X5J4W1_MOUSE Loading...

IgA heavy chain VDJ region

AlphaFold DB , UniProt , Accession X5J4W1, Species MOUSE (Mus musculus, Mouse), Gene n/a, Length 74 aa.

						>X5J4W1_MOUSE|X5J4W1
TELVKPGASVKLSCKASGYTFTSYWMHWVKQRPRQGLEWIGNINPSNGGTNYNEKFKSKPTLTVDKSSSTAYMQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	T	61	Low	83.7	Confident	192 Å²	192	120.2 Å²	120.2	100%	1.178	71%	0.709	S	S	*	*				0	123.3	0	32.8	0	0	0	0	107.5
2	E	74.1	Confident	84.6	Confident	158 Å²	158	117 Å²	117	74%	0.738	69%	0.686	S	S	*	*			trans	-91.1	122.1	176.3	-165.9	175.6	171.8	0	0	108.5	V4	E2-V4 HydrophobicContact CG-CG1 4.09Å
3	L	82.4	Confident	85.5	Confident	174 Å²	174	114.5 Å²	114.5	91%	0.911	68%	0.678	S	S	*	*			trans	-95.7	108.8	177.7	-144.7	98.1	0	0	0	107.7
4	V	86.3	Confident	86.3	Confident	60 Å²	60	109.6 Å²	109.6	36%	0.364	65%	0.653	S	S	.	*			trans	-104.3	152.8	179.5	-63.3	0	0	0	0	111.5	E2 A8 V10	E2-V4 HydrophobicContact CG-CG1 4.09Å; V4-A8 HydrophobicContact CB-CB 4.16Å; V4-V10 HydrophobicContact CB-CG2 4.14Å; V4-V10 HydrophobicContact CG1-CG2 3.77Å; V4-V10 HydrophobicContact CG2-CG2 3.46Å; V4-V10 VanDerWaalsContact CG2-CG2 3.46Å
5	K	90.8	Very high	87	Confident	176 Å²	176	112.5 Å²	112.5	77%	0.765	65%	0.654	S	S	*	*			trans	-65.8	146.9	172.4	-66.8	-179.8	-178	179.4	0	109.8	G7 A8	K5-G7 PolarHBondContact O-N 3.15Å; K5-A8 WeakPolarHBondContact O-CB 3.35Å; K5-A8 PolarHBondContact O-N 2.95Å; K5-A8 VanDerWaalsContact O-N 3.1Å
6	P	87.1	Confident	87.5	Confident	138 Å²	138	106.1 Å²	106.1	90%	0.896	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.8	131.2	171	-25	34.1	0	0	0	111.1
7	G	84.6	Confident	88	Confident	86 Å²	86	105.9 Å²	105.9	89%	0.887	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	89.3	-8.8	-179.5	0	0	0	0	0	115.6	K5	K5-G7 PolarHBondContact O-N 3.15Å
8	A	87.3	Confident	88.4	Confident	53 Å²	53	105.1 Å²	105.1	44%	0.438	64%	0.641	S	S	.	*			trans	-74.9	140.2	169.6	0	0	0	0	0	111	V4 K5	V4-A8 HydrophobicContact CB-CB 4.16Å; K5-A8 WeakPolarHBondContact O-CB 3.35Å; K5-A8 PolarHBondContact O-N 2.95Å; K5-A8 VanDerWaalsContact O-N 3.1Å
9	S	85.9	Confident	88.7	Confident	114 Å²	114	105.2 Å²	105.2	80%	0.797	63%	0.629	S	S	*	*			trans	-76.1	144	171.7	-57.3	0	0	0	0	110.6
10	V	89.1	Confident	89	Confident	50 Å²	50	104.5 Å²	104.5	30%	0.303	63%	0.626	S	S	.	*			trans	-125.3	134.8	178.4	-176.4	0	0	0	0	108.5	V4 L12	V4-V10 HydrophobicContact CB-CG2 4.14Å; V4-V10 HydrophobicContact CG1-CG2 3.77Å; V4-V10 HydrophobicContact CG2-CG2 3.46Å; V4-V10 VanDerWaalsContact CG2-CG2 3.46Å; V10-L12 HydrophobicContact CG1-CD2 4.25Å; V10-L12 HydrophobicContact CG1-CG 4.46Å
11	K	92.4	Very high	89.4	Confident	121 Å²	121	99.9 Å²	99.9	53%	0.526	60%	0.598	S	S	.	*			trans	-103.8	115.6	172.2	-175	174.6	177.9	177.8	0	109.8	Y72 M73 Q74	K11-Y72 HydrophobicContact CD-CD1 4.39Å; K11-Y72 HydrophobicContact CG-CD1 4.36Å; K11-M73 CarbonylContact C-O 3.6Å; K11-M73 WeakPolarHBondContact CA-O 3.38Å; K11-Q74 HydrophobicContact CG-CB 4.46Å
12	L	94.4	Very high	91.1	Very high	82 Å²	82	93.4 Å²	93.4	43%	0.429	56%	0.558	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.8	144.5	172.7	-62.9	173.1	0	0	0	109.9	V10 W28 Y72 M73	V10-L12 HydrophobicContact CG1-CD2 4.25Å; V10-L12 HydrophobicContact CG1-CG 4.46Å; L12-W28 HydrophobicContact CB-CH2 3.82Å; L12-W28 HydrophobicContact CB-CZ3 3.62Å; L12-W28 HydrophobicContact CD1-CZ3 4.2Å; L12-Y72 WeakPolarHBondContact O-CA 3.39Å; L12-M73 HydrophobicContact CD1-CE 3.55Å; L12-M73 PolarHBondContact N-O 3.2Å; L12-M73 PolarHBondContact O-N 3.43Å
13	S	96.4	Very high	92.1	Very high	84 Å²	84	89.4 Å²	89.4	59%	0.587	55%	0.548	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-126.3	146.9	176.3	63.5	0	0	0	0	111.2	A71 Y72	S13-A71 CarbonylContact C-O 3.43Å; S13-A71 WeakPolarHBondContact CA-O 3.21Å; S13-Y72 VanDerWaalsContact CB-CE1 3.5Å
14	C	96.1	Very high	92.7	Very high	47 Å²	47	88.3 Å²	88.3	32%	0.318	53%	0.532	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.4	113.1	174.4	-178.1	0	0	0	0	108.9	M26 W28 T70 A71	C14-M26 HydrophobicContact CB-CE 4.44Å; C14-M26 HydrophobicContact CB-SD 4.43Å; C14-W28 HydrophobicContact CB-CH2 4.11Å; C14-W28 HydrophobicContact CB-CZ2 4.28Å; C14-T70 CarbonylContact O-C 3.55Å; C14-T70 WeakPolarHBondContact O-CA 3.22Å; C14-A71 PolarHBondContact N-O 3.03Å; C14-A71 PolarHBondContact O-N 2.81Å
15	K	97	Very high	93.2	Very high	153 Å²	153	91 Å²	91	67%	0.665	54%	0.536	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.2	125.4	179.1	-175.6	174	-178.9	177.4	0	110.2	S68 S69 T70	K15-S68 WeakPolarHBondContact CE-O 3.48Å; K15-S69 WeakPolarHBondContact CA-O 3.47Å; K15-T70 HydrophobicContact CB-CG2 4.43Å
