X5J4N6_MOUSE Loading...

IgM heavy chain VDJ region

AlphaFold DB , UniProt , Accession X5J4N6, Species MOUSE (Mus musculus, Mouse), Gene n/a, Length 88 aa.

						>X5J4N6_MOUSE|X5J4N6
SGAELVRPGASVKLSCTASGFNIKDDYMHWVKQRPEQGLEWIGRIDPANGNTKYAPKFQDKATITADTSSNTAYLQLSSLTSEDTAVY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	65	Low	87.6	Confident	100 Å²	100	101.6 Å²	101.6	70%	0.699	64%	0.64	S	S	*	*				0	163.6	0	-77.2	0	0	0	0	112.9	S15	S1-S15 PolarHBondContact N-O 3.39Å; S1-S15 VanDerWaalsContact N-O 3.08Å; S1-S15 PolarHBondContact OG-N 2.74Å; S1-S15 PolarHBondContact OG-O 3.14Å; S1-S15 PolarHBondContact OG-OG 3.13Å
2	G	79.5	Confident	88.2	Confident	67 Å²	67	94.5 Å²	94.5	69%	0.691	59%	0.594	S	S	*	*			trans	-107.6	-177.7	167.3	0	0	0	0	0	111.8
3	A	85.9	Confident	88.8	Confident	118 Å²	118	96.1 Å²	96.1	98%	0.975	59%	0.587	S	S	*	*			trans	-72.8	134.7	176.4	0	0	0	0	0	111.2
4	E	87.7	Confident	89.4	Confident	124 Å²	124	90.6 Å²	90.6	58%	0.579	55%	0.553	S	S	*	*			trans	-130.8	129.3	-179.8	-162.7	177.7	155.8	0	0	110.3	V6 V12	E4-V6 HydrophobicContact CG-CG1 3.85Å; E4-V6 WeakPolarHBondContact OE1-CG1 3.41Å; E4-V12 VanDerWaalsContact OE2-CG2 3.25Å; E4-V12 WeakPolarHBondContact OE2-CG2 3.46Å
5	L	90.4	Very high	89.9	Confident	176 Å²	176	87.5 Å²	87.5	92%	0.921	54%	0.536	S	S	*	.			trans	-103.9	117.6	173.9	-178.7	66.3	0	0	0	108.9
6	V	90.6	Very high	90.3	Very high	52 Å²	52	85.2 Å²	85.2	32%	0.315	52%	0.524	S	S	.	.			trans	-122.6	156.4	-175.5	-61.2	0	0	0	0	111.5	E4 A10 L80	E4-V6 HydrophobicContact CG-CG1 3.85Å; E4-V6 WeakPolarHBondContact OE1-CG1 3.41Å; V6-A10 HydrophobicContact CB-CB 4.34Å; V6-L80 HydrophobicContact CG2-CD1 3.47Å; V6-L80 VanDerWaalsContact CG2-CD1 3.47Å
7	R	90.7	Very high	90.7	Very high	211 Å²	211	85.5 Å²	85.5	80%	0.796	53%	0.526	S	S	*	.			trans	-76.4	150.1	176.6	-63.9	-179.1	-177.6	178.6	0.6	110.6	A10	R7-A10 WeakPolarHBondContact O-CB 3.33Å; R7-A10 PolarHBondContact O-N 3.01Å; R7-A10 VanDerWaalsContact O-N 3.13Å
8	P	91.4	Very high	90.9	Very high	117 Å²	117	81.3 Å²	81.3	76%	0.76	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.1	142.2	169.8	-24.8	34.3	0	0	0	111.9	A10	P8-A10 PolarHBondContact O-N 3.49Å
9	G	92.6	Very high	91.2	Very high	56 Å²	56	82.6 Å²	82.6	58%	0.577	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.2	-10.7	-175.6	0	0	0	0	0	114.9	L80	G9-L80 PolarHBondContact N-O 3.31Å
10	A	94.6	Very high	91.4	Very high	34 Å²	34	83.1 Å²	83.1	28%	0.281	54%	0.536	S	S	.	.			trans	-70.1	170.6	174.9	0	0	0	0	0	111.9	V6 R7 P8 S79 L80	V6-A10 HydrophobicContact CB-CB 4.34Å; R7-A10 WeakPolarHBondContact O-CB 3.33Å; R7-A10 PolarHBondContact O-N 3.01Å; R7-A10 VanDerWaalsContact O-N 3.13Å; P8-A10 PolarHBondContact O-N 3.49Å; A10-S79 PolarHBondContact O-N 2.89Å; A10-L80 WeakPolarHBondContact O-CB 3.43Å; A10-L80 WeakPolarHBondContact O-CG 3.32Å; A10-L80 PolarHBondContact O-N 2.82Å
11	S	95.1	Very high	91.5	Very high	63 Å²	63	83.7 Å²	83.7	44%	0.441	53%	0.53	S	S	.	.			trans	-115.2	147.8	169.9	-55.1	0	0	0	0	109.7	L77 S78	S11-L77 CarbonylContact C-O 3.59Å; S11-L77 WeakPolarHBondContact CA-O 3.49Å; S11-L77 WeakPolarHBondContact CB-O 3.44Å; S11-S78 WeakPolarHBondContact OG-CA 3.26Å
12	V	95.2	Very high	93	Very high	16 Å²	16	82.3 Å²	82.3	10%	0.097	52%	0.515	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	148.2	176	71.1	0	0	0	0	109.9	E4 L14 Q76 L77 L80	E4-V12 VanDerWaalsContact OE2-CG2 3.25Å; E4-V12 WeakPolarHBondContact OE2-CG2 3.46Å; V12-L14 HydrophobicContact CG2-CD2 4.16Å; V12-Q76 CarbonylContact O-C 3.4Å; V12-Q76 VanDerWaalsContact O-CA 3.3Å; V12-Q76 WeakPolarHBondContact O-CA 3.32Å; V12-L77 HydrophobicContact CG1-CB 4.11Å; V12-L77 HydrophobicContact CG1-CD1 4.49Å; V12-L77 PolarHBondContact N-O 3.02Å; V12-L77 PolarHBondContact O-N 2.79Å; V12-L80 HydrophobicContact CB-CD1 4Å; V12-L80 HydrophobicContact CG1-CD1 3.79Å
13	K	96.2	Very high	93.8	Very high	115 Å²	115	79.1 Å²	79.1	50%	0.5	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.9	111.5	174.1	-174.4	177.9	178.6	179.9	0	110.2	Y74 L75	K13-Y74 HydrophobicContact CD-CD1 4.48Å; K13-Y74 VanDerWaalsContact CE-CD1 3.42Å; K13-Y74 HydrophobicContact CG-CD1 4.48Å; K13-L75 CarbonylContact C-O 3.53Å; K13-L75 WeakPolarHBondContact CA-O 3.05Å
14	L	96.8	Very high	94.3	Very high	20 Å²	20	77.8 Å²	77.8	11%	0.105	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.5	150.7	175.5	-53.9	-180	0	0	0	110.4	V12 W30 Y74 L75 Y88	V12-L14 HydrophobicContact CG2-CD2 4.16Å; L14-W30 HydrophobicContact CB-CH2 3.91Å; L14-W30 HydrophobicContact CB-CZ3 3.85Å; L14-W30 HydrophobicContact CD1-CZ3 4.2Å; L14-Y74 WeakPolarHBondContact O-CA 3.5Å; L14-Y74 WeakPolarHBondContact O-CB 3.23Å; L14-L75 HydrophobicContact CB-CB 4.47Å; L14-L75 HydrophobicContact CD1-CD2 4.32Å; L14-L75 PolarHBondContact N-O 2.87Å; L14-L75 PolarHBondContact O-N 3.06Å; L14-L75 VanDerWaalsContact O-N 3.09Å; L14-Y88 HydrophobicContact CD1-CD1 4.27Å; L14-Y88 HydrophobicContact CD1-CD2 4.31Å; L14-Y88 HydrophobicContact CD1-CG 3.8Å
15	S	97.1	Very high	94.7	Very high	43 Å²	43	77.7 Å²	77.7	30%	0.301	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.6	140.5	176.8	64.9	0	0	0	0	111.9	S1 A73	S1-S15 PolarHBondContact N-O 3.39Å; S1-S15 VanDerWaalsContact N-O 3.08Å; S1-S15 PolarHBondContact OG-N 2.74Å; S1-S15 PolarHBondContact OG-O 3.14Å; S1-S15 PolarHBondContact OG-OG 3.13Å; S15-A73 WeakPolarHBondContact CA-O 3.27Å
16	C	95.7	Very high	94.9	Very high	51 Å²	51	73.4 Å²	73.4	35%	0.345	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.4	111.5	174.4	-178.5	0	0	0	0	108.9	W30 T72 A73	C16-W30 HydrophobicContact CB-CH2 4.08Å; C16-W30 HydrophobicContact CB-CZ2 4.24Å; C16-T72 CarbonylContact O-C 3.57Å; C16-T72 WeakPolarHBondContact O-CA 3.38Å; C16-A73 PolarHBondContact N-O 2.8Å; C16-A73 PolarHBondContact O-N 3.18Å
