.433	S	S	.	.	H	α-helix	trans	-59.8	-42.2	175	-49.6	0	0	0	0	112.6	S40 P42 G47 Q48	S40-T44 PolarHBondContact O-N 3.49Å; P42-T44 VanDerWaalsContact C-N 3.27Å; P42-T44 PolarHBondContact O-N 2.9Å; T44-G47 PolarHBondContact O-N 3.4Å; T44-Q48 WeakPolarHBondContact O-CG 3.48Å; T44-Q48 PolarHBondContact O-N 3.36Å; T44-Q48 VanDerWaalsContact O-N 3.08Å
45	I	90.1	Very high	87.3	Confident	82 Å²	82	80.5 Å²	80.5	42%	0.421	45%	0.454	S	S	.	.	H	α-helix	trans	-70.3	-41.9	-179.6	-64.5	179.8	0	0	0	109.9	Y41 P42 F43 G47 Q48 V49	Y41-I45 HydrophobicContact CD2-CD1 4.08Å; Y41-I45 HydrophobicContact CE2-CD1 3.56Å; P42-I45 PolarHBondContact O-N 3.49Å; P42-I45 VanDerWaalsContact O-N 3.15Å; F43-I45 VanDerWaalsContact C-N 3.35Å; F43-I45 PolarHBondContact O-N 3.44Å; I45-G47 VanDerWaalsContact C-N 3.31Å; I45-G47 PolarHBondContact O-N 3.33Å; I45-Q48 PolarHBondContact O-N 3.48Å; I45-V49 HydrophobicContact CG2-CG2 4.35Å; I45-V49 WeakPolarHBondContact O-CG2 3.44Å; I45-V49 PolarHBondContact O-N 3.19Å
46	I	88.5	Confident	87.4	Confident	71 Å²	71	79.5 Å²	79.5	36%	0.364	43%	0.434	S	S	.	.	H	α-helix	trans	-62.6	-41.8	178.5	-53	173.6	0	0	0	110.1	I34 P42 F43 Q48 V49 A50	I34-I46 HydrophobicContact CD1-CB 3.91Å; I34-I46 HydrophobicContact CD1-CG2 3.39Å; I34-I46 HydrophobicContact CG1-CG2 4.48Å; P42-I46 PolarHBondContact O-N 3.06Å; F43-I46 PolarHBondContact O-N 3.24Å; I46-Q48 PolarHBondContact O-N 3.02Å; I46-V49 PolarHBondContact O-N 3.41Å; I46-A50 VanDerWaalsContact O-CB 3.23Å; I46-A50 WeakPolarHBondContact O-CB 3.42Å; I46-A50 PolarHBondContact O-N 2.94Å
47	G	89.4	Confident	87.4	Confident	13 Å²	13	76.5 Å²	76.5	13%	0.134	40%	0.403	C	S	.	.	H	α-helix	trans	-63.3	-38.5	175.8	0	0	0	0	0	113.3	F43 T44 I45 S51	F43-G47 PolarHBondContact O-N 2.87Å; T44-G47 PolarHBondContact O-N 3.4Å; I45-G47 VanDerWaalsContact C-N 3.31Å; I45-G47 PolarHBondContact O-N 3.33Å; G47-S51 WeakPolarHBondContact O-CB 3.28Å; G47-S51 PolarHBondContact O-N 2.85Å; G47-S51 PolarHBondContact O-OG 2.87Å
48	Q	88.9	Confident	87.3	Confident	127 Å²	127	75.2 Å²	75.2	59%	0.593	40%	0.398	S	S	*	.	H	α-helix	trans	-66.1	-46.5	175.7	-75.3	175.9	-7	0	0	112	T44 I45 I46 S51 M52	T44-Q48 WeakPolarHBondContact O-CG 3.48Å; T44-Q48 PolarHBondContact O-N 3.36Å; T44-Q48 VanDerWaalsContact O-N 3.08Å; I45-Q48 PolarHBondContact O-N 3.48Å; I46-Q48 PolarHBondContact O-N 3.02Å; Q48-S51 PolarHBondContact O-N 3.27Å; Q48-M52 WeakPolarHBondContact O-CB 3.29Å; Q48-M52 PolarHBondContact O-N 3.4Å