16	A	95.8	Very high	93.5	Very high	10 Å²	10	83.8 Å²	83.8	8%	0.083	51%	0.505	C	S	.	.			trans	-78.1	148.6	175	0	0	0	0	0	111.4	Y19 F21 S69	A16-Y19 HydrophobicContact CB-CE1 4.08Å; A16-Y19 HydrophobicContact CB-CE2 3.83Å; A16-Y19 VanDerWaalsContact CB-CZ 3.49Å; A16-Y19 WeakPolarHBondContact CB-OH 3.34Å; A16-F21 HydrophobicContact CB-CB 4.15Å; A16-F21 HydrophobicContact CB-CD2 3.49Å; A16-F21 VanDerWaalsContact CB-CD2 3.49Å; A16-F21 HydrophobicContact CB-CE2 4.26Å; A16-F21 HydrophobicContact CB-CG 4.17Å; A16-S69 PolarHBondContact N-O 3.48Å
17	S	95.9	Very high	93.9	Very high	102 Å²	102	81.9 Å²	81.9	71%	0.713	48%	0.484	S	S	*	.			trans	-147.4	147.5	173.4	67.2	0	0	0	0	110.2	Y19	S17-Y19 VanDerWaalsContact C-N 3.35Å; S17-Y19 WeakPolarHBondContact O-CD1 3.37Å; S17-Y19 WeakPolarHBondContact O-CE1 3.19Å; S17-Y19 PolarHBondContact O-N 2.8Å
18	G	95.4	Very high	94.5	Very high	91 Å²	91	79.1 Å²	79.1	94%	0.938	45%	0.447	S	S	*	.	S	Bend	trans	81.6	4.8	176.9	0	0	0	0	0	115.9
19	Y	93.2	Very high	94.9	Very high	108 Å²	108	80.2 Å²	80.2	42%	0.424	45%	0.448	S	S	.	.	S	Bend	trans	-154.6	164.5	174.9	60.2	-88.6	0	0	0	111.6	A16 S17 F21 Y24	A16-Y19 HydrophobicContact CB-CE1 4.08Å; A16-Y19 HydrophobicContact CB-CE2 3.83Å; A16-Y19 VanDerWaalsContact CB-CZ 3.49Å; A16-Y19 WeakPolarHBondContact CB-OH 3.34Å; S17-Y19 VanDerWaalsContact C-N 3.35Å; S17-Y19 WeakPolarHBondContact O-CD1 3.37Å; S17-Y19 WeakPolarHBondContact O-CE1 3.19Å; S17-Y19 PolarHBondContact O-N 2.8Å; Y19-F21 PolarHBondContact O-N 2.93Å; Y19-F21 VanDerWaalsContact O-N 3.1Å; Y19-Y24 AromaticContact CD2-CD2 3.62Å; Y19-Y24 HydrophobicContact CD2-CD2 3.62Å; Y19-Y24 HydrophobicContact CD2-CE2 4.09Å; Y19-Y24 AromaticContact CE2-CD2 3.95Å; Y19-Y24 HydrophobicContact CE2-CD2 3.95Å; Y19-Y24 HydrophobicContact CG-CD2 4.38Å; Y19-Y24 HydrophobicContact CG-CE2 4.46Å
20	T	95.8	Very high	95.3	Very high	90 Å²	90	78.8 Å²	78.8	55%	0.552	43%	0.428	S	S	*	.			trans	-67.4	106.4	172.5	-54.2	0	0	0	0	109.4	T22 S23	T20-T22 WeakPolarHBondContact CG2-OG1 3.36Å; T20-T22 PolarHBondContact O-N 3.1Å; T20-S23 WeakPolarHBondContact CB-OG 3.46Å; T20-S23 VanDerWaalsContact O-CB 3.3Å; T20-S23 WeakPolarHBondContact O-CB 3.46Å; T20-S23 PolarHBondContact O-N 3.3Å; T20-S23 PolarHBondContact O-OG 3.5Å
21	F	96.1	Very high	95.5	Very high	9 Å²	9	83 Å²	83	4%	0.039	44%	0.444	C	S	.	.	G	3₁₀ helix	trans	-52.6	-34.1	-175.2	174.9	-125	0	0	0	114.1	A16 Y19 S23 M26 P45 V64 S69 A71	A16-F21 HydrophobicContact CB-CB 4.15Å; A16-F21 HydrophobicContact CB-CD2 3.49Å; A16-F21 VanDerWaalsContact CB-CD2 3.49Å; A16-F21 HydrophobicContact CB-CE2 4.26Å; A16-F21 HydrophobicContact CB-CG 4.17Å; Y19-F21 PolarHBondContact O-N 2.93Å; Y19-F21 VanDerWaalsContact O-N 3.1Å; F21-S23 VanDerWaalsContact C-N 3.26Å; F21-S23 PolarHBondContact O-N 2.91Å; F21-M26 HydrophobicContact CE2-CE 4.16Å; F21-P45 HydrophobicContact CD1-CB 3.88Å; F21-P45 HydrophobicContact CD2-CB 4.41Å; F21-P45 HydrophobicContact CD2-CG 4.31Å; F21-P45 HydrophobicContact CE1-CB 3.58Å; F21-P45 HydrophobicContact CE1-CG 4.24Å; F21-P45 HydrophobicContact CE2-CB 4.13Å; F21-P45 HydrophobicContact CE2-CG 3.89Å; F21-P45 HydrophobicContact CG-CB 4.32Å; F21-P45 HydrophobicContact CZ-CB 3.72Å; F21-P45 HydrophobicContact CZ-CG 3.86Å; F21-V64 HydrophobicContact CE1-CB 4.2Å; F21-V64 HydrophobicContact CE1-CG1 4.31Å; F21-V64 HydrophobicContact CZ-CB 4.34Å; F21-V64 HydrophobicContact CZ-CG1 4Å; F21-S69 VanDerWaalsContact CD1-CA 3.49Å; F21-A71 HydrophobicContact CE2-CB 4.44Å; F21-A71 HydrophobicContact CZ-CB 4.09Å
22	T	96.9	Very high	95.5	Very high	55 Å²	55	82 Å²	82	34%	0.337	44%	0.437	S	S	.	.	G	3₁₀ helix	trans	-75.8	-8.4	-179.9	53	0	0	0	0	114.4	T20 K66	T20-T22 WeakPolarHBondContact CG2-OG1 3.36Å; T20-T22 PolarHBondContact O-N 3.1Å; T22-K66 HydrophobicContact CG2-CG 4.5Å
23	S	95.9	Very high	95.5	Very high	75 Å²	75	84 Å²	84	52%	0.524	46%	0.455	S	S	.	.	G	3₁₀ helix	trans	-82.7	-15.1	-178.2	-62.4	0	0	0	0	114.1	T20 F21	T20-S23 WeakPolarHBondContact CB-OG 3.46Å; T20-S23 VanDerWaalsContact O-CB 3.3Å; T20-S23 WeakPolarHBondContact O-CB 3.46Å; T20-S23 PolarHBondContact O-N 3.3Å; T20-S23 PolarHBondContact O-OG 3.5Å; F21-S23 VanDerWaalsContact C-N 3.26Å; F21-S23 PolarHBondContact O-N 2.91Å