17	T	96.9	Very high	95.2	Very high	90 Å²	90	76.8 Å²	76.8	55%	0.552	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.9	119.1	178	-56.5	0	0	0	0	108.9	N71 T72	T17-N71 WeakPolarHBondContact CA-O 3.5Å; T17-T72 WeakPolarHBondContact CG2-OG1 3.3Å; T17-T72 PolarHBondContact OG1-OG1 3.08Å
18	A	95.2	Very high	95.6	Very high	11 Å²	11	68.1 Å²	68.1	9%	0.091	41%	0.413	C	S	.	.			trans	-74	144.5	176.6	0	0	0	0	0	110.6	F21 I23 N71	A18-F21 HydrophobicContact CB-CD2 4.42Å; A18-F21 HydrophobicContact CB-CE1 3.87Å; A18-F21 HydrophobicContact CB-CE2 3.78Å; A18-F21 HydrophobicContact CB-CZ 3.47Å; A18-F21 VanDerWaalsContact CB-CZ 3.47Å; A18-I23 HydrophobicContact CB-CB 4.2Å; A18-I23 HydrophobicContact CB-CD1 4.34Å; A18-I23 HydrophobicContact CB-CG1 4.29Å; A18-N71 WeakPolarHBondContact CB-ND2 3.3Å; A18-N71 PolarHBondContact N-O 2.85Å; A18-N71 PolarHBondContact O-ND2 3.22Å
19	S	96.3	Very high	95.9	Very high	105 Å²	105	67.3 Å²	67.3	73%	0.734	40%	0.398	S	S	*	.			trans	-136.2	141.3	175.8	66.1	0	0	0	0	109.8	F21	S19-F21 VanDerWaalsContact C-N 3.3Å; S19-F21 WeakPolarHBondContact O-CD1 3.37Å; S19-F21 PolarHBondContact O-N 2.77Å
20	G	95.8	Very high	96.1	Very high	93 Å²	93	65.4 Å²	65.4	96%	0.959	37%	0.374	S	S	*	.	S	Bend	trans	84	-5.8	-177.6	0	0	0	0	0	115.6
21	F	93.3	Very high	96.3	Very high	96 Å²	96	66.1 Å²	66.1	42%	0.421	38%	0.375	S	S	.	.	S	Bend	trans	-151.5	164.4	174.9	65.9	-81.2	0	0	0	110.9	A18 S19 D26 N71	A18-F21 HydrophobicContact CB-CD2 4.42Å; A18-F21 HydrophobicContact CB-CE1 3.87Å; A18-F21 HydrophobicContact CB-CE2 3.78Å; A18-F21 HydrophobicContact CB-CZ 3.47Å; A18-F21 VanDerWaalsContact CB-CZ 3.47Å; S19-F21 VanDerWaalsContact C-N 3.3Å; S19-F21 WeakPolarHBondContact O-CD1 3.37Å; S19-F21 PolarHBondContact O-N 2.77Å; F21-D26 VanDerWaalsContact CD2-OD2 3.29Å; F21-D26 WeakPolarHBondContact CD2-OD2 3.33Å; F21-D26 HydrophobicContact CE2-CB 4.37Å; F21-N71 PolarHBondContact O-ND2 2.76Å
22	N	95.7	Very high	96.3	Very high	70 Å²	70	63.2 Å²	63.2	37%	0.374	35%	0.354	S	S	.	.			trans	-89.2	121.3	175.7	174.2	9	0	0	0	109.6	K24 D25	N22-K24 PolarHBondContact O-N 3.13Å; N22-K24 WeakPolarHBondContact OD1-CB 3.46Å; N22-K24 PolarHBondContact OD1-N 3.18Å; N22-K24 VanDerWaalsContact OD1-N 3.1Å; N22-D25 WeakPolarHBondContact CB-OD2 3.3Å; N22-D25 PolarHBondContact O-N 3.01Å
23	I	96.7	Very high	96.3	Very high	0 Å²	0	67 Å²	67	0%	0	37%	0.371	C	S	.	.	G	3₁₀ helix	trans	-61.3	-21	-175.9	-157.1	171.1	0	0	0	112.7	A18 D25 M28 P47 T68 N71 A73	A18-I23 HydrophobicContact CB-CB 4.2Å; A18-I23 HydrophobicContact CB-CD1 4.34Å; A18-I23 HydrophobicContact CB-CG1 4.29Å; I23-D25 PolarHBondContact O-N 2.81Å; I23-M28 HydrophobicContact CD1-CE 3.91Å; I23-M28 HydrophobicContact CG1-CE 4.04Å; I23-P47 HydrophobicContact CG1-CG 4.14Å; I23-P47 HydrophobicContact CG2-CB 4.29Å; I23-P47 WeakPolarHBondContact O-CB 3.36Å; I23-P47 VanDerWaalsContact O-CG 3.23Å; I23-P47 WeakPolarHBondContact O-CG 3.28Å; I23-T68 HydrophobicContact CG2-CG2 4.31Å; I23-N71 VanDerWaalsContact CB-OD1 3.23Å; I23-N71 WeakPolarHBondContact CB-OD1 3.14Å; I23-N71 VanDerWaalsContact CG2-OD1 3.26Å; I23-N71 WeakPolarHBondContact CG2-OD1 3.28Å; I23-N71 PolarHBondContact N-OD1 3.45Å; I23-A73 HydrophobicContact CD1-CB 3.88Å
24	K	96.8	Very high	96.1	Very high	91 Å²	91	63.1 Å²	63.1	40%	0.396	35%	0.353	S	S	.	.	G	3₁₀ helix	trans	-63.1	-25	175	-72.8	-170.1	179.2	-173.7	0	113.5	N22 D26 T68	N22-K24 PolarHBondContact O-N 3.13Å; N22-K24 WeakPolarHBondContact OD1-CB 3.46Å; N22-K24 PolarHBondContact OD1-N 3.18Å; N22-K24 VanDerWaalsContact OD1-N 3.1Å; K24-D26 VanDerWaalsContact C-N 3.32Å; K24-T68 HydrophobicContact CD-CG2 4.1Å; K24-T68 VanDerWaalsContact CE-CG2 3.48Å; K24-T68 WeakPolarHBondContact CE-OG1 3.39Å; K24-T68 HydrophobicContact CG-CG2 3.45Å; K24-T68 VanDerWaalsContact CG-CG2 3.45Å
25	D	96.3	Very high	95.6	Very high	122 Å²	122	68.8 Å²	68.8	65%	0.652	39%	0.391	S	S	*	.	G	3₁₀ helix	trans	-88	-6	-171.2	-56.8	-34.3	0	0	0	112.2	N22 I23	N22-D25 WeakPolarHBondContact CB-OD2 3.3Å; N22-D25 PolarHBondContact O-N 3.01Å; I23-D25 PolarHBondContact O-N 2.81Å
26	D	94.9	Very high	95.1	Very high	85 Å²	85	75.7 Å²	75.7	46%	0.455	42%	0.419	S	S	.	.	S	Bend	trans	-132.8	148.4	-173.3	-71.4	-68.9	0	0	0	113.3	F21 K24 P47	F21-D26 VanDerWaalsContact CD2-OD2 3.29Å; F21-D26 WeakPolarHBondContact CD2-OD2 3.33Å; F21-D26 HydrophobicContact CE2-CB 4.37Å; K24-D26 VanDerWaalsContact C-N 3.32Å; D26-P47 WeakPolarHBondContact O-CD 3.37Å
27	Y	97	Very high	94.5	Very high	123 Å²	123	78.7 Å²	78.7	48%	0.482	43%	0.428	S	S	.	.	P	Polyproline II helix	trans	-74.7	127.6	168.2	-67.4	-60.2	0	0	0	110.7	D46	Y27-D46 HydrophobicContact CD1-CB 3.86Å; Y27-D46 HydrophobicContact CE1-CB 3.55Å; Y27-D46 WeakPolarHBondContact CE1-OD2 3.49Å
28	M	97.2	Very high	94.2	Very high	30 Å²	30	76 Å²	76	15%	0.148	42%	0.418	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	118.6	173.4	-170.4	59.6	63.4	0	0	110.2	I23 R44 I45 A73	I23-M28 HydrophobicContact CD1-CE 3.91Å; I23-M28 HydrophobicContact CG1-CE 4.04Å; M28-R44 CarbonylContact O-C 3.49Å; M28-R44 WeakPolarHBondContact O-CA 3.47Å; M28-R44 WeakPolarHBondContact O-CB 3.25Å; M28-I45 HydrophobicContact CB-CG2 3.89Å; M28-I45 PolarHBondContact N-O 3.44Å; M28-I45 PolarHBondContact O-N 2.92Å; M28-A73 HydrophobicContact CB-CB 4.25Å; M28-A73 HydrophobicContact CG-CB 3.68Å
29	H	97.8	Very high	94.2	Very high	99 Å²	99	81.3 Å²	81.3	46%	0.458	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.7	141.4	178.7	-71.2	-109.3	0	0	0	110.7	W41	H29-W41 AromaticContact ND1-CD1 3.95Å; H29-W41 AromaticContact ND1-NE1 3.18Å; H29-W41 PolarHBondContact ND1-NE1 2.54Å; H29-W41 VanDerWaalsContact ND1-NE1 3.18Å