49	V	92.6	Very high	87.3	Confident	80 Å²	80	76 Å²	76	49%	0.485	40%	0.397	S	S	.	.	H	α-helix	trans	-64.6	-43.5	177.8	173.8	0	0	0	0	111	I45 I46 M52 L53	I45-V49 HydrophobicContact CG2-CG2 4.35Å; I45-V49 WeakPolarHBondContact O-CG2 3.44Å; I45-V49 PolarHBondContact O-N 3.19Å; I46-V49 PolarHBondContact O-N 3.41Å; V49-M52 PolarHBondContact O-N 3.43Å; V49-L53 HydrophobicContact CG1-CD1 4.05Å; V49-L53 WeakPolarHBondContact O-CB 3.47Å; V49-L53 WeakPolarHBondContact O-CG 3.47Å; V49-L53 PolarHBondContact O-N 3.21Å
50	A	90.2	Very high	87.5	Confident	5 Å²	5	74.2 Å²	74.2	4%	0.041	38%	0.382	C	S	.	.	H	α-helix	trans	-62.3	-44	176.7	0	0	0	0	0	111.4	I30 L31 I46 M52 L53 Y54	I30-A50 HydrophobicContact CG2-CB 4.34Å; L31-A50 HydrophobicContact CD2-CB 3.89Å; L31-A50 HydrophobicContact CG-CB 3.99Å; I46-A50 VanDerWaalsContact O-CB 3.23Å; I46-A50 WeakPolarHBondContact O-CB 3.42Å; I46-A50 PolarHBondContact O-N 2.94Å; A50-M52 VanDerWaalsContact C-N 3.33Å; A50-M52 PolarHBondContact O-N 3.44Å; A50-L53 WeakPolarHBondContact O-CB 3.34Å; A50-L53 PolarHBondContact O-N 3.47Å; A50-Y54 WeakPolarHBondContact O-CB 3.48Å; A50-Y54 PolarHBondContact O-N 3.15Å
51	S	90.8	Very high	87.5	Confident	50 Å²	50	74.3 Å²	74.3	35%	0.35	38%	0.378	S	S	.	.	H	α-helix	trans	-62.3	-40.4	175.9	-58.7	0	0	0	0	112.1	G47 Q48 Y54 F55	G47-S51 WeakPolarHBondContact O-CB 3.28Å; G47-S51 PolarHBondContact O-N 2.85Å; G47-S51 PolarHBondContact O-OG 2.87Å; Q48-S51 PolarHBondContact O-N 3.27Å; S51-Y54 WeakPolarHBondContact O-CB 3.4Å; S51-Y54 PolarHBondContact O-N 3.2Å; S51-F55 VanDerWaalsContact O-CD2 3.27Å; S51-F55 WeakPolarHBondContact O-CD2 3.33Å; S51-F55 PolarHBondContact O-N 2.82Å
52	M	93.4	Very high	87.5	Confident	139 Å²	139	68.3 Å²	68.3	69%	0.685	36%	0.357	S	S	*	.	H	α-helix	trans	-64.7	-41.4	175.6	-171	178.2	-174.5	0	0	111.6	Q48 V49 A50 T56	Q48-M52 WeakPolarHBondContact O-CB 3.29Å; Q48-M52 PolarHBondContact O-N 3.4Å; V49-M52 PolarHBondContact O-N 3.43Å; A50-M52 VanDerWaalsContact C-N 3.33Å; A50-M52 PolarHBondContact O-N 3.44Å; M52-T56 VanDerWaalsContact O-CB 3.28Å; M52-T56 WeakPolarHBondContact O-CB 3.38Å; M52-T56 PolarHBondContact O-N 3.38Å; M52-T56 PolarHBondContact O-OG1 3.31Å