24	Y	94.3	Very high	95.3	Very high	150 Å²	150	92.5 Å²	92.5	59%	0.588	47%	0.474	S	S	*	.	S	Bend	trans	-132.9	147.7	-174.2	-62.1	-78.6	0	0	0	112.1	Y19 P45	Y19-Y24 AromaticContact CD2-CD2 3.62Å; Y19-Y24 HydrophobicContact CD2-CD2 3.62Å; Y19-Y24 HydrophobicContact CD2-CE2 4.09Å; Y19-Y24 AromaticContact CE2-CD2 3.95Å; Y19-Y24 HydrophobicContact CE2-CD2 3.95Å; Y19-Y24 HydrophobicContact CG-CD2 4.38Å; Y19-Y24 HydrophobicContact CG-CE2 4.46Å; Y24-P45 WeakPolarHBondContact O-CD 3.12Å; Y24-P45 VanDerWaalsContact O-CG 3.28Å; Y24-P45 WeakPolarHBondContact O-CG 3.17Å
25	W	96.8	Very high	95.1	Very high	117 Å²	117	94.6 Å²	94.6	44%	0.443	48%	0.479	S	S	.	.			trans	-72.3	139.9	173.1	-68.7	64.8	0	0	0	110.3	N42 N44 N51	W25-N42 HydrophobicContact CE3-CB 4.09Å; W25-N42 VanDerWaalsContact CE3-CG 3.44Å; W25-N42 WeakPolarHBondContact CZ3-OD1 2.8Å; W25-N44 HydrophobicContact CD2-CB 3.92Å; W25-N44 HydrophobicContact CE3-CB 3.93Å; W25-N44 HydrophobicContact CH2-CB 4.06Å; W25-N44 HydrophobicContact CZ2-CB 4.02Å; W25-N44 HydrophobicContact CZ3-CB 3.97Å; W25-N51 VanDerWaalsContact CZ3-ND2 3.27Å; W25-N51 WeakPolarHBondContact CZ3-ND2 3.46Å
26	M	96.8	Very high	95	Very high	24 Å²	24	90 Å²	90	12%	0.118	48%	0.475	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	122.2	172	-175.9	59.7	66.6	0	0	109.5	C14 F21 N42 I43 A71	C14-M26 HydrophobicContact CB-CE 4.44Å; C14-M26 HydrophobicContact CB-SD 4.43Å; F21-M26 HydrophobicContact CE2-CE 4.16Å; M26-N42 CarbonylContact O-C 3.54Å; M26-N42 WeakPolarHBondContact O-CA 3.03Å; M26-N42 WeakPolarHBondContact O-CB 3.35Å; M26-I43 HydrophobicContact CB-CG2 3.94Å; M26-I43 PolarHBondContact N-O 3.32Å; M26-I43 PolarHBondContact O-N 2.87Å; M26-A71 HydrophobicContact CB-CB 4.16Å; M26-A71 HydrophobicContact CG-CB 3.68Å
27	H	96.9	Very high	94.9	Very high	99 Å²	99	95.1 Å²	95.1	46%	0.458	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	137.2	179.1	-70.5	-108.8	0	0	0	111	W39	H27-W39 AromaticContact ND1-CD1 3.98Å; H27-W39 AromaticContact ND1-NE1 3.32Å; H27-W39 PolarHBondContact ND1-NE1 2.92Å
28	W	96.8	Very high	94.9	Very high	27 Å²	27	92.2 Å²	92.2	10%	0.102	48%	0.476	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	129.9	172.4	-66.8	90.9	0	0	0	109.7	L12 C14 I40 G41 L62 A71 M73	L12-W28 HydrophobicContact CB-CH2 3.82Å; L12-W28 HydrophobicContact CB-CZ3 3.62Å; L12-W28 HydrophobicContact CD1-CZ3 4.2Å; C14-W28 HydrophobicContact CB-CH2 4.11Å; C14-W28 HydrophobicContact CB-CZ2 4.28Å; W28-I40 HydrophobicContact CB-CB 4.21Å; W28-I40 HydrophobicContact CB-CD1 4.34Å; W28-I40 WeakPolarHBondContact O-CB 3.32Å; W28-I40 PolarHBondContact O-N 3.17Å; W28-G41 PolarHBondContact N-O 2.99Å; W28-G41 PolarHBondContact O-N 2.88Å; W28-L62 HydrophobicContact CG-CD2 4.07Å; W28-A71 HydrophobicContact CZ2-CB 4.34Å; W28-M73 HydrophobicContact CB-CE 4.45Å; W28-M73 HydrophobicContact CB-SD 3.87Å; W28-M73 HydrophobicContact CD2-CB 3.74Å; W28-M73 HydrophobicContact CD2-CE 4.17Å; W28-M73 HydrophobicContact CD2-CG 4.48Å; W28-M73 HydrophobicContact CD2-SD 4.03Å; W28-M73 HydrophobicContact CE3-CB 3.93Å; W28-M73 HydrophobicContact CE3-CE 3.65Å; W28-M73 HydrophobicContact CE3-SD 4.14Å; W28-M73 HydrophobicContact CG-CB 4.32Å; W28-M73 HydrophobicContact CG-SD 3.93Å; W28-M73 HydrophobicContact CH2-CB 4.05Å; W28-M73 HydrophobicContact CZ2-CB 3.87Å; W28-M73 HydrophobicContact CZ3-CB 4.08Å; W28-M73 HydrophobicContact CZ3-CE 4.26Å
29	V	95.8	Very high	94.9	Very high	77 Å²	77	91.9 Å²	91.9	47%	0.467	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	145.7	-179.8	-62.2	0	0	0	0	109.8	L37 E38	V29-L37 HydrophobicContact CG2-CD2 4.45Å; V29-E38 CarbonylContact C-O 3.55Å; V29-E38 WeakPolarHBondContact CA-O 3.49Å
30	K	93.1	Very high	95.1	Very high	83 Å²	83	87.3 Å²	87.3	36%	0.361	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	132.7	172.3	-179.7	178.3	-178.7	179.9	0	108.8	E38 I40	K30-E38 HydrophobicContact CB-CB 4.4Å; K30-E38 PolarHBondContact N-O 3.13Å; K30-E38 PolarHBondContact O-N 3.08Å; K30-I40 HydrophobicContact CB-CD1 4.02Å; K30-I40 HydrophobicContact CB-CG1 4.19Å
31	Q	94	Very high	95.1	Very high	138 Å²	138	83 Å²	83	65%	0.645	40%	0.402	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.8	135	169.8	-164.3	177	12.7	0	0	109.2	L37	Q31-L37 HydrophobicContact CB-CD2 3.86Å; Q31-L37 HydrophobicContact CG-CD2 3.95Å
32	R	92.3	Very high	95.2	Very high	101 Å²	101	83.4 Å²	83.4	38%	0.381	41%	0.405	S	S	.	.			trans	-110	155.2	170.6	-49.6	-171.4	-148.1	-176.8	1.3	109.4	R34 Q35 E38	R32-R34 PolarHBondContact O-N 2.83Å; R32-Q35 HydrophobicContact CB-CB 4.03Å; R32-Q35 HydrophobicContact CB-CG 4.11Å; R32-Q35 PolarHBondContact O-N 2.84Å; R32-E38 IonicContact CZ-OE1 3.36Å; R32-E38 IonicContact NE-OE1 3.03Å; R32-E38 PolarHBondContact NE-OE1 3.48Å; R32-E38 IonicContact NH2-OE1 2.93Å; R32-E38 PolarHBondContact NH2-OE1 2.91Å; R32-E38 IonicContact NH2-OE2 3.82Å