30	W	98.2	Very high	94.1	Very high	16 Å²	16	78 Å²	78	6%	0.061	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	133.1	169.8	-68.3	90.6	0	0	0	109.5	L14 C16 I42 G43 A73 L75	L14-W30 HydrophobicContact CB-CH2 3.91Å; L14-W30 HydrophobicContact CB-CZ3 3.85Å; L14-W30 HydrophobicContact CD1-CZ3 4.2Å; C16-W30 HydrophobicContact CB-CH2 4.08Å; C16-W30 HydrophobicContact CB-CZ2 4.24Å; W30-I42 HydrophobicContact CB-CB 4.19Å; W30-I42 HydrophobicContact CB-CD1 4.44Å; W30-I42 WeakPolarHBondContact O-CB 3.15Å; W30-I42 PolarHBondContact O-N 3.03Å; W30-G43 PolarHBondContact N-O 3.04Å; W30-G43 PolarHBondContact O-N 2.88Å; W30-A73 HydrophobicContact CZ2-CB 4.44Å; W30-L75 HydrophobicContact CB-CD2 4.07Å; W30-L75 HydrophobicContact CD2-CB 3.45Å; W30-L75 VanDerWaalsContact CD2-CB 3.45Å; W30-L75 HydrophobicContact CD2-CD2 3.84Å; W30-L75 HydrophobicContact CD2-CG 4.21Å; W30-L75 VanDerWaalsContact CE2-CB 3.49Å; W30-L75 HydrophobicContact CE3-CB 3.64Å; W30-L75 HydrophobicContact CE3-CD2 3.6Å; W30-L75 HydrophobicContact CE3-CG 4.26Å; W30-L75 HydrophobicContact CG-CB 4.01Å; W30-L75 HydrophobicContact CG-CD2 4.05Å; W30-L75 HydrophobicContact CG-CG 4.45Å; W30-L75 HydrophobicContact CH2-CB 3.88Å; W30-L75 HydrophobicContact CZ2-CB 3.72Å; W30-L75 HydrophobicContact CZ3-CB 3.84Å; W30-L75 HydrophobicContact CZ3-CD2 4.3Å
31	V	97.3	Very high	94.2	Very high	50 Å²	50	78 Å²	78	30%	0.303	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	157.9	177.3	-64.9	0	0	0	0	108	L39 E40 Y88	V31-L39 HydrophobicContact CG2-CD2 4.33Å; V31-E40 CarbonylContact C-O 3.48Å; V31-E40 VanDerWaalsContact CA-O 3.3Å; V31-E40 WeakPolarHBondContact CA-O 3.4Å; V31-Y88 WeakPolarHBondContact O-CA 3.43Å; V31-Y88 VanDerWaalsContact O-OXT 3.06Å
32	K	95.1	Very high	94.4	Very high	1 Å²	1	73.5 Å²	73.5	0%	0.004	37%	0.368	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	142.4	162.4	72.2	173.8	-160.1	172.6	0	110.1	E40 I42 F58 E83 D84 A86 V87 Y88	K32-E40 VanDerWaalsContact CE-OE1 3.32Å; K32-E40 WeakPolarHBondContact CE-OE1 3.36Å; K32-E40 HydrophobicContact CG-CB 3.84Å; K32-E40 PolarHBondContact N-O 3.03Å; K32-E40 PolarHBondContact O-N 2.91Å; K32-I42 HydrophobicContact CB-CD1 4.16Å; K32-F58 HydrophobicContact CD-CE1 4.14Å; K32-F58 HydrophobicContact CD-CZ 3.99Å; K32-F58 HydrophobicContact CG-CZ 4.36Å; K32-E83 PolarHBondContact NZ-O 3.25Å; K32-D84 IonicContact NZ-OD1 3.14Å; K32-A86 HydrophobicContact CB-CB 3.97Å; K32-A86 HydrophobicContact CD-CB 4.36Å; K32-V87 CarbonylContact C-O 3.58Å; K32-V87 VanDerWaalsContact CA-O 3.27Å; K32-V87 WeakPolarHBondContact CA-O 3.26Å; K32-Y88 HydrophobicContact CB-CD1 3.69Å; K32-Y88 HydrophobicContact CB-CE1 3.5Å; K32-Y88 VanDerWaalsContact CB-CE1 3.5Å; K32-Y88 HydrophobicContact CB-CG 4.39Å; K32-Y88 HydrophobicContact CD-CE1 4.06Å; K32-Y88 HydrophobicContact CG-CE1 4.38Å
33	Q	95.4	Very high	94.6	Very high	97 Å²	97	70.1 Å²	70.1	45%	0.453	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	123.1	177.2	-165	176.3	17.1	0	0	110.5	G38 L39 A86 V87	Q33-G38 WeakPolarHBondContact CA-O 3.29Å; Q33-L39 HydrophobicContact CB-CD2 3.88Å; Q33-L39 HydrophobicContact CG-CD2 3.97Å; Q33-A86 WeakPolarHBondContact O-CA 3.32Å; Q33-A86 WeakPolarHBondContact O-CB 3.5Å; Q33-V87 HydrophobicContact CB-CB 4.48Å; Q33-V87 PolarHBondContact N-O 3.32Å; Q33-V87 PolarHBondContact O-N 2.54Å
34	R	92.2	Very high	94.7	Very high	33 Å²	33	72 Å²	72	13%	0.125	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	144.2	168.3	-71.5	-173.1	-78.1	170.3	1.1	109.3	E36 Q37 G38 E40 A86	R34-E36 PolarHBondContact O-N 3.49Å; R34-Q37 HydrophobicContact CB-CB 4.05Å; R34-Q37 VanDerWaalsContact NH2-CD 3.29Å; R34-Q37 PolarHBondContact O-N 2.75Å; R34-Q37 VanDerWaalsContact O-N 3.13Å; R34-G38 PolarHBondContact N-O 3.42Å; R34-G38 PolarHBondContact O-N 2.83Å; R34-E40 IonicContact CZ-OE1 3.8Å; R34-E40 IonicContact NE-OE1 3.87Å; R34-E40 PolarHBondContact NE-OE1 3.45Å; R34-E40 VanDerWaalsContact NE-OE1 3.14Å; R34-E40 IonicContact NH2-OE1 2.77Å; R34-E40 PolarHBondContact NH2-OE1 3.2Å; R34-E40 IonicContact NH2-OE2 3.37Å; R34-A86 HydrophobicContact CG-CB 3.85Å
35	P	86.7	Confident	94.7	Very high	138 Å²	138	68 Å²	68	90%	0.896	34%	0.34	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.2	-33	-178	-29.3	35.2	0	0	0	114.2
36	E	86.6	Confident	94.8	Very high	189 Å²	189	63.1 Å²	63.1	88%	0.883	31%	0.314	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.2	-7.7	-175	-58.4	-173.8	-179.1	0	0	114.8	R34	R34-E36 PolarHBondContact O-N 3.49Å
37	Q	83.6	Confident	95	Very high	114 Å²	114	59.5 Å²	59.5	53%	0.533	30%	0.295	S	S	.	.	T	Hydrogen-bonded Turn	trans	-122.4	2.3	-167.1	-103.1	153.3	-21.2	0	0	114.6	R34	R34-Q37 HydrophobicContact CB-CB 4.05Å; R34-Q37 VanDerWaalsContact NH2-CD 3.29Å; R34-Q37 PolarHBondContact O-N 2.75Å; R34-Q37 VanDerWaalsContact O-N 3.13Å
38	G	89.9	Confident	95	Very high	34 Å²	34	56.7 Å²	56.7	35%	0.351	30%	0.297	S	S	.	.	E	Extended strand (participates in β ladder)	trans	65.8	-157.6	179.7	0	0	0	0	0	112.4	Q33 R34	Q33-G38 WeakPolarHBondContact CA-O 3.29Å; R34-G38 PolarHBondContact N-O 3.42Å; R34-G38 PolarHBondContact O-N 2.83Å
39	L	94.8	Very high	95	Very high	122 Å²	122	60.2 Å²	60.2	64%	0.639	32%	0.317	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.1	120.4	179.1	-65.4	177.4	0	0	0	110.7	V31 Q33	V31-L39 HydrophobicContact CG2-CD2 4.33Å; Q33-L39 HydrophobicContact CB-CD2 3.88Å; Q33-L39 HydrophobicContact CG-CD2 3.97Å