53	L	90	Very high	87.3	Confident	86 Å²	86	67.6 Å²	67.6	45%	0.45	35%	0.353	S	S	.	.	H	α-helix	trans	-63.5	-42.4	175.1	-82.7	169	0	0	0	111.8	V49 A50 T56 T57	V49-L53 HydrophobicContact CG1-CD1 4.05Å; V49-L53 WeakPolarHBondContact O-CB 3.47Å; V49-L53 WeakPolarHBondContact O-CG 3.47Å; V49-L53 PolarHBondContact O-N 3.21Å; A50-L53 WeakPolarHBondContact O-CB 3.34Å; A50-L53 PolarHBondContact O-N 3.47Å; L53-T56 PolarHBondContact O-N 3.37Å; L53-T57 VanDerWaalsContact O-CB 3.26Å; L53-T57 WeakPolarHBondContact O-CB 3.43Å; L53-T57 PolarHBondContact O-N 2.83Å; L53-T57 PolarHBondContact O-OG1 2.72Å
54	Y	89.9	Confident	87.1	Confident	72 Å²	72	68.2 Å²	68.2	28%	0.282	36%	0.361	S	S	.	.	H	α-helix	trans	-54.5	-55.6	176.4	-177.3	-103.6	0	0	0	111.9	L24 D27 L28 L31 A50 S51 T56 T57 I58	L24-Y54 HydrophobicContact CD1-CD2 3.74Å; L24-Y54 HydrophobicContact CD1-CE2 3.77Å; D27-Y54 WeakPolarHBondContact OD2-CA 3.37Å; D27-Y54 WeakPolarHBondContact OD2-CB 3.15Å; D27-Y54 PolarHBondContact OD2-N 2.9Å; L28-Y54 HydrophobicContact CD2-CD2 4.1Å; L28-Y54 HydrophobicContact CD2-CE2 3.54Å; L28-Y54 HydrophobicContact CG-CD2 4.44Å; L28-Y54 HydrophobicContact CG-CE2 3.99Å; L31-Y54 HydrophobicContact CD1-CD2 4.26Å; L31-Y54 HydrophobicContact CD1-CG 4.28Å; A50-Y54 WeakPolarHBondContact O-CB 3.48Å; A50-Y54 PolarHBondContact O-N 3.15Å; S51-Y54 WeakPolarHBondContact O-CB 3.4Å; S51-Y54 PolarHBondContact O-N 3.2Å; Y54-T56 PolarHBondContact O-N 3.48Å; Y54-T57 PolarHBondContact O-N 2.9Å; Y54-I58 HydrophobicContact CD1-CD1 4.3Å; Y54-I58 HydrophobicContact CD2-CD1 4.32Å; Y54-I58 HydrophobicContact CE1-CD1 3.67Å; Y54-I58 HydrophobicContact CE2-CD1 3.68Å; Y54-I58 PolarHBondContact O-N 3.29Å; Y54-I58 VanDerWaalsContact O-N 3.15Å; Y54-I58 WeakPolarHBondContact OH-CD1 3.23Å
55	F	88.5	Confident	86.9	Confident	129 Å²	129	66.9 Å²	66.9	57%	0.566	35%	0.351	S	S	*	.	H	α-helix	trans	-65.2	-41.2	-179.4	-79.9	-71.2	0	0	0	112.3	S51 T57 I58 L59	S51-F55 VanDerWaalsContact O-CD2 3.27Å; S51-F55 WeakPolarHBondContact O-CD2 3.33Å; S51-F55 PolarHBondContact O-N 2.82Å; F55-T57 VanDerWaalsContact C-N 3.3Å; F55-T57 PolarHBondContact O-N 2.93Å; F55-I58 PolarHBondContact O-N 3.34Å; F55-L59 HydrophobicContact CD1-CD1 4.41Å; F55-L59 VanDerWaalsContact O-CB 3.29Å; F55-L59 WeakPolarHBondContact O-CB 3.44Å; F55-L59 PolarHBondContact O-N 3.08Å