33	P	93.9	Very high	95.2	Very high	124 Å²	124	80.9 Å²	80.9	81%	0.805	39%	0.389	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.9	128.5	174.3	-25.6	34.4	0	0	0	110.4	Q35	P33-Q35 PolarHBondContact O-N 3.01Å; P33-Q35 VanDerWaalsContact O-N 3.15Å
34	R	93.3	Very high	95.3	Very high	263 Å²	263	78.2 Å²	78.2	99%	0.992	37%	0.369	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.1	10.4	-179.1	-52.6	176.7	132.8	147.4	-2.6	115.9	R32	R32-R34 PolarHBondContact O-N 2.83Å
35	Q	92.4	Very high	95.5	Very high	91 Å²	91	71.1 Å²	71.1	43%	0.425	34%	0.341	S	S	.	.			trans	-109.6	154.9	172.2	-62.6	-175.2	-3.1	0	0	110.4	R32 P33	R32-Q35 HydrophobicContact CB-CB 4.03Å; R32-Q35 HydrophobicContact CB-CG 4.11Å; R32-Q35 PolarHBondContact O-N 2.84Å; P33-Q35 PolarHBondContact O-N 3.01Å; P33-Q35 VanDerWaalsContact O-N 3.15Å
36	G	93.4	Very high	95.5	Very high	56 Å²	56	68 Å²	68	58%	0.577	34%	0.337	S	S	*	.			trans	-67	176.7	172.1	0	0	0	0	0	112.6	E38	G36-E38 PolarHBondContact O-N 2.8Å
37	L	95.2	Very high	95.4	Very high	117 Å²	117	72.2 Å²	72.2	61%	0.613	36%	0.361	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.7	123.6	172.3	-61.4	176.4	0	0	0	109.6	V29 Q31	V29-L37 HydrophobicContact CG2-CD2 4.45Å; Q31-L37 HydrophobicContact CB-CD2 3.86Å; Q31-L37 HydrophobicContact CG-CD2 3.95Å
38	E	95.4	Very high	95.4	Very high	42 Å²	42	69.1 Å²	69.1	20%	0.196	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	115.4	170.3	-59.7	-173.2	-105.2	0	0	108.6	V29 K30 R32 G36 I40 F56	V29-E38 CarbonylContact C-O 3.55Å; V29-E38 WeakPolarHBondContact CA-O 3.49Å; K30-E38 HydrophobicContact CB-CB 4.4Å; K30-E38 PolarHBondContact N-O 3.13Å; K30-E38 PolarHBondContact O-N 3.08Å; R32-E38 IonicContact CZ-OE1 3.36Å; R32-E38 IonicContact NE-OE1 3.03Å; R32-E38 PolarHBondContact NE-OE1 3.48Å; R32-E38 IonicContact NH2-OE1 2.93Å; R32-E38 PolarHBondContact NH2-OE1 2.91Å; R32-E38 IonicContact NH2-OE2 3.82Å; G36-E38 PolarHBondContact O-N 2.8Å; E38-I40 PolarHBondContact O-N 2.94Å; E38-F56 HydrophobicContact CB-CE2 4.43Å; E38-F56 HydrophobicContact CB-CZ 4.35Å
39	W	95.7	Very high	95.4	Very high	84 Å²	84	69.2 Å²	69.2	32%	0.318	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72	128.6	175.3	-179.3	66.3	0	0	0	111	H27 G41 N42 N51 N53	H27-W39 AromaticContact ND1-CD1 3.98Å; H27-W39 AromaticContact ND1-NE1 3.32Å; H27-W39 PolarHBondContact ND1-NE1 2.92Å; W39-G41 VanDerWaalsContact CE2-C 3.5Å; W39-G41 PolarHBondContact NE1-O 2.95Å; W39-N42 HydrophobicContact CZ2-CB 4.12Å; W39-N42 WeakPolarHBondContact CZ2-ND2 3.3Å; W39-N51 HydrophobicContact CH2-CB 4.13Å; W39-N53 HydrophobicContact CE3-CB 3.73Å; W39-N53 HydrophobicContact CZ3-CB 3.92Å; W39-N53 WeakPolarHBondContact O-CB 3.29Å; W39-N53 PolarHBondContact O-ND2 2.91Å
40	I	96.1	Very high	95.4	Very high	11 Å²	11	68.2 Å²	68.2	6%	0.056	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	-50.4	-179.3	-58.7	173.8	0	0	0	110.1	W28 K30 E38 N53 F56 P60 M73	W28-I40 HydrophobicContact CB-CB 4.21Å; W28-I40 HydrophobicContact CB-CD1 4.34Å; W28-I40 WeakPolarHBondContact O-CB 3.32Å; W28-I40 PolarHBondContact O-N 3.17Å; K30-I40 HydrophobicContact CB-CD1 4.02Å; K30-I40 HydrophobicContact CB-CG1 4.19Å; E38-I40 PolarHBondContact O-N 2.94Å; I40-N53 PolarHBondContact O-N 2.98Å; I40-F56 HydrophobicContact CG2-CB 3.95Å; I40-F56 HydrophobicContact CG2-CG 4.13Å; I40-P60 HydrophobicContact CG2-CB 4.43Å; I40-P60 HydrophobicContact CG2-CG 3.55Å; I40-M73 HydrophobicContact CD1-CE 3.82Å; I40-M73 HydrophobicContact CD1-SD 3.86Å; I40-M73 HydrophobicContact CG2-SD 4.02Å
41	G	96.7	Very high	95.6	Very high	0 Å²	0	68.1 Å²	68.1	0%	0	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	174.8	176.9	-172	0	0	0	0	0	112.2	W28 W39 N51	W28-G41 PolarHBondContact N-O 2.99Å; W28-G41 PolarHBondContact O-N 2.88Å; W39-G41 VanDerWaalsContact CE2-C 3.5Å; W39-G41 PolarHBondContact NE1-O 2.95Å; G41-N51 CarbonylContact C-O 3.59Å; G41-N51 WeakPolarHBondContact CA-O 3.27Å
42	N	97.3	Very high	95.7	Very high	17 Å²	17	64.3 Å²	64.3	9%	0.091	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.1	158	171.9	64.1	38.8	0	0	0	111	W25 M26 W39 T50 N51 L62	W25-N42 HydrophobicContact CE3-CB 4.09Å; W25-N42 VanDerWaalsContact CE3-CG 3.44Å; W25-N42 WeakPolarHBondContact CZ3-OD1 2.8Å; M26-N42 CarbonylContact O-C 3.54Å; M26-N42 WeakPolarHBondContact O-CA 3.03Å; M26-N42 WeakPolarHBondContact O-CB 3.35Å; W39-N42 HydrophobicContact CZ2-CB 4.12Å; W39-N42 WeakPolarHBondContact CZ2-ND2 3.3Å; N42-T50 VanDerWaalsContact O-CA 3.29Å; N42-T50 WeakPolarHBondContact O-CA 3.39Å; N42-N51 PolarHBondContact N-O 3.37Å; N42-N51 PolarHBondContact O-N 3.07Å; N42-N51 WeakPolarHBondContact OD1-CB 3.27Å; N42-N51 PolarHBondContact OD1-N 2.93Å; N42-N51 PolarHBondContact OD1-ND2 2.85Å; N42-N51 VanDerWaalsContact OD1-ND2 3.08Å; N42-L62 WeakPolarHBondContact O-CD1 3.34Å