40	E	96	Very high	94.9	Very high	35 Å²	35	57.6 Å²	57.6	16%	0.164	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	118.5	169	-68.3	-179.7	-110.6	0	0	109	V31 K32 R34 K57	V31-E40 CarbonylContact C-O 3.48Å; V31-E40 VanDerWaalsContact CA-O 3.3Å; V31-E40 WeakPolarHBondContact CA-O 3.4Å; K32-E40 VanDerWaalsContact CE-OE1 3.32Å; K32-E40 WeakPolarHBondContact CE-OE1 3.36Å; K32-E40 HydrophobicContact CG-CB 3.84Å; K32-E40 PolarHBondContact N-O 3.03Å; K32-E40 PolarHBondContact O-N 2.91Å; R34-E40 IonicContact CZ-OE1 3.8Å; R34-E40 IonicContact NE-OE1 3.87Å; R34-E40 PolarHBondContact NE-OE1 3.45Å; R34-E40 VanDerWaalsContact NE-OE1 3.14Å; R34-E40 IonicContact NH2-OE1 2.77Å; R34-E40 PolarHBondContact NH2-OE1 3.2Å; R34-E40 IonicContact NH2-OE2 3.37Å; E40-K57 IonicContact OE2-NZ 2.74Å; E40-K57 PolarHBondContact OE2-NZ 3.21Å
41	W	97.4	Very high	94.9	Very high	94 Å²	94	61 Å²	61	36%	0.356	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.4	127.5	176.6	-178	69.1	0	0	0	111.2	H29 G43 R44 K53 A55	H29-W41 AromaticContact ND1-CD1 3.95Å; H29-W41 AromaticContact ND1-NE1 3.18Å; H29-W41 PolarHBondContact ND1-NE1 2.54Å; H29-W41 VanDerWaalsContact ND1-NE1 3.18Å; W41-G43 VanDerWaalsContact CE2-C 3.47Å; W41-G43 PolarHBondContact NE1-O 2.91Å; W41-R44 HydrophobicContact CZ2-CB 4.07Å; W41-R44 HydrophobicContact CZ2-CG 4.06Å; W41-K53 HydrophobicContact CH2-CB 4.11Å; W41-A55 HydrophobicContact CE3-CB 3.85Å; W41-A55 HydrophobicContact CZ3-CB 4.08Å; W41-A55 VanDerWaalsContact O-CB 3.25Å; W41-A55 WeakPolarHBondContact O-CB 3.13Å
42	I	97.9	Very high	95	Very high	0 Å²	0	60.8 Å²	60.8	0%	0	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.9	-50.4	-179.5	-61.9	174.6	0	0	0	110	W30 K32 Y54 A55 F58 A62 L75 Y88	W30-I42 HydrophobicContact CB-CB 4.19Å; W30-I42 HydrophobicContact CB-CD1 4.44Å; W30-I42 WeakPolarHBondContact O-CB 3.15Å; W30-I42 PolarHBondContact O-N 3.03Å; K32-I42 HydrophobicContact CB-CD1 4.16Å; I42-Y54 WeakPolarHBondContact O-CA 3.34Å; I42-A55 PolarHBondContact O-N 2.95Å; I42-F58 HydrophobicContact CB-CD2 4.26Å; I42-F58 HydrophobicContact CB-CG 4.35Å; I42-F58 HydrophobicContact CG1-CD1 4.34Å; I42-F58 HydrophobicContact CG1-CD2 4.25Å; I42-F58 HydrophobicContact CG1-CE1 4.18Å; I42-F58 HydrophobicContact CG1-CE2 4.07Å; I42-F58 HydrophobicContact CG1-CG 4.37Å; I42-F58 HydrophobicContact CG1-CZ 4.03Å; I42-F58 HydrophobicContact CG2-CB 3.91Å; I42-F58 HydrophobicContact CG2-CD1 4.24Å; I42-F58 HydrophobicContact CG2-CD2 4.27Å; I42-F58 HydrophobicContact CG2-CG 3.9Å; I42-A62 HydrophobicContact CG2-CB 3.78Å; I42-L75 HydrophobicContact CD1-CD2 3.8Å; I42-L75 HydrophobicContact CG2-CD1 4.26Å; I42-Y88 HydrophobicContact CD1-CD1 3.78Å; I42-Y88 HydrophobicContact CD1-CE1 3.82Å
43	G	98.4	Very high	95.1	Very high	0 Å²	0	66.1 Å²	66.1	0%	0	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	173.1	-179.5	-172.9	0	0	0	0	0	112.8	W30 W41 K53	W30-G43 PolarHBondContact N-O 3.04Å; W30-G43 PolarHBondContact O-N 2.88Å; W41-G43 VanDerWaalsContact CE2-C 3.47Å; W41-G43 PolarHBondContact NE1-O 2.91Å; G43-K53 CarbonylContact C-O 3.58Å; G43-K53 WeakPolarHBondContact CA-O 3.49Å
44	R	98.4	Very high	95.3	Very high	39 Å²	39	64.2 Å²	64.2	15%	0.147	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	159.1	171.7	72.8	172.5	-176.7	77.7	-14	111.6	M28 W41 T52 K53	M28-R44 CarbonylContact O-C 3.49Å; M28-R44 WeakPolarHBondContact O-CA 3.47Å; M28-R44 WeakPolarHBondContact O-CB 3.25Å; W41-R44 HydrophobicContact CZ2-CB 4.07Å; W41-R44 HydrophobicContact CZ2-CG 4.06Å; R44-T52 VanDerWaalsContact O-CA 3.3Å; R44-T52 WeakPolarHBondContact O-CA 3.12Å; R44-K53 HydrophobicContact CG-CB 4.29Å; R44-K53 PolarHBondContact N-O 3.36Å; R44-K53 PolarHBondContact O-N 3.13Å
45	I	98.6	Very high	95.6	Very high	6 Å²	6	63.4 Å²	63.4	3%	0.031	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	143.3	165.9	-174.5	163	0	0	0	110.2	M28 P47 N51 T52 I64 A66	M28-I45 HydrophobicContact CB-CG2 3.89Å; M28-I45 PolarHBondContact N-O 3.44Å; M28-I45 PolarHBondContact O-N 2.92Å; I45-P47 HydrophobicContact CG2-CG 4.33Å; I45-P47 WeakPolarHBondContact O-CD 3.44Å; I45-N51 CarbonylContact C-O 3.54Å; I45-N51 WeakPolarHBondContact CA-O 3.39Å; I45-T52 HydrophobicContact CB-CG2 3.98Å; I45-T52 HydrophobicContact CD1-CG2 3.97Å; I45-T52 HydrophobicContact CG1-CG2 3.9Å; I45-I64 HydrophobicContact CB-CG2 3.62Å; I45-I64 HydrophobicContact CD1-CG2 4.47Å; I45-I64 HydrophobicContact CG2-CG2 3.54Å; I45-A66 HydrophobicContact CD1-CB 3.95Å; I45-A66 HydrophobicContact CG2-CB 4.47Å
46	D	98.3	Very high	96	Very high	20 Å²	20	62.2 Å²	62.2	11%	0.107	34%	0.34	C	S	.	.			trans	-89.8	103.1	159.7	-172.7	-26.1	0	0	0	108.7	Y27 A48 N49 G50 N51	Y27-D46 HydrophobicContact CD1-CB 3.86Å; Y27-D46 HydrophobicContact CE1-CB 3.55Å; Y27-D46 WeakPolarHBondContact CE1-OD2 3.49Å; D46-A48 PolarHBondContact O-N 3.03Å; D46-A48 VanDerWaalsContact OD1-CB 3.28Å; D46-A48 WeakPolarHBondContact OD1-CB 3.46Å; D46-A48 PolarHBondContact OD1-N 3Å; D46-N49 WeakPolarHBondContact CB-OD1 3.3Å; D46-N49 PolarHBondContact O-N 2.84Å; D46-N49 PolarHBondContact OD2-ND2 3.34Å; D46-N49 PolarHBondContact OD2-OD1 2.78Å; D46-G50 VanDerWaalsContact O-CA 3.26Å; D46-G50 WeakPolarHBondContact O-CA 2.98Å; D46-G50 PolarHBondContact O-N 3.32Å; D46-N51 HydrophobicContact CB-CB 4.22Å; D46-N51 PolarHBondContact N-O 2.99Å
47	P	97.9	Very high	96.4	Very high	10 Å²	10	58.6 Å²	58.6	7%	0.065	32%	0.321	C	S	.	.	T	Hydrogen-bonded Turn	trans	-69.8	-15.8	-176.2	-20.6	37.1	0	0	0	113.1	I23 D26 I45 A66 T68	I23-P47 HydrophobicContact CG1-CG 4.14Å; I23-P47 HydrophobicContact CG2-CB 4.29Å; I23-P47 WeakPolarHBondContact O-CB 3.36Å; I23-P47 VanDerWaalsContact O-CG 3.23Å; I23-P47 WeakPolarHBondContact O-CG 3.28Å; D26-P47 WeakPolarHBondContact O-CD 3.37Å; I45-P47 HydrophobicContact CG2-CG 4.33Å; I45-P47 WeakPolarHBondContact O-CD 3.44Å; P47-A66 HydrophobicContact CB-CB 3.84Å; P47-A66 HydrophobicContact CG-CB 4.2Å; P47-T68 HydrophobicContact CB-CG2 4.11Å; P47-T68 WeakPolarHBondContact O-CG2 3.03Å