56	T	89.7	Confident	86.2	Confident	47 Å²	47	63.7 Å²	63.7	29%	0.288	34%	0.336	S	S	.	.	H	α-helix	trans	-62.8	-39.7	177.8	-58	0	0	0	0	111.1	M52 L53 Y54 I60 L61	M52-T56 VanDerWaalsContact O-CB 3.28Å; M52-T56 WeakPolarHBondContact O-CB 3.38Å; M52-T56 PolarHBondContact O-N 3.38Å; M52-T56 PolarHBondContact O-OG1 3.31Å; L53-T56 PolarHBondContact O-N 3.37Å; Y54-T56 PolarHBondContact O-N 3.48Å; T56-I60 HydrophobicContact CG2-CB 4.48Å; T56-I60 HydrophobicContact CG2-CD1 4.28Å; T56-I60 WeakPolarHBondContact O-CA 3.26Å; T56-I60 WeakPolarHBondContact O-CB 3.5Å; T56-I60 PolarHBondContact O-N 2.98Å; T56-L61 HydrophobicContact CG2-CD1 3.83Å; T56-L61 PolarHBondContact O-N 2.78Å; T56-L61 VanDerWaalsContact O-N 3.08Å
57	T	85.9	Confident	85.6	Confident	3 Å²	3	65.3 Å²	65.3	2%	0.018	35%	0.345	C	S	.	.	I	π-helix	trans	-65.6	-46.4	-179.3	-60.2	0	0	0	0	111.4	L20 L23 L24 L53 Y54 F55 L61 M62	L20-T57 HydrophobicContact CD2-CG2 4.18Å; L23-T57 HydrophobicContact CD2-CG2 4.22Å; L24-T57 HydrophobicContact CB-CG2 4.39Å; L24-T57 HydrophobicContact CD1-CG2 4.11Å; L53-T57 VanDerWaalsContact O-CB 3.26Å; L53-T57 WeakPolarHBondContact O-CB 3.43Å; L53-T57 PolarHBondContact O-N 2.83Å; L53-T57 PolarHBondContact O-OG1 2.72Å; Y54-T57 PolarHBondContact O-N 2.9Å; F55-T57 VanDerWaalsContact C-N 3.3Å; F55-T57 PolarHBondContact O-N 2.93Å; T57-L61 PolarHBondContact O-N 3.41Å; T57-M62 PolarHBondContact O-N 2.99Å
58	I	83.9	Confident	85.2	Confident	41 Å²	41	69 Å²	69	21%	0.21	36%	0.361	C	S	.	.	I	π-helix	trans	-73.3	-46.3	-179.1	-65.2	178.7	0	0	0	112	L3 L24 Y54 F55	L3-I58 HydrophobicContact CD1-CG2 4.43Å; L24-I58 HydrophobicContact CD1-CD1 4.02Å; L24-I58 HydrophobicContact CD1-CG1 3.74Å; L24-I58 HydrophobicContact CD2-CD1 4.47Å; L24-I58 HydrophobicContact CD2-CG1 4.31Å; Y54-I58 HydrophobicContact CD1-CD1 4.3Å; Y54-I58 HydrophobicContact CD2-CD1 4.32Å; Y54-I58 HydrophobicContact CE1-CD1 3.67Å; Y54-I58 HydrophobicContact CE2-CD1 3.68Å; Y54-I58 PolarHBondContact O-N 3.29Å; Y54-I58 VanDerWaalsContact O-N 3.15Å; Y54-I58 WeakPolarHBondContact OH-CD1 3.23Å; F55-I58 PolarHBondContact O-N 3.34Å
59	L	83.2	Confident	84.5	Confident	102 Å²	102	63.1 Å²	63.1	53%	0.534	33%	0.333	S	S	.	.	I	π-helix	trans	-81.7	-34.2	-172.6	-68.5	173.8	0	0	0	113.2	L3 F55 P63	L3-L59 HydrophobicContact CD1-CD2 4.47Å; F55-L59 HydrophobicContact CD1-CD1 4.41Å; F55-L59 VanDerWaalsContact O-CB 3.29Å; F55-L59 WeakPolarHBondContact O-CB 3.44Å; F55-L59 PolarHBondContact O-N 3.08Å; L59-P63 WeakPolarHBondContact O-CG 3.22Å