43	I	97.9	Very high	95.8	Very high	3 Å²	3	61.5 Å²	61.5	2%	0.015	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.2	133.2	171.5	-174.3	158.7	0	0	0	108.8	M26 P45 G49 T50 L62 V64	M26-I43 HydrophobicContact CB-CG2 3.94Å; M26-I43 PolarHBondContact N-O 3.32Å; M26-I43 PolarHBondContact O-N 2.87Å; I43-P45 VanDerWaalsContact O-CD 3.26Å; I43-P45 WeakPolarHBondContact O-CD 2.93Å; I43-G49 CarbonylContact C-O 3.59Å; I43-G49 WeakPolarHBondContact CA-O 3.28Å; I43-T50 HydrophobicContact CB-CG2 4.12Å; I43-T50 HydrophobicContact CD1-CG2 3.76Å; I43-T50 HydrophobicContact CG1-CG2 3.89Å; I43-L62 HydrophobicContact CB-CB 4.12Å; I43-L62 HydrophobicContact CB-CD1 4.36Å; I43-L62 HydrophobicContact CD1-CB 4.11Å; I43-L62 HydrophobicContact CG2-CB 4.45Å; I43-V64 HydrophobicContact CD1-CG1 3.79Å; I43-V64 HydrophobicContact CD1-CG2 4.34Å; I43-V64 HydrophobicContact CG1-CG1 3.95Å; I43-V64 HydrophobicContact CG2-CG1 3.82Å
44	N	97.7	Very high	95.8	Very high	19 Å²	19	64 Å²	64	10%	0.102	34%	0.336	C	S	.	.			trans	-82.9	110.2	169.7	-178.9	-13.9	0	0	0	108.6	W25 S46 N47 G48 G49	W25-N44 HydrophobicContact CD2-CB 3.92Å; W25-N44 HydrophobicContact CE3-CB 3.93Å; W25-N44 HydrophobicContact CH2-CB 4.06Å; W25-N44 HydrophobicContact CZ2-CB 4.02Å; W25-N44 HydrophobicContact CZ3-CB 3.97Å; N44-S46 VanDerWaalsContact CG-OG 3.22Å; N44-S46 PolarHBondContact ND2-OG 2.88Å; N44-S46 PolarHBondContact O-N 2.92Å; N44-S46 VanDerWaalsContact O-N 3.16Å; N44-S46 WeakPolarHBondContact OD1-CB 3.26Å; N44-S46 PolarHBondContact OD1-N 3.05Å; N44-S46 PolarHBondContact OD1-OG 3.4Å; N44-N47 WeakPolarHBondContact CB-OD1 3.47Å; N44-N47 PolarHBondContact ND2-OD1 3.1Å; N44-N47 PolarHBondContact O-N 3.15Å; N44-G48 VanDerWaalsContact O-CA 3.3Å; N44-G48 WeakPolarHBondContact O-CA 3.44Å; N44-G48 PolarHBondContact O-N 2.97Å; N44-G49 PolarHBondContact N-O 3.11Å
45	P	97.3	Very high	95.7	Very high	0 Å²	0	59 Å²	59	0%	0	32%	0.321	C	S	.	.	T	Hydrogen-bonded Turn	trans	-67.9	-16.5	-176.3	-18.3	33.3	0	0	0	113.8	F21 Y24 I43 V64 K66	F21-P45 HydrophobicContact CD1-CB 3.88Å; F21-P45 HydrophobicContact CD2-CB 4.41Å; F21-P45 HydrophobicContact CD2-CG 4.31Å; F21-P45 HydrophobicContact CE1-CB 3.58Å; F21-P45 HydrophobicContact CE1-CG 4.24Å; F21-P45 HydrophobicContact CE2-CB 4.13Å; F21-P45 HydrophobicContact CE2-CG 3.89Å; F21-P45 HydrophobicContact CG-CB 4.32Å; F21-P45 HydrophobicContact CZ-CB 3.72Å; F21-P45 HydrophobicContact CZ-CG 3.86Å; Y24-P45 WeakPolarHBondContact O-CD 3.12Å; Y24-P45 VanDerWaalsContact O-CG 3.28Å; Y24-P45 WeakPolarHBondContact O-CG 3.17Å; I43-P45 VanDerWaalsContact O-CD 3.26Å; I43-P45 WeakPolarHBondContact O-CD 2.93Å; P45-V64 HydrophobicContact CB-CG1 4.04Å; P45-V64 HydrophobicContact CG-CG1 4.33Å; P45-K66 WeakPolarHBondContact O-CE 3.44Å
46	S	97.1	Very high	95.5	Very high	51 Å²	51	55.9 Å²	55.9	36%	0.357	31%	0.306	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.4	-42.8	177.9	67.6	0	0	0	0	113	N44 K66	N44-S46 VanDerWaalsContact CG-OG 3.22Å; N44-S46 PolarHBondContact ND2-OG 2.88Å; N44-S46 PolarHBondContact O-N 2.92Å; N44-S46 VanDerWaalsContact O-N 3.16Å; N44-S46 WeakPolarHBondContact OD1-CB 3.26Å; N44-S46 PolarHBondContact OD1-N 3.05Å; N44-S46 PolarHBondContact OD1-OG 3.4Å; S46-K66 WeakPolarHBondContact O-CE 3.27Å; S46-K66 PolarHBondContact O-NZ 3.31Å
47	N	96.3	Very high	95	Very high	114 Å²	114	60.4 Å²	60.4	61%	0.61	31%	0.31	S	S	*	.	T	Hydrogen-bonded Turn	trans	-125.2	-3.7	-173.7	65.4	12.8	0	0	0	114.1	N44 G49	N44-N47 WeakPolarHBondContact CB-OD1 3.47Å; N44-N47 PolarHBondContact ND2-OD1 3.1Å; N44-N47 PolarHBondContact O-N 3.15Å; N47-G49 VanDerWaalsContact C-N 3.25Å; N47-G49 PolarHBondContact O-N 3.4Å; N47-G49 PolarHBondContact OD1-N 2.78Å
48	G	95.4	Very high	94.5	Very high	33 Å²	33	60.2 Å²	60.2	34%	0.34	32%	0.319	S	S	.	.			trans	76.8	6.2	-179.3	0	0	0	0	0	114.4	N44 T50	N44-G48 VanDerWaalsContact O-CA 3.3Å; N44-G48 WeakPolarHBondContact O-CA 3.44Å; N44-G48 PolarHBondContact O-N 2.97Å; G48-T50 PolarHBondContact O-N 3.47Å
49	G	96.8	Very high	93.8	Very high	30 Å²	30	66 Å²	66	31%	0.309	34%	0.343	S	S	.	.			trans	-62.8	131.4	178.2	0	0	0	0	0	111.6	I43 N44 N47	I43-G49 CarbonylContact C-O 3.59Å; I43-G49 WeakPolarHBondContact CA-O 3.28Å; N44-G49 PolarHBondContact N-O 3.11Å; N47-G49 VanDerWaalsContact C-N 3.25Å; N47-G49 PolarHBondContact O-N 3.4Å; N47-G49 PolarHBondContact OD1-N 2.78Å