48	A	97.3	Very high	97	Very high	63 Å²	63	53.4 Å²	53.4	52%	0.521	30%	0.297	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.2	-34.6	177.2	0	0	0	0	0	112.6	D46	D46-A48 PolarHBondContact O-N 3.03Å; D46-A48 VanDerWaalsContact OD1-CB 3.28Å; D46-A48 WeakPolarHBondContact OD1-CB 3.46Å; D46-A48 PolarHBondContact OD1-N 3Å
49	N	97.1	Very high	97.2	Very high	105 Å²	105	57.7 Å²	57.7	56%	0.561	31%	0.308	S	S	*	.	T	Hydrogen-bonded Turn	trans	-132	-1	-174.7	60.4	41.9	0	0	0	114.5	D46 N51	D46-N49 WeakPolarHBondContact CB-OD1 3.3Å; D46-N49 PolarHBondContact O-N 2.84Å; D46-N49 PolarHBondContact OD2-ND2 3.34Å; D46-N49 PolarHBondContact OD2-OD1 2.78Å; N49-N51 VanDerWaalsContact C-N 3.28Å; N49-N51 PolarHBondContact O-N 2.86Å; N49-N51 WeakPolarHBondContact OD1-CB 3.35Å; N49-N51 PolarHBondContact OD1-N 3Å
50	G	96.8	Very high	97.2	Very high	43 Å²	43	59.8 Å²	59.8	44%	0.443	32%	0.319	S	S	.	.			trans	76.3	6.4	178.7	0	0	0	0	0	115	D46 T52	D46-G50 VanDerWaalsContact O-CA 3.26Å; D46-G50 WeakPolarHBondContact O-CA 2.98Å; D46-G50 PolarHBondContact O-N 3.32Å; G50-T52 PolarHBondContact O-N 3.24Å
51	N	98.1	Very high	97.2	Very high	87 Å²	87	60.1 Å²	60.1	47%	0.465	32%	0.32	S	S	.	.			trans	-67.1	127.1	-179.2	-172.9	-23.6	0	0	0	110.6	I45 D46 N49	I45-N51 CarbonylContact C-O 3.54Å; I45-N51 WeakPolarHBondContact CA-O 3.39Å; D46-N51 HydrophobicContact CB-CB 4.22Å; D46-N51 PolarHBondContact N-O 2.99Å; N49-N51 VanDerWaalsContact C-N 3.28Å; N49-N51 PolarHBondContact O-N 2.86Å; N49-N51 WeakPolarHBondContact OD1-CB 3.35Å; N49-N51 PolarHBondContact OD1-N 3Å
52	T	98.4	Very high	97.2	Very high	46 Å²	46	55.8 Å²	55.8	28%	0.282	31%	0.305	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	145.1	-179.7	50.7	0	0	0	0	111.6	R44 I45 G50 Y54 I64	R44-T52 VanDerWaalsContact O-CA 3.3Å; R44-T52 WeakPolarHBondContact O-CA 3.12Å; I45-T52 HydrophobicContact CB-CG2 3.98Å; I45-T52 HydrophobicContact CD1-CG2 3.97Å; I45-T52 HydrophobicContact CG1-CG2 3.9Å; G50-T52 PolarHBondContact O-N 3.24Å; T52-Y54 WeakPolarHBondContact OG1-CE2 3.37Å; T52-I64 HydrophobicContact CG2-CB 4.26Å
53	K	98.3	Very high	97.2	Very high	114 Å²	114	59 Å²	59	50%	0.496	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	140.6	167.7	-65.9	-170.2	177.9	-171.9	0	108.8	W41 G43 R44	W41-K53 HydrophobicContact CH2-CB 4.11Å; G43-K53 CarbonylContact C-O 3.58Å; G43-K53 WeakPolarHBondContact CA-O 3.49Å; R44-K53 HydrophobicContact CG-CB 4.29Å; R44-K53 PolarHBondContact N-O 3.36Å; R44-K53 PolarHBondContact O-N 3.13Å
54	Y	98.5	Very high	97.2	Very high	56 Å²	56	59.3 Å²	59.3	22%	0.22	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	148.7	-179.4	-59.7	-87.6	0	0	0	109.8	I42 T52 A62 I64	I42-Y54 WeakPolarHBondContact O-CA 3.34Å; T52-Y54 WeakPolarHBondContact OG1-CE2 3.37Å; Y54-A62 HydrophobicContact CD1-CB 4.21Å; Y54-A62 HydrophobicContact CE1-CB 4.17Å; Y54-A62 VanDerWaalsContact CE1-O 3.25Å; Y54-A62 WeakPolarHBondContact CE1-O 3.25Å; Y54-I64 HydrophobicContact CD1-CD1 4.14Å; Y54-I64 HydrophobicContact CE1-CB 4.3Å; Y54-I64 HydrophobicContact CE1-CD1 3.72Å; Y54-I64 HydrophobicContact CE1-CG1 3.8Å; Y54-I64 PolarHBondContact OH-N 2.79Å
55	A	97.7	Very high	97.2	Very high	16 Å²	16	60.4 Å²	60.4	13%	0.132	34%	0.337	C	S	.	.			trans	-69.8	143.5	160	0	0	0	0	0	109	W41 I42 K57 F58 Q59	W41-A55 HydrophobicContact CE3-CB 3.85Å; W41-A55 HydrophobicContact CZ3-CB 4.08Å; W41-A55 VanDerWaalsContact O-CB 3.25Å; W41-A55 WeakPolarHBondContact O-CB 3.13Å; I42-A55 PolarHBondContact O-N 2.95Å; A55-K57 PolarHBondContact O-N 3.46Å; A55-F58 HydrophobicContact CB-CD2 4.1Å; A55-F58 PolarHBondContact O-N 3.08Å; A55-Q59 PolarHBondContact O-N 2.87Å
56	P	96.8	Very high	97.2	Very high	114 Å²	114	61.6 Å²	61.6	74%	0.74	35%	0.348	S	S	*	.	G	3₁₀ helix	trans	-52.1	-35.6	-174.9	-30	35.5	0	0	0	114.2	F58 Q59	P56-F58 PolarHBondContact O-N 2.92Å; P56-Q59 PolarHBondContact O-N 3.5Å
57	K	94.1	Very high	97.2	Very high	113 Å²	113	63.3 Å²	63.3	49%	0.491	36%	0.357	S	S	.	.	G	3₁₀ helix	trans	-60.5	-26	178.5	-177.2	176.3	176.8	-179.2	0	114.1	E40 A55	E40-K57 IonicContact OE2-NZ 2.74Å; E40-K57 PolarHBondContact OE2-NZ 3.21Å; A55-K57 PolarHBondContact O-N 3.46Å
58	F	95.8	Very high	97.1	Very high	5 Å²	5	65.1 Å²	65.1	2%	0.022	37%	0.368	C	S	.	.	G	3₁₀ helix	trans	-112.4	0.2	-172.9	-59.8	-80.9	0	0	0	113.5	K32 I42 A55 P56 D60 K61 A62	K32-F58 HydrophobicContact CD-CE1 4.14Å; K32-F58 HydrophobicContact CD-CZ 3.99Å; K32-F58 HydrophobicContact CG-CZ 4.36Å; I42-F58 HydrophobicContact CB-CD2 4.26Å; I42-F58 HydrophobicContact CB-CG 4.35Å; I42-F58 HydrophobicContact CG1-CD1 4.34Å; I42-F58 HydrophobicContact CG1-CD2 4.25Å; I42-F58 HydrophobicContact CG1-CE1 4.18Å; I42-F58 HydrophobicContact CG1-CE2 4.07Å; I42-F58 HydrophobicContact CG1-CG 4.37Å; I42-F58 HydrophobicContact CG1-CZ 4.03Å; I42-F58 HydrophobicContact CG2-CB 3.91Å; I42-F58 HydrophobicContact CG2-CD1 4.24Å; I42-F58 HydrophobicContact CG2-CD2 4.27Å; I42-F58 HydrophobicContact CG2-CG 3.9Å; A55-F58 HydrophobicContact CB-CD2 4.1Å; A55-F58 PolarHBondContact O-N 3.08Å; P56-F58 PolarHBondContact O-N 2.92Å; F58-D60 VanDerWaalsContact C-N 3.29Å; F58-D60 PolarHBondContact O-N 3.01Å; F58-K61 PolarHBondContact O-N 3.09Å; F58-A62 HydrophobicContact CB-CB 4.04Å; F58-A62 WeakPolarHBondContact O-CB 3.46Å; F58-A62 PolarHBondContact O-N 2.94Å
59	Q	95.1	Very high	97.1	Very high	124 Å²	124	67.2 Å²	67.2	58%	0.579	38%	0.379	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.9	-37.5	-172.2	-171.6	163.7	11.3	0	0	113.4	A55 P56	A55-Q59 PolarHBondContact O-N 2.87Å; P56-Q59 PolarHBondContact O-N 3.5Å
60	D	94.5	Very high	97.1	Very high	165 Å²	165	64.5 Å²	64.5	88%	0.882	37%	0.368	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.4	-1.8	178.7	-58	-40.3	0	0	0	113.3	F58	F58-D60 VanDerWaalsContact C-N 3.29Å; F58-D60 PolarHBondContact O-N 3.01Å