60	I	84.5	Confident	83.6	Confident	97 Å²	97	60.9 Å²	60.9	50%	0.497	32%	0.319	S	S	.	.	I	π-helix	trans	-112.6	-51.2	-171	-58.8	171.8	0	0	0	111.3	T56 P63 T64	T56-I60 HydrophobicContact CG2-CB 4.48Å; T56-I60 HydrophobicContact CG2-CD1 4.28Å; T56-I60 WeakPolarHBondContact O-CA 3.26Å; T56-I60 WeakPolarHBondContact O-CB 3.5Å; T56-I60 PolarHBondContact O-N 2.98Å; I60-P63 VanDerWaalsContact O-CD 3.29Å; I60-P63 WeakPolarHBondContact O-CD 3.47Å; I60-P63 WeakPolarHBondContact O-CG 3.37Å; I60-T64 HydrophobicContact CG2-CG2 4.37Å; I60-T64 WeakPolarHBondContact O-CB 3.49Å; I60-T64 WeakPolarHBondContact O-CG2 3.44Å; I60-T64 PolarHBondContact O-N 3.22Å; I60-T64 PolarHBondContact O-OG1 3.41Å
61	L	81.9	Confident	82.8	Confident	55 Å²	55	68 Å²	68	29%	0.288	35%	0.349	S	S	.	.	I	π-helix	trans	-70.7	-41.2	-174.4	-83.2	69.7	0	0	0	112.5	L20 T56 T57 T64 I65	L20-L61 HydrophobicContact CD1-CB 4.13Å; L20-L61 HydrophobicContact CD2-CB 3.76Å; L20-L61 HydrophobicContact CD2-CD2 3.56Å; L20-L61 HydrophobicContact CD2-CG 4.25Å; T56-L61 HydrophobicContact CG2-CD1 3.83Å; T56-L61 PolarHBondContact O-N 2.78Å; T56-L61 VanDerWaalsContact O-N 3.08Å; T57-L61 PolarHBondContact O-N 3.41Å; L61-T64 VanDerWaalsContact CA-OG1 3.31Å; L61-T64 WeakPolarHBondContact CA-OG1 3.35Å; L61-T64 PolarHBondContact O-N 2.94Å; L61-T64 PolarHBondContact O-OG1 2.92Å; L61-I65 WeakPolarHBondContact O-CB 3.35Å; L61-I65 WeakPolarHBondContact O-CG1 3.45Å; L61-I65 PolarHBondContact O-N 3.32Å
62	M	82	Confident	81.9	Confident	67 Å²	67	71.9 Å²	71.9	33%	0.33	36%	0.363	S	S	.	.	H	α-helix	trans	-55.8	-51.4	177.1	-86.9	-163.6	173.9	0	0	114.1	L24 T57 S66	L24-M62 HydrophobicContact CD2-CE 4.25Å; T57-M62 PolarHBondContact O-N 2.99Å; M62-S66 WeakPolarHBondContact O-CB 3.44Å; M62-S66 PolarHBondContact O-N 3.36Å; M62-S66 VanDerWaalsContact O-N 3.16Å; M62-S66 PolarHBondContact O-OG 3.47Å
63	P	77.4	Confident	80.9	Confident	45 Å²	45	69.2 Å²	69.2	29%	0.292	35%	0.351	S	S	.	.	H	α-helix	trans	-70.4	-36.3	178.9	24.3	-32.3	0	0	0	112.8	L59 I60 S66 L67	L59-P63 WeakPolarHBondContact O-CG 3.22Å; I60-P63 VanDerWaalsContact O-CD 3.29Å; I60-P63 WeakPolarHBondContact O-CD 3.47Å; I60-P63 WeakPolarHBondContact O-CG 3.37Å; P63-S66 PolarHBondContact O-N 2.89Å; P63-L67 PolarHBondContact O-N 3.24Å