50	T	96.8	Very high	93.3	Very high	55 Å²	55	62.8 Å²	62.8	34%	0.337	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	139.3	-176.2	56.6	0	0	0	0	112.1	N42 I43 G48 Y52 L62	N42-T50 VanDerWaalsContact O-CA 3.29Å; N42-T50 WeakPolarHBondContact O-CA 3.39Å; I43-T50 HydrophobicContact CB-CG2 4.12Å; I43-T50 HydrophobicContact CD1-CG2 3.76Å; I43-T50 HydrophobicContact CG1-CG2 3.89Å; G48-T50 PolarHBondContact O-N 3.47Å; T50-Y52 WeakPolarHBondContact OG1-CE2 3.39Å; T50-L62 HydrophobicContact CG2-CB 3.98Å
51	N	96.1	Very high	93.3	Very high	81 Å²	81	65.5 Å²	65.5	43%	0.433	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	147.2	164.7	-58.8	-67.6	0	0	0	110.1	W25 W39 G41 N42	W25-N51 VanDerWaalsContact CZ3-ND2 3.27Å; W25-N51 WeakPolarHBondContact CZ3-ND2 3.46Å; W39-N51 HydrophobicContact CH2-CB 4.13Å; G41-N51 CarbonylContact C-O 3.59Å; G41-N51 WeakPolarHBondContact CA-O 3.27Å; N42-N51 PolarHBondContact N-O 3.37Å; N42-N51 PolarHBondContact O-N 3.07Å; N42-N51 WeakPolarHBondContact OD1-CB 3.27Å; N42-N51 PolarHBondContact OD1-N 2.93Å; N42-N51 PolarHBondContact OD1-ND2 2.85Å; N42-N51 VanDerWaalsContact OD1-ND2 3.08Å
52	Y	96.3	Very high	93.3	Very high	58 Å²	58	66 Å²	66	23%	0.227	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	146.5	-179.9	-62.6	-87.6	0	0	0	110.3	T50 P60 L62	T50-Y52 WeakPolarHBondContact OG1-CE2 3.39Å; Y52-P60 HydrophobicContact CD1-CG 4.45Å; Y52-P60 HydrophobicContact CE1-CG 4.36Å; Y52-P60 VanDerWaalsContact CE1-O 3.27Å; Y52-P60 WeakPolarHBondContact CE1-O 3.03Å; Y52-L62 HydrophobicContact CE1-CD1 4.01Å; Y52-L62 HydrophobicContact CE1-CG 3.76Å; Y52-L62 PolarHBondContact OH-N 2.59Å
53	N	94.9	Very high	93.2	Very high	43 Å²	43	67.6 Å²	67.6	23%	0.23	36%	0.363	C	S	.	.			trans	-68.8	134.8	160	178.5	-25.2	0	0	0	108.7	W39 I40 K55 F56 K57	W39-N53 HydrophobicContact CE3-CB 3.73Å; W39-N53 HydrophobicContact CZ3-CB 3.92Å; W39-N53 WeakPolarHBondContact O-CB 3.29Å; W39-N53 PolarHBondContact O-ND2 2.91Å; I40-N53 PolarHBondContact O-N 2.98Å; N53-K55 PolarHBondContact O-N 2.83Å; N53-K55 VanDerWaalsContact O-N 3.11Å; N53-K55 PolarHBondContact OD1-N 2.84Å; N53-K55 VanDerWaalsContact OD1-N 3.08Å; N53-F56 HydrophobicContact CB-CD2 3.97Å; N53-F56 PolarHBondContact O-N 3.24Å; N53-K57 PolarHBondContact O-N 2.73Å
54	E	93.2	Very high	93.2	Very high	175 Å²	175	69.2 Å²	69.2	82%	0.818	37%	0.373	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52	-36.7	-177.7	-64.5	-175.6	159.8	0	0	113	F56 K57	E54-F56 PolarHBondContact O-N 3.44Å; E54-F56 VanDerWaalsContact O-N 3.17Å; E54-K57 PolarHBondContact O-N 2.99Å
55	K	90.9	Very high	93.2	Very high	158 Å²	158	70.8 Å²	70.8	69%	0.687	38%	0.382	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.1	-25.5	177.7	-67.2	-177.9	179.5	178.7	0	113.8	N53	N53-K55 PolarHBondContact O-N 2.83Å; N53-K55 VanDerWaalsContact O-N 3.11Å; N53-K55 PolarHBondContact OD1-N 2.84Å; N53-K55 VanDerWaalsContact OD1-N 3.08Å
56	F	88.6	Confident	93.1	Very high	27 Å²	27	76.3 Å²	76.3	12%	0.118	41%	0.406	C	S	.	.	T	Hydrogen-bonded Turn	trans	-113.3	-8	-174.6	-60.6	-78.3	0	0	0	112.8	E38 I40 N53 E54 S58 K59 P60	E38-F56 HydrophobicContact CB-CE2 4.43Å; E38-F56 HydrophobicContact CB-CZ 4.35Å; I40-F56 HydrophobicContact CG2-CB 3.95Å; I40-F56 HydrophobicContact CG2-CG 4.13Å; N53-F56 HydrophobicContact CB-CD2 3.97Å; N53-F56 PolarHBondContact O-N 3.24Å; E54-F56 PolarHBondContact O-N 3.44Å; E54-F56 VanDerWaalsContact O-N 3.17Å; F56-S58 PolarHBondContact O-N 3.08Å; F56-K59 PolarHBondContact O-N 2.99Å; F56-P60 HydrophobicContact CB-CG 4.4Å; F56-P60 WeakPolarHBondContact O-CD 3.37Å
57	K	83.4	Confident	93	Very high	151 Å²	151	79.1 Å²	79.1	66%	0.657	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52	-25.5	-170	-165.2	173.8	-176.2	180	0	115.9	N53 E54	N53-K57 PolarHBondContact O-N 2.73Å; E54-K57 PolarHBondContact O-N 2.99Å
58	S	84.1	Confident	93	Very high	113 Å²	113	75.2 Å²	75.2	79%	0.79	41%	0.407	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.8	-5.1	-179.5	60.5	0	0	0	0	115.6	F56	F56-S58 PolarHBondContact O-N 3.08Å
59	K	81.8	Confident	93.1	Very high	163 Å²	163	75.5 Å²	75.5	71%	0.709	40%	0.404	S	S	*	.	S	Bend	trans	-106.4	-62	-170	-60.1	-176.3	-180	-175.3	0	114.1	F56	F56-K59 PolarHBondContact O-N 2.99Å