61	K	95.7	Very high	97.1	Very high	42 Å²	42	64 Å²	64	18%	0.183	36%	0.355	C	S	.	.	T	Hydrogen-bonded Turn	trans	-113.3	-34.2	-170.7	-163.7	172.2	-168.2	168.5	0	113.6	F58 L77 S78 D84	F58-K61 PolarHBondContact O-N 3.09Å; K61-L77 WeakPolarHBondContact O-CA 3.47Å; K61-S78 VanDerWaalsContact CE-O 3.29Å; K61-S78 WeakPolarHBondContact CE-O 3.29Å; K61-S78 VanDerWaalsContact CG-O 3.28Å; K61-S78 WeakPolarHBondContact CG-O 3.23Å; K61-S78 PolarHBondContact O-N 3.16Å; K61-D84 WeakPolarHBondContact CE-OD1 3.39Å; K61-D84 WeakPolarHBondContact CE-OD2 3.47Å; K61-D84 IonicContact NZ-OD1 2.83Å; K61-D84 PolarHBondContact NZ-OD1 3.38Å; K61-D84 IonicContact NZ-OD2 2.54Å; K61-D84 PolarHBondContact NZ-OD2 3.1Å
62	A	97.7	Very high	97.1	Very high	4 Å²	4	60.2 Å²	60.2	3%	0.033	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	135.5	-173.9	0	0	0	0	0	111.3	I42 Y54 F58 L75 Q76 L77	I42-A62 HydrophobicContact CG2-CB 3.78Å; Y54-A62 HydrophobicContact CD1-CB 4.21Å; Y54-A62 HydrophobicContact CE1-CB 4.17Å; Y54-A62 VanDerWaalsContact CE1-O 3.25Å; Y54-A62 WeakPolarHBondContact CE1-O 3.25Å; F58-A62 HydrophobicContact CB-CB 4.04Å; F58-A62 WeakPolarHBondContact O-CB 3.46Å; F58-A62 PolarHBondContact O-N 2.94Å; A62-L75 HydrophobicContact CB-CD1 3.84Å; A62-Q76 CarbonylContact C-O 3.5Å; A62-Q76 WeakPolarHBondContact CA-O 3.25Å; A62-L77 HydrophobicContact CB-CD2 3.84Å
63	T	98.4	Very high	97.1	Very high	68 Å²	68	58 Å²	58	42%	0.417	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	117.4	167.4	-57.1	0	0	0	0	108.3	T65 Q76	T63-T65 HydrophobicContact CG2-CG2 4.27Å; T63-Q76 PolarHBondContact N-O 2.81Å; T63-Q76 PolarHBondContact O-N 2.79Å
64	I	98.6	Very high	97.1	Very high	6 Å²	6	55.1 Å²	55.1	3%	0.031	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.4	131.7	177.6	-58.8	165.4	0	0	0	109	I45 T52 Y54 Y74 L75	I45-I64 HydrophobicContact CB-CG2 3.62Å; I45-I64 HydrophobicContact CD1-CG2 4.47Å; I45-I64 HydrophobicContact CG2-CG2 3.54Å; T52-I64 HydrophobicContact CG2-CB 4.26Å; Y54-I64 HydrophobicContact CD1-CD1 4.14Å; Y54-I64 HydrophobicContact CE1-CB 4.3Å; Y54-I64 HydrophobicContact CE1-CD1 3.72Å; Y54-I64 HydrophobicContact CE1-CG1 3.8Å; Y54-I64 PolarHBondContact OH-N 2.79Å; I64-Y74 WeakPolarHBondContact CA-O 3.37Å; I64-L75 HydrophobicContact CG1-CD1 3.84Å
65	T	98.4	Very high	97.1	Very high	61 Å²	61	52.4 Å²	52.4	37%	0.374	30%	0.298	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	164.6	177	55.9	0	0	0	0	110.8	T63 A73 Y74	T63-T65 HydrophobicContact CG2-CG2 4.27Å; T65-A73 WeakPolarHBondContact O-CA 3.41Å; T65-Y74 PolarHBondContact N-O 3.03Å; T65-Y74 PolarHBondContact O-N 2.81Å
66	A	98.1	Very high	97.1	Very high	32 Å²	32	55.4 Å²	55.4	26%	0.264	31%	0.309	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.8	137.5	173.2	0	0	0	0	0	110.4	I45 P47 T72	I45-A66 HydrophobicContact CD1-CB 3.95Å; I45-A66 HydrophobicContact CG2-CB 4.47Å; P47-A66 HydrophobicContact CB-CB 3.84Å; P47-A66 HydrophobicContact CG-CB 4.2Å; A66-T72 WeakPolarHBondContact CA-O 3.34Å
67	D	97.5	Very high	97.1	Very high	56 Å²	56	50 Å²	50	30%	0.299	27%	0.274	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108	107.2	167.1	175.3	10.6	0	0	0	108.6	S69 S70 N71 T72 Y74	D67-S69 VanDerWaalsContact C-N 3.29Å; D67-S69 PolarHBondContact O-N 3.03Å; D67-S69 WeakPolarHBondContact OD1-CB 3.23Å; D67-S69 PolarHBondContact OD1-N 2.86Å; D67-S69 PolarHBondContact OD1-OG 2.92Å; D67-S69 PolarHBondContact OD2-OG 2.92Å; D67-S70 WeakPolarHBondContact CB-OG 3.45Å; D67-S70 PolarHBondContact OD1-N 3.07Å; D67-S70 WeakPolarHBondContact OD2-CB 3.2Å; D67-S70 PolarHBondContact OD2-OG 2.85Å; D67-N71 PolarHBondContact O-N 2.86Å; D67-N71 VanDerWaalsContact O-N 3.1Å; D67-T72 PolarHBondContact N-O 3.36Å; D67-T72 PolarHBondContact O-N 2.93Å; D67-Y74 HydrophobicContact CB-CE2 4.09Å
68	T	96.8	Very high	97.2	Very high	47 Å²	47	46.3 Å²	46.3	29%	0.288	26%	0.262	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.7	-15.9	-176.5	63.3	0	0	0	0	113	I23 K24 P47	I23-T68 HydrophobicContact CG2-CG2 4.31Å; K24-T68 HydrophobicContact CD-CG2 4.1Å; K24-T68 VanDerWaalsContact CE-CG2 3.48Å; K24-T68 WeakPolarHBondContact CE-OG1 3.39Å; K24-T68 HydrophobicContact CG-CG2 3.45Å; K24-T68 VanDerWaalsContact CG-CG2 3.45Å; P47-T68 HydrophobicContact CB-CG2 4.11Å; P47-T68 WeakPolarHBondContact O-CG2 3.03Å
69	S	96.4	Very high	97.1	Very high	108 Å²	108	50.1 Å²	50.1	76%	0.755	29%	0.289	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.9	-36.7	175	72.8	0	0	0	0	111.6	D67	D67-S69 VanDerWaalsContact C-N 3.29Å; D67-S69 PolarHBondContact O-N 3.03Å; D67-S69 WeakPolarHBondContact OD1-CB 3.23Å; D67-S69 PolarHBondContact OD1-N 2.86Å; D67-S69 PolarHBondContact OD1-OG 2.92Å; D67-S69 PolarHBondContact OD2-OG 2.92Å
70	S	97.3	Very high	97.1	Very high	48 Å²	48	44.8 Å²	44.8	34%	0.336	27%	0.265	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.2	7.9	175.5	64.5	0	0	0	0	113.5	D67 T72	D67-S70 WeakPolarHBondContact CB-OG 3.45Å; D67-S70 PolarHBondContact OD1-N 3.07Å; D67-S70 WeakPolarHBondContact OD2-CB 3.2Å; D67-S70 PolarHBondContact OD2-OG 2.85Å; S70-T72 PolarHBondContact O-N 3.4Å; S70-T72 VanDerWaalsContact O-N 3.16Å; S70-T72 PolarHBondContact O-OG1 2.84Å
71	N	97.2	Very high	97	Very high	32 Å²	32	40 Å²	40	17%	0.171	24%	0.242	C	C	.	.	T	Hydrogen-bonded Turn	trans	52.1	35.7	-179.3	-147	40.7	0	0	0	113.5	T17 A18 F21 I23 D67	T17-N71 WeakPolarHBondContact CA-O 3.5Å; A18-N71 WeakPolarHBondContact CB-ND2 3.3Å; A18-N71 PolarHBondContact N-O 2.85Å; A18-N71 PolarHBondContact O-ND2 3.22Å; F21-N71 PolarHBondContact O-ND2 2.76Å; I23-N71 VanDerWaalsContact CB-OD1 3.23Å; I23-N71 WeakPolarHBondContact CB-OD1 3.14Å; I23-N71 VanDerWaalsContact CG2-OD1 3.26Å; I23-N71 WeakPolarHBondContact CG2-OD1 3.28Å; I23-N71 PolarHBondContact N-OD1 3.45Å; D67-N71 PolarHBondContact O-N 2.86Å; D67-N71 VanDerWaalsContact O-N 3.1Å