64	T	81.7	Confident	79.4	Confident	63 Å²	63	74 Å²	74	39%	0.387	37%	0.368	S	S	.	.	H	α-helix	trans	-68.1	-47.3	-179.1	51.8	0	0	0	0	112.2	I60 L61 S66 L67 I68	I60-T64 HydrophobicContact CG2-CG2 4.37Å; I60-T64 WeakPolarHBondContact O-CB 3.49Å; I60-T64 WeakPolarHBondContact O-CG2 3.44Å; I60-T64 PolarHBondContact O-N 3.22Å; I60-T64 PolarHBondContact O-OG1 3.41Å; L61-T64 VanDerWaalsContact CA-OG1 3.31Å; L61-T64 WeakPolarHBondContact CA-OG1 3.35Å; L61-T64 PolarHBondContact O-N 2.94Å; L61-T64 PolarHBondContact O-OG1 2.92Å; T64-S66 PolarHBondContact O-N 3.5Å; T64-L67 WeakPolarHBondContact O-CB 3.45Å; T64-L67 PolarHBondContact O-N 2.97Å; T64-L67 VanDerWaalsContact O-N 3.14Å; T64-I68 VanDerWaalsContact O-CG1 3.28Å; T64-I68 WeakPolarHBondContact O-CG1 3.27Å; T64-I68 PolarHBondContact O-N 3.21Å
65	I	81.8	Confident	77.9	Confident	31 Å²	31	77.3 Å²	77.3	16%	0.159	38%	0.38	C	S	.	.	H	α-helix	trans	-63.7	-32.5	174.5	-66	-145.4	0	0	0	110.8	L16 L20 L61 I68 E69	L16-I65 HydrophobicContact CB-CD1 4.37Å; L16-I65 HydrophobicContact CB-CG2 3.59Å; L20-I65 HydrophobicContact CD1-CB 3.57Å; L20-I65 HydrophobicContact CD1-CD1 3.38Å; L20-I65 HydrophobicContact CD1-CG1 3.5Å; L20-I65 HydrophobicContact CD1-CG2 3.95Å; L20-I65 HydrophobicContact CD2-CD1 4.35Å; L20-I65 HydrophobicContact CG-CD1 3.77Å; L20-I65 HydrophobicContact CG-CG1 4.42Å; L61-I65 WeakPolarHBondContact O-CB 3.35Å; L61-I65 WeakPolarHBondContact O-CG1 3.45Å; L61-I65 PolarHBondContact O-N 3.32Å; I65-I68 PolarHBondContact O-N 3.5Å; I65-E69 HydrophobicContact CG2-CG 4.33Å; I65-E69 WeakPolarHBondContact O-CB 3.27Å; I65-E69 PolarHBondContact O-N 2.97Å
66	S	75	Confident	75.8	Confident	15 Å²	15	78.2 Å²	78.2	11%	0.105	41%	0.411	C	S	.	.	H	α-helix	trans	-65.6	-38.5	171.9	-55.5	0	0	0	0	115.1	R14 M62 P63 T64 N70	R14-S66 PolarHBondContact NH1-OG 3.24Å; R14-S66 VanDerWaalsContact NH2-CB 3.31Å; R14-S66 PolarHBondContact NH2-OG 2.88Å; M62-S66 WeakPolarHBondContact O-CB 3.44Å; M62-S66 PolarHBondContact O-N 3.36Å; M62-S66 VanDerWaalsContact O-N 3.16Å; M62-S66 PolarHBondContact O-OG 3.47Å; P63-S66 PolarHBondContact O-N 2.89Å; T64-S66 PolarHBondContact O-N 3.5Å; S66-N70 WeakPolarHBondContact O-CB 3.32Å; S66-N70 PolarHBondContact O-N 2.93Å; S66-N70 VanDerWaalsContact O-N 3.14Å; S66-N70 PolarHBondContact O-ND2 3.48Å; S66-N70 VanDerWaalsContact O-ND2 3.16Å