60	P	85.4	Confident	93.2	Very high	16 Å²	16	74.5 Å²	74.5	10%	0.104	39%	0.392	C	S	.	.	P	Polyproline II helix	trans	-89.7	141.8	-174.1	29	-17.7	0	0	0	112	I40 Y52 F56 M73 Q74	I40-P60 HydrophobicContact CG2-CB 4.43Å; I40-P60 HydrophobicContact CG2-CG 3.55Å; Y52-P60 HydrophobicContact CD1-CG 4.45Å; Y52-P60 HydrophobicContact CE1-CG 4.36Å; Y52-P60 VanDerWaalsContact CE1-O 3.27Å; Y52-P60 WeakPolarHBondContact CE1-O 3.03Å; F56-P60 HydrophobicContact CB-CG 4.4Å; F56-P60 WeakPolarHBondContact O-CD 3.37Å; P60-M73 HydrophobicContact CB-CG 3.66Å; P60-M73 HydrophobicContact CB-SD 3.86Å; P60-M73 HydrophobicContact CG-SD 4.47Å; P60-Q74 CarbonylContact C-O 3.53Å; P60-Q74 WeakPolarHBondContact CA-O 3.33Å
61	T	94.5	Very high	93.2	Very high	69 Å²	69	71.9 Å²	71.9	42%	0.423	38%	0.376	S	S	.	.	P	Polyproline II helix	trans	-101.3	122.5	164.5	-54.2	0	0	0	0	109.2	T63 M73 Q74	T61-T63 HydrophobicContact CG2-CG2 4.15Å; T61-M73 WeakPolarHBondContact O-CA 3.41Å; T61-Q74 PolarHBondContact N-O 3.42Å; T61-Q74 PolarHBondContact O-N 2.73Å; T61-Q74 VanDerWaalsContact O-N 3.13Å
62	L	96.7	Very high	93.3	Very high	9 Å²	9	70.5 Å²	70.5	5%	0.047	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	132.7	174.6	-54.4	-175.2	0	0	0	110.5	W28 N42 I43 T50 Y52 Y72 M73	W28-L62 HydrophobicContact CG-CD2 4.07Å; N42-L62 WeakPolarHBondContact O-CD1 3.34Å; I43-L62 HydrophobicContact CB-CB 4.12Å; I43-L62 HydrophobicContact CB-CD1 4.36Å; I43-L62 HydrophobicContact CD1-CB 4.11Å; I43-L62 HydrophobicContact CG2-CB 4.45Å; T50-L62 HydrophobicContact CG2-CB 3.98Å; Y52-L62 HydrophobicContact CE1-CD1 4.01Å; Y52-L62 HydrophobicContact CE1-CG 3.76Å; Y52-L62 PolarHBondContact OH-N 2.59Å; L62-Y72 WeakPolarHBondContact CA-O 3.41Å; L62-M73 HydrophobicContact CD2-CB 3.75Å; L62-M73 HydrophobicContact CD2-CG 3.67Å; L62-M73 HydrophobicContact CD2-SD 4.02Å
63	T	97.1	Very high	93.2	Very high	51 Å²	51	68.7 Å²	68.7	31%	0.313	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.5	162.2	176.7	59.4	0	0	0	0	111.1	T61 A71 Y72	T61-T63 HydrophobicContact CG2-CG2 4.15Å; T63-A71 CarbonylContact O-C 3.41Å; T63-A71 WeakPolarHBondContact O-CA 3.3Å; T63-Y72 PolarHBondContact N-O 2.63Å; T63-Y72 PolarHBondContact O-N 2.92Å
64	V	97.5	Very high	93.1	Very high	38 Å²	38	72.1 Å²	72.1	23%	0.23	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	142.8	174.7	-68	0	0	0	0	110.7	F21 I43 P45 T70 A71	F21-V64 HydrophobicContact CE1-CB 4.2Å; F21-V64 HydrophobicContact CE1-CG1 4.31Å; F21-V64 HydrophobicContact CZ-CB 4.34Å; F21-V64 HydrophobicContact CZ-CG1 4Å; I43-V64 HydrophobicContact CD1-CG1 3.79Å; I43-V64 HydrophobicContact CD1-CG2 4.34Å; I43-V64 HydrophobicContact CG1-CG1 3.95Å; I43-V64 HydrophobicContact CG2-CG1 3.82Å; P45-V64 HydrophobicContact CB-CG1 4.04Å; P45-V64 HydrophobicContact CG-CG1 4.33Å; V64-T70 WeakPolarHBondContact CA-O 3.38Å; V64-A71 HydrophobicContact CG1-CB 4.14Å
65	D	96.8	Very high	93.1	Very high	52 Å²	52	67 Å²	67	28%	0.278	35%	0.351	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	105.6	164.5	173.8	8.2	0	0	0	108.1	S67 S68 S69 T70 Y72	D65-S67 VanDerWaalsContact C-N 3.29Å; D65-S67 PolarHBondContact O-N 3.08Å; D65-S67 WeakPolarHBondContact OD1-CB 3.39Å; D65-S67 PolarHBondContact OD1-N 2.94Å; D65-S67 PolarHBondContact OD1-OG 3.47Å; D65-S67 PolarHBondContact OD2-OG 3.39Å; D65-S68 PolarHBondContact OD1-N 2.61Å; D65-S68 VanDerWaalsContact OD2-CB 3.27Å; D65-S68 WeakPolarHBondContact OD2-CB 3.39Å; D65-S68 PolarHBondContact OD2-OG 2.8Å; D65-S69 PolarHBondContact O-N 3.16Å; D65-S69 VanDerWaalsContact O-N 3.08Å; D65-T70 PolarHBondContact N-O 3.47Å; D65-T70 PolarHBondContact O-N 3.44Å; D65-Y72 HydrophobicContact CB-CE2 3.95Å
66	K	95.5	Very high	93.2	Very high	115 Å²	115	62.2 Å²	62.2	50%	0.5	33%	0.334	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67	-32.2	-179.3	-62.3	177.9	180	178	0	111.9	T22 P45 S46 S69	T22-K66 HydrophobicContact CG2-CG 4.5Å; P45-K66 WeakPolarHBondContact O-CE 3.44Å; S46-K66 WeakPolarHBondContact O-CE 3.27Å; S46-K66 PolarHBondContact O-NZ 3.31Å; K66-S69 PolarHBondContact O-N 3.46Å
67	S	95.1	Very high	93.4	Very high	110 Å²	110	64.2 Å²	64.2	77%	0.769	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.4	-39.3	-176.4	73.2	0	0	0	0	111.6	D65	D65-S67 VanDerWaalsContact C-N 3.29Å; D65-S67 PolarHBondContact O-N 3.08Å; D65-S67 WeakPolarHBondContact OD1-CB 3.39Å; D65-S67 PolarHBondContact OD1-N 2.94Å; D65-S67 PolarHBondContact OD1-OG 3.47Å; D65-S67 PolarHBondContact OD2-OG 3.39Å