72	T	98.1	Very high	96.8	Very high	7 Å²	7	42.8 Å²	42.8	4%	0.043	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	130.8	-168.7	-59.9	0	0	0	0	112	C16 T17 A66 D67 S70 Y74	C16-T72 CarbonylContact O-C 3.57Å; C16-T72 WeakPolarHBondContact O-CA 3.38Å; T17-T72 WeakPolarHBondContact CG2-OG1 3.3Å; T17-T72 PolarHBondContact OG1-OG1 3.08Å; A66-T72 WeakPolarHBondContact CA-O 3.34Å; D67-T72 PolarHBondContact N-O 3.36Å; D67-T72 PolarHBondContact O-N 2.93Å; S70-T72 PolarHBondContact O-N 3.4Å; S70-T72 VanDerWaalsContact O-N 3.16Å; S70-T72 PolarHBondContact O-OG1 2.84Å; T72-Y74 HydrophobicContact CG2-CD1 4.27Å; T72-Y74 HydrophobicContact CG2-CE1 3.63Å; T72-Y74 HydrophobicContact CG2-CE2 3.92Å; T72-Y74 VanDerWaalsContact CG2-CZ 3.42Å
73	A	98	Very high	96.4	Very high	0 Å²	0	47.8 Å²	47.8	0%	0	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	151.6	169	0	0	0	0	0	111.2	S15 C16 I23 M28 W30 T65	S15-A73 WeakPolarHBondContact CA-O 3.27Å; C16-A73 PolarHBondContact N-O 2.8Å; C16-A73 PolarHBondContact O-N 3.18Å; I23-A73 HydrophobicContact CD1-CB 3.88Å; M28-A73 HydrophobicContact CB-CB 4.25Å; M28-A73 HydrophobicContact CG-CB 3.68Å; W30-A73 HydrophobicContact CZ2-CB 4.44Å; T65-A73 WeakPolarHBondContact O-CA 3.41Å
74	Y	98.3	Very high	96.1	Very high	53 Å²	53	45.1 Å²	45.1	21%	0.208	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	143.3	179.3	-52.6	-86	0	0	0	111.8	K13 L14 I64 T65 D67 T72	K13-Y74 HydrophobicContact CD-CD1 4.48Å; K13-Y74 VanDerWaalsContact CE-CD1 3.42Å; K13-Y74 HydrophobicContact CG-CD1 4.48Å; L14-Y74 WeakPolarHBondContact O-CA 3.5Å; L14-Y74 WeakPolarHBondContact O-CB 3.23Å; I64-Y74 WeakPolarHBondContact CA-O 3.37Å; T65-Y74 PolarHBondContact N-O 3.03Å; T65-Y74 PolarHBondContact O-N 2.81Å; D67-Y74 HydrophobicContact CB-CE2 4.09Å; T72-Y74 HydrophobicContact CG2-CD1 4.27Å; T72-Y74 HydrophobicContact CG2-CE1 3.63Å; T72-Y74 HydrophobicContact CG2-CE2 3.92Å; T72-Y74 VanDerWaalsContact CG2-CZ 3.42Å
75	L	98.3	Very high	95.9	Very high	0 Å²	0	50 Å²	50	0%	0	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	119.8	167.2	169.1	66.1	0	0	0	108.2	K13 L14 W30 I42 A62 I64 L77 Y88	K13-L75 CarbonylContact C-O 3.53Å; K13-L75 WeakPolarHBondContact CA-O 3.05Å; L14-L75 HydrophobicContact CB-CB 4.47Å; L14-L75 HydrophobicContact CD1-CD2 4.32Å; L14-L75 PolarHBondContact N-O 2.87Å; L14-L75 PolarHBondContact O-N 3.06Å; L14-L75 VanDerWaalsContact O-N 3.09Å; W30-L75 HydrophobicContact CB-CD2 4.07Å; W30-L75 HydrophobicContact CD2-CB 3.45Å; W30-L75 VanDerWaalsContact CD2-CB 3.45Å; W30-L75 HydrophobicContact CD2-CD2 3.84Å; W30-L75 HydrophobicContact CD2-CG 4.21Å; W30-L75 VanDerWaalsContact CE2-CB 3.49Å; W30-L75 HydrophobicContact CE3-CB 3.64Å; W30-L75 HydrophobicContact CE3-CD2 3.6Å; W30-L75 HydrophobicContact CE3-CG 4.26Å; W30-L75 HydrophobicContact CG-CB 4.01Å; W30-L75 HydrophobicContact CG-CD2 4.05Å; W30-L75 HydrophobicContact CG-CG 4.45Å; W30-L75 HydrophobicContact CH2-CB 3.88Å; W30-L75 HydrophobicContact CZ2-CB 3.72Å; W30-L75 HydrophobicContact CZ3-CB 3.84Å; W30-L75 HydrophobicContact CZ3-CD2 4.3Å; I42-L75 HydrophobicContact CD1-CD2 3.8Å; I42-L75 HydrophobicContact CG2-CD1 4.26Å; A62-L75 HydrophobicContact CB-CD1 3.84Å; I64-L75 HydrophobicContact CG1-CD1 3.84Å; L75-L77 HydrophobicContact CD1-CD2 4.11Å; L75-L77 HydrophobicContact CD1-CG 4.33Å; L75-L77 HydrophobicContact CD2-CD1 4.24Å; L75-L77 HydrophobicContact CD2-CD2 4.4Å; L75-L77 HydrophobicContact CD2-CG 4.2Å; L75-L77 HydrophobicContact CG-CD2 4.37Å; L75-L77 HydrophobicContact CG-CG 4.1Å; L75-Y88 HydrophobicContact CD2-CD1 4.3Å
76	Q	97.9	Very high	95.7	Very high	79 Å²	79	48.5 Å²	48.5	37%	0.369	30%	0.296	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.4	125.9	169.5	-178	172.5	-7.6	0	0	109.2	V12 A62 T63	V12-Q76 CarbonylContact O-C 3.4Å; V12-Q76 VanDerWaalsContact O-CA 3.3Å; V12-Q76 WeakPolarHBondContact O-CA 3.32Å; A62-Q76 CarbonylContact C-O 3.5Å; A62-Q76 WeakPolarHBondContact CA-O 3.25Å; T63-Q76 PolarHBondContact N-O 2.81Å; T63-Q76 PolarHBondContact O-N 2.79Å
77	L	96.9	Very high	95.5	Very high	1 Å²	1	51.9 Å²	51.9	1%	0.005	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	133	173.4	-65.3	168.5	0	0	0	108.8	S11 V12 K61 A62 L75 L80 Y88	S11-L77 CarbonylContact C-O 3.59Å; S11-L77 WeakPolarHBondContact CA-O 3.49Å; S11-L77 WeakPolarHBondContact CB-O 3.44Å; V12-L77 HydrophobicContact CG1-CB 4.11Å; V12-L77 HydrophobicContact CG1-CD1 4.49Å; V12-L77 PolarHBondContact N-O 3.02Å; V12-L77 PolarHBondContact O-N 2.79Å; K61-L77 WeakPolarHBondContact O-CA 3.47Å; A62-L77 HydrophobicContact CB-CD2 3.84Å; L75-L77 HydrophobicContact CD1-CD2 4.11Å; L75-L77 HydrophobicContact CD1-CG 4.33Å; L75-L77 HydrophobicContact CD2-CD1 4.24Å; L75-L77 HydrophobicContact CD2-CD2 4.4Å; L75-L77 HydrophobicContact CD2-CG 4.2Å; L75-L77 HydrophobicContact CG-CD2 4.37Å; L75-L77 HydrophobicContact CG-CG 4.1Å; L77-L80 HydrophobicContact CB-CD2 3.71Å; L77-L80 HydrophobicContact CD1-CD2 4.33Å; L77-Y88 HydrophobicContact CD1-CD1 4.14Å; L77-Y88 HydrophobicContact CD1-CE1 3.46Å; L77-Y88 VanDerWaalsContact CD1-CE1 3.46Å
78	S	95.9	Very high	95.4	Very high	34 Å²	34	53 Å²	53	24%	0.238	31%	0.314	C	S	.	.			trans	-112.6	160	-178.6	-49.7	0	0	0	0	111.2	S11 K61 L80	S11-S78 WeakPolarHBondContact OG-CA 3.26Å; K61-S78 VanDerWaalsContact CE-O 3.29Å; K61-S78 WeakPolarHBondContact CE-O 3.29Å; K61-S78 VanDerWaalsContact CG-O 3.28Å; K61-S78 WeakPolarHBondContact CG-O 3.23Å; K61-S78 PolarHBondContact O-N 3.16Å; S78-L80 VanDerWaalsContact C-N 3.34Å; S78-L80 PolarHBondContact O-N 2.92Å