67	L	77.4	Confident	75.1	Confident	105 Å²	105	79.8 Å²	79.8	55%	0.55	42%	0.417	S	S	.	.	H	α-helix	trans	-66.5	-41.8	172.2	-163.6	95.2	0	0	0	111.7	P63 T64 N70 K71	P63-L67 PolarHBondContact O-N 3.24Å; T64-L67 WeakPolarHBondContact O-CB 3.45Å; T64-L67 PolarHBondContact O-N 2.97Å; T64-L67 VanDerWaalsContact O-N 3.14Å; L67-N70 PolarHBondContact O-N 3.47Å; L67-K71 HydrophobicContact CD2-CD 4.45Å; L67-K71 WeakPolarHBondContact O-CG 3.46Å; L67-K71 PolarHBondContact O-N 3.17Å
68	I	80.6	Confident	74.5	Confident	90 Å²	90	83.8 Å²	83.8	46%	0.462	44%	0.438	S	S	.	.	H	α-helix	trans	-64.7	-49.4	-178.6	-68.3	164	0	0	0	110.6	T64 I65 N70 K71 M72	T64-I68 VanDerWaalsContact O-CG1 3.28Å; T64-I68 WeakPolarHBondContact O-CG1 3.27Å; T64-I68 PolarHBondContact O-N 3.21Å; I65-I68 PolarHBondContact O-N 3.5Å; I68-N70 PolarHBondContact O-N 3.48Å; I68-K71 PolarHBondContact O-N 3.28Å; I68-M72 WeakPolarHBondContact O-CB 3.48Å; I68-M72 PolarHBondContact O-N 2.93Å
69	E	74.4	Confident	74	Confident	3 Å²	3	86.2 Å²	86.2	1%	0.014	45%	0.451	C	S	.	.	H	α-helix	trans	-64.1	-38.9	178.6	-77.1	179.5	134.8	0	0	112	R14 L16 S17 I65 K71 M72 L73	R14-E69 WeakPolarHBondContact CA-OE1 3.49Å; R14-E69 WeakPolarHBondContact CB-OE1 3.49Å; R14-E69 WeakPolarHBondContact CB-OE2 3.39Å; R14-E69 IonicContact CZ-OE2 3.12Å; R14-E69 IonicContact NE-OE2 2.71Å; R14-E69 PolarHBondContact NE-OE2 2.92Å; R14-E69 IonicContact NH2-OE2 2.7Å; R14-E69 PolarHBondContact NH2-OE2 2.78Å; L16-E69 WeakPolarHBondContact CA-OE1 3.47Å; L16-E69 HydrophobicContact CB-CG 4.14Å; L16-E69 VanDerWaalsContact CB-OE1 3.31Å; L16-E69 WeakPolarHBondContact CB-OE1 3.37Å; L16-E69 HydrophobicContact CD1-CG 3.96Å; L16-E69 HydrophobicContact CG-CG 4.46Å; L16-E69 PolarHBondContact N-OE1 3.33Å; S17-E69 PolarHBondContact N-OE1 3.11Å; S17-E69 PolarHBondContact OG-OE2 3.01Å; I65-E69 HydrophobicContact CG2-CG 4.33Å; I65-E69 WeakPolarHBondContact O-CB 3.27Å; I65-E69 PolarHBondContact O-N 2.97Å; E69-K71 PolarHBondContact O-N 3.49Å; E69-M72 PolarHBondContact O-N 3.41Å; E69-L73 WeakPolarHBondContact O-CB 3.4Å; E69-L73 WeakPolarHBondContact O-CG 3.4Å; E69-L73 PolarHBondContact O-N 2.91Å
70	N	73	Confident	73.5	Confident	34 Å²	34	85.2 Å²	85.2	18%	0.182	45%	0.446	C	S	.	.	H	α-helix	trans	-60.1	-44.4	174.1	-73.5	-16	0	0	0	111.9	S66 L67 I68 K74 W75	S66-N70 WeakPolarHBondContact O-CB 3.32Å; S66-N70 PolarHBondContact O-N 2.93Å; S66-N70 VanDerWaalsContact O-N 3.14Å; S66-N70 PolarHBondContact O-ND2 3.48Å; S66-N70 VanDerWaalsContact O-ND2 3.16Å; L67-N70 PolarHBondContact O-N 3.47Å; I68-N70 PolarHBondContact O-N 3.48Å; N70-K74 PolarHBondContact O-N 2.95Å; N70-W75 PolarHBondContact O-N 2.74Å
71	K	73.8	Confident	72.8	Confident	154 Å²	154	84.5 Å²	84.5	67%	0.67	44%	0.443	S	S	*	.	H	α-helix	trans	-64.5	-40.4	175.8	-76.3	177.4	178.3	-72.8	0	112	L67 I68 E69 K74	L67-K71 HydrophobicContact CD2-CD 4.45Å; L67-K71 WeakPolarHBondContact O-CG 3.46Å; L67-K71 PolarHBondContact O-N 3.17Å; I68-K71 PolarHBondContact O-N 3.28Å; E69-K71 PolarHBondContact O-N 3.49Å; K71-K74 PolarHBondContact O-N 3.44Å
72	M	71.8	Confident	72.2	Confident	131 Å²	131	86.5 Å²	86.5	65%	0.645	45%	0.453	S	S	*	.	H	α-helix	trans	-68.4	-35.5	-178.4	-145.3	175.7	75.2	0	0	112.1	I68 E69 K74	I68-M72 WeakPolarHBondContact O-CB 3.48Å; I68-M72 PolarHBondContact O-N 2.93Å; E69-M72 PolarHBondContact O-N 3.41Å; M72-K74 PolarHBondContact O-N 3.46Å
73	L	71.7	Confident	71.5	Confident	84 Å²	84	87.9 Å²	87.9	44%	0.44	46%	0.462	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.8	7	176.8	-67.1	171.1	0	0	0	113.7	E69 W75	E69-L73 WeakPolarHBondContact O-CB 3.4Å; E69-L73 WeakPolarHBondContact O-CG 3.4Å; E69-L73 PolarHBondContact O-N 2.91Å; L73-W75 PolarHBondContact O-N 3.27Å; L73-W75 VanDerWaalsContact O-N 3.09Å
74	K	59.4	Low	71	Confident	187 Å²	187	91.2 Å²	91.2	81%	0.813	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.2	29.8	178.8	-67.1	-174.7	178.7	179.6	0	114.5	N70 K71 M72 A76	N70-K74 PolarHBondContact O-N 2.95Å; K71-K74 PolarHBondContact O-N 3.44Å; M72-K74 PolarHBondContact O-N 3.46Å; K74-A76 PolarHBondContact O-N 3.4Å
75	W	57.7	Low	70.1	Confident	140 Å²	140	93.5 Å²	93.5	53%	0.53	48%	0.483	S	S	.	.			trans	-84.7	100.2	163.3	-81.3	-1.9	0	0	0	108	K7 Q8 N70 L73	K7-W75 HydrophobicContact CB-CE3 4.44Å; K7-W75 HydrophobicContact CB-CZ3 4.36Å; Q8-W75 HydrophobicContact CG-CH2 4.12Å; Q8-W75 HydrophobicContact CG-CZ3 3.86Å; N70-W75 PolarHBondContact O-N 2.74Å; L73-W75 PolarHBondContact O-N 3.27Å; L73-W75 VanDerWaalsContact O-N 3.09Å
76	A	44.8	Very low	69	Low	148 Å²	148	99.2 Å²	99.2	100%	1.223	51%	0.512	S	S	*	.			trans	-60.8	0	164.1	0	0	0	0	0	111.1	K7 K74	K7-A76 PolarHBondContact NZ-O 2.94Å; K74-A76 PolarHBondContact O-N 3.4Å

Retrieved 76 of 76 residues in 17.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).