79	S	94.5	Very high	95.3	Very high	85 Å²	85	53.3 Å²	53.3	59%	0.594	32%	0.315	S	S	*	.	S	Bend	trans	51.3	51.2	174.7	-57.1	0	0	0	0	112.9	A10	A10-S79 PolarHBondContact O-N 2.89Å
80	L	94.5	Very high	95.2	Very high	12 Å²	12	50.4 Å²	50.4	6%	0.063	29%	0.292	C	S	.	.			trans	-63.9	141.4	-173.4	-68.3	170.3	0	0	0	112.5	V6 G9 A10 V12 L77 S78 D84	V6-L80 HydrophobicContact CG2-CD1 3.47Å; V6-L80 VanDerWaalsContact CG2-CD1 3.47Å; G9-L80 PolarHBondContact N-O 3.31Å; A10-L80 WeakPolarHBondContact O-CB 3.43Å; A10-L80 WeakPolarHBondContact O-CG 3.32Å; A10-L80 PolarHBondContact O-N 2.82Å; V12-L80 HydrophobicContact CB-CD1 4Å; V12-L80 HydrophobicContact CG1-CD1 3.79Å; L77-L80 HydrophobicContact CB-CD2 3.71Å; L77-L80 HydrophobicContact CD1-CD2 4.33Å; S78-L80 VanDerWaalsContact C-N 3.34Å; S78-L80 PolarHBondContact O-N 2.92Å; L80-D84 WeakPolarHBondContact CA-OD2 3.43Å; L80-D84 HydrophobicContact CD2-CB 3.71Å
81	T	93.4	Very high	95.1	Very high	66 Å²	66	50.6 Å²	50.6	41%	0.405	29%	0.29	S	S	.	.			trans	-123.5	173	175.2	70.4	0	0	0	0	109.9	E83 D84	T81-E83 PolarHBondContact O-N 2.81Å; T81-D84 PolarHBondContact N-OD2 2.62Å; T81-D84 WeakPolarHBondContact O-CB 3.49Å; T81-D84 PolarHBondContact O-N 2.75Å; T81-D84 PolarHBondContact OG1-OD2 3.5Å
82	S	91.1	Very high	95	Very high	100 Å²	100	51.6 Å²	51.6	70%	0.699	30%	0.297	S	S	*	.	G	3₁₀ helix	trans	-57	-30.6	176.8	50.6	0	0	0	0	112.8	D84 T85	S82-D84 PolarHBondContact O-N 3.1Å; S82-T85 WeakPolarHBondContact O-CB 3.46Å; S82-T85 PolarHBondContact O-N 2.78Å; S82-T85 VanDerWaalsContact O-N 3.08Å; S82-T85 PolarHBondContact O-OG1 2.92Å
83	E	89.7	Confident	94.8	Very high	108 Å²	108	54.4 Å²	54.4	51%	0.505	31%	0.313	S	S	.	.	G	3₁₀ helix	trans	-66.6	-15.5	177.7	-61.2	-172.4	179.7	0	0	114.3	K32 T81 T85	K32-E83 PolarHBondContact NZ-O 3.25Å; T81-E83 PolarHBondContact O-N 2.81Å; E83-T85 VanDerWaalsContact C-N 3.3Å
84	D	92.3	Very high	94.6	Very high	13 Å²	13	58.1 Å²	58.1	7%	0.07	33%	0.333	C	S	.	.	G	3₁₀ helix	trans	-89.3	3.2	175.1	-52.3	-51.1	0	0	0	112.3	K32 K61 L80 T81 S82 A86 Y88	K32-D84 IonicContact NZ-OD1 3.14Å; K61-D84 WeakPolarHBondContact CE-OD1 3.39Å; K61-D84 WeakPolarHBondContact CE-OD2 3.47Å; K61-D84 IonicContact NZ-OD1 2.83Å; K61-D84 PolarHBondContact NZ-OD1 3.38Å; K61-D84 IonicContact NZ-OD2 2.54Å; K61-D84 PolarHBondContact NZ-OD2 3.1Å; L80-D84 WeakPolarHBondContact CA-OD2 3.43Å; L80-D84 HydrophobicContact CD2-CB 3.71Å; T81-D84 PolarHBondContact N-OD2 2.62Å; T81-D84 WeakPolarHBondContact O-CB 3.49Å; T81-D84 PolarHBondContact O-N 2.75Å; T81-D84 PolarHBondContact OG1-OD2 3.5Å; S82-D84 PolarHBondContact O-N 3.1Å; D84-A86 PolarHBondContact O-N 3.49Å; D84-A86 VanDerWaalsContact O-N 3.13Å; D84-Y88 VanDerWaalsContact C-OH 3.27Å; D84-Y88 WeakPolarHBondContact CA-OH 3.33Å; D84-Y88 WeakPolarHBondContact CB-OH 3.39Å; D84-Y88 VanDerWaalsContact O-CE2 3.23Å; D84-Y88 WeakPolarHBondContact O-CE2 3.35Å; D84-Y88 VanDerWaalsContact O-CZ 3.28Å; D84-Y88 PolarHBondContact O-OH 2.63Å
85	T	93.1	Very high	94.3	Very high	107 Å²	107	58.4 Å²	58.4	66%	0.656	34%	0.342	S	S	*	.			trans	-72.7	108.7	171.2	-52.2	0	0	0	0	108.6	S82 E83	S82-T85 WeakPolarHBondContact O-CB 3.46Å; S82-T85 PolarHBondContact O-N 2.78Å; S82-T85 VanDerWaalsContact O-N 3.08Å; S82-T85 PolarHBondContact O-OG1 2.92Å; E83-T85 VanDerWaalsContact C-N 3.3Å
86	A	94.2	Very high	94	Very high	30 Å²	30	62.9 Å²	62.9	25%	0.248	37%	0.369	C	S	.	.	S	Bend	trans	-162.1	168.3	-174.1	0	0	0	0	0	110.9	K32 Q33 R34 D84 Y88	K32-A86 HydrophobicContact CB-CB 3.97Å; K32-A86 HydrophobicContact CD-CB 4.36Å; Q33-A86 WeakPolarHBondContact O-CA 3.32Å; Q33-A86 WeakPolarHBondContact O-CB 3.5Å; R34-A86 HydrophobicContact CG-CB 3.85Å; D84-A86 PolarHBondContact O-N 3.49Å; D84-A86 VanDerWaalsContact O-N 3.13Å; A86-Y88 HydrophobicContact CB-CD2 4.29Å; A86-Y88 HydrophobicContact CB-CE2 3.77Å; A86-Y88 VanDerWaalsContact O-CD2 3.3Å; A86-Y88 WeakPolarHBondContact O-CD2 3.48Å; A86-Y88 WeakPolarHBondContact O-CE2 2.94Å
87	V	94.8	Very high	93.7	Very high	104 Å²	104	61.6 Å²	61.6	63%	0.63	37%	0.369	S	S	*	.	B	Isolated β-bridge	trans	-80.5	140	158.1	179.2	0	0	0	0	107.6	K32 Q33	K32-V87 CarbonylContact C-O 3.58Å; K32-V87 VanDerWaalsContact CA-O 3.27Å; K32-V87 WeakPolarHBondContact CA-O 3.26Å; Q33-V87 HydrophobicContact CB-CB 4.48Å; Q33-V87 PolarHBondContact N-O 3.32Å; Q33-V87 PolarHBondContact O-N 2.54Å
88	Y	94.3	Very high	93.4	Very high	79 Å²	79	67.1 Å²	67.1	31%	0.31	40%	0.402	S	S	.	.			trans	-124	0	-177.3	-71.7	-91.4	0	0	0	110.8	L14 V31 K32 I42 L75 L77 D84 A86	L14-Y88 HydrophobicContact CD1-CD1 4.27Å; L14-Y88 HydrophobicContact CD1-CD2 4.31Å; L14-Y88 HydrophobicContact CD1-CG 3.8Å; V31-Y88 WeakPolarHBondContact O-CA 3.43Å; V31-Y88 VanDerWaalsContact O-OXT 3.06Å; K32-Y88 HydrophobicContact CB-CD1 3.69Å; K32-Y88 HydrophobicContact CB-CE1 3.5Å; K32-Y88 VanDerWaalsContact CB-CE1 3.5Å; K32-Y88 HydrophobicContact CB-CG 4.39Å; K32-Y88 HydrophobicContact CD-CE1 4.06Å; K32-Y88 HydrophobicContact CG-CE1 4.38Å; I42-Y88 HydrophobicContact CD1-CD1 3.78Å; I42-Y88 HydrophobicContact CD1-CE1 3.82Å; L75-Y88 HydrophobicContact CD2-CD1 4.3Å; L77-Y88 HydrophobicContact CD1-CD1 4.14Å; L77-Y88 HydrophobicContact CD1-CE1 3.46Å; L77-Y88 VanDerWaalsContact CD1-CE1 3.46Å; D84-Y88 VanDerWaalsContact C-OH 3.27Å; D84-Y88 WeakPolarHBondContact CA-OH 3.33Å; D84-Y88 WeakPolarHBondContact CB-OH 3.39Å; D84-Y88 VanDerWaalsContact O-CE2 3.23Å; D84-Y88 WeakPolarHBondContact O-CE2 3.35Å; D84-Y88 VanDerWaalsContact O-CZ 3.28Å; D84-Y88 PolarHBondContact O-OH 2.63Å; A86-Y88 HydrophobicContact CB-CD2 4.29Å; A86-Y88 HydrophobicContact CB-CE2 3.77Å; A86-Y88 VanDerWaalsContact O-CD2 3.3Å; A86-Y88 WeakPolarHBondContact O-CD2 3.48Å; A86-Y88 WeakPolarHBondContact O-CE2 2.94Å

Retrieved 88 of 88 residues in 19.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).