68	S	96.8	Very high	94	Very high	33 Å²	33	59.1 Å²	59.1	23%	0.231	33%	0.327	C	S	.	.	T	Hydrogen-bonded Turn	trans	-93.8	-1.2	176.8	68.4	0	0	0	0	113.8	K15 D65 T70	K15-S68 WeakPolarHBondContact CE-O 3.48Å; D65-S68 PolarHBondContact OD1-N 2.61Å; D65-S68 VanDerWaalsContact OD2-CB 3.27Å; D65-S68 WeakPolarHBondContact OD2-CB 3.39Å; D65-S68 PolarHBondContact OD2-OG 2.8Å; S68-T70 VanDerWaalsContact C-N 3.26Å; S68-T70 PolarHBondContact O-N 3.25Å; S68-T70 PolarHBondContact O-OG1 2.98Å; S68-T70 WeakPolarHBondContact OG-CB 3.04Å; S68-T70 PolarHBondContact OG-OG1 3.43Å
69	S	97.2	Very high	94.7	Very high	38 Å²	38	55.7 Å²	55.7	27%	0.266	30%	0.298	S	S	.	.	T	Hydrogen-bonded Turn	trans	53.9	41.8	-172.8	-64.4	0	0	0	0	113.1	K15 A16 F21 D65 K66	K15-S69 WeakPolarHBondContact CA-O 3.47Å; A16-S69 PolarHBondContact N-O 3.48Å; F21-S69 VanDerWaalsContact CD1-CA 3.49Å; D65-S69 PolarHBondContact O-N 3.16Å; D65-S69 VanDerWaalsContact O-N 3.08Å; K66-S69 PolarHBondContact O-N 3.46Å
70	T	97.9	Very high	95.5	Very high	10 Å²	10	48.5 Å²	48.5	6%	0.061	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	132.2	-173.5	-50.7	0	0	0	0	111.4	C14 K15 V64 D65 S68 Y72	C14-T70 CarbonylContact O-C 3.55Å; C14-T70 WeakPolarHBondContact O-CA 3.22Å; K15-T70 HydrophobicContact CB-CG2 4.43Å; V64-T70 WeakPolarHBondContact CA-O 3.38Å; D65-T70 PolarHBondContact N-O 3.47Å; D65-T70 PolarHBondContact O-N 3.44Å; S68-T70 VanDerWaalsContact C-N 3.26Å; S68-T70 PolarHBondContact O-N 3.25Å; S68-T70 PolarHBondContact O-OG1 2.98Å; S68-T70 WeakPolarHBondContact OG-CB 3.04Å; S68-T70 PolarHBondContact OG-OG1 3.43Å; T70-Y72 HydrophobicContact CG2-CD1 4.32Å; T70-Y72 HydrophobicContact CG2-CD2 4.46Å; T70-Y72 HydrophobicContact CG2-CE1 3.71Å; T70-Y72 HydrophobicContact CG2-CE2 3.84Å; T70-Y72 VanDerWaalsContact CG2-CZ 3.42Å
71	A	97.8	Very high	96.2	Very high	0 Å²	0	50.9 Å²	50.9	0%	0	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	150.1	167.9	0	0	0	0	0	110.5	S13 C14 F21 M26 W28 T63 V64	S13-A71 CarbonylContact C-O 3.43Å; S13-A71 WeakPolarHBondContact CA-O 3.21Å; C14-A71 PolarHBondContact N-O 3.03Å; C14-A71 PolarHBondContact O-N 2.81Å; F21-A71 HydrophobicContact CE2-CB 4.44Å; F21-A71 HydrophobicContact CZ-CB 4.09Å; M26-A71 HydrophobicContact CB-CB 4.16Å; M26-A71 HydrophobicContact CG-CB 3.68Å; W28-A71 HydrophobicContact CZ2-CB 4.34Å; T63-A71 CarbonylContact O-C 3.41Å; T63-A71 WeakPolarHBondContact O-CA 3.3Å; V64-A71 HydrophobicContact CG1-CB 4.14Å
72	Y	97.4	Very high	96.4	Very high	51 Å²	51	49.5 Å²	49.5	20%	0.2	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	150.6	177.3	-53.3	-88.7	0	0	0	112	K11 L12 S13 L62 T63 D65 T70	K11-Y72 HydrophobicContact CD-CD1 4.39Å; K11-Y72 HydrophobicContact CG-CD1 4.36Å; L12-Y72 WeakPolarHBondContact O-CA 3.39Å; S13-Y72 VanDerWaalsContact CB-CE1 3.5Å; L62-Y72 WeakPolarHBondContact CA-O 3.41Å; T63-Y72 PolarHBondContact N-O 2.63Å; T63-Y72 PolarHBondContact O-N 2.92Å; D65-Y72 HydrophobicContact CB-CE2 3.95Å; T70-Y72 HydrophobicContact CG2-CD1 4.32Å; T70-Y72 HydrophobicContact CG2-CD2 4.46Å; T70-Y72 HydrophobicContact CG2-CE1 3.71Å; T70-Y72 HydrophobicContact CG2-CE2 3.84Å; T70-Y72 VanDerWaalsContact CG2-CZ 3.42Å
73	M	95.6	Very high	96.3	Very high	21 Å²	21	52.8 Å²	52.8	10%	0.103	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	129.2	168.1	179.2	171	71	0	0	108.4	K11 L12 W28 I40 P60 T61 L62	K11-M73 CarbonylContact C-O 3.6Å; K11-M73 WeakPolarHBondContact CA-O 3.38Å; L12-M73 HydrophobicContact CD1-CE 3.55Å; L12-M73 PolarHBondContact N-O 3.2Å; L12-M73 PolarHBondContact O-N 3.43Å; W28-M73 HydrophobicContact CB-CE 4.45Å; W28-M73 HydrophobicContact CB-SD 3.87Å; W28-M73 HydrophobicContact CD2-CB 3.74Å; W28-M73 HydrophobicContact CD2-CE 4.17Å; W28-M73 HydrophobicContact CD2-CG 4.48Å; W28-M73 HydrophobicContact CD2-SD 4.03Å; W28-M73 HydrophobicContact CE3-CB 3.93Å; W28-M73 HydrophobicContact CE3-CE 3.65Å; W28-M73 HydrophobicContact CE3-SD 4.14Å; W28-M73 HydrophobicContact CG-CB 4.32Å; W28-M73 HydrophobicContact CG-SD 3.93Å; W28-M73 HydrophobicContact CH2-CB 4.05Å; W28-M73 HydrophobicContact CZ2-CB 3.87Å; W28-M73 HydrophobicContact CZ3-CB 4.08Å; W28-M73 HydrophobicContact CZ3-CE 4.26Å; I40-M73 HydrophobicContact CD1-CE 3.82Å; I40-M73 HydrophobicContact CD1-SD 3.86Å; I40-M73 HydrophobicContact CG2-SD 4.02Å; P60-M73 HydrophobicContact CB-CG 3.66Å; P60-M73 HydrophobicContact CB-SD 3.86Å; P60-M73 HydrophobicContact CG-SD 4.47Å; T61-M73 WeakPolarHBondContact O-CA 3.41Å; L62-M73 HydrophobicContact CD2-CB 3.75Å; L62-M73 HydrophobicContact CD2-CG 3.67Å; L62-M73 HydrophobicContact CD2-SD 4.02Å
74	Q	91.6	Very high	96.3	Very high	115 Å²	115	53 Å²	53	54%	0.537	29%	0.289	S	S	.	.			trans	-131.2	0	177.3	63.9	-177.3	-0.1	0	0	111.1	K11 P60 T61	K11-Q74 HydrophobicContact CG-CB 4.46Å; P60-Q74 CarbonylContact C-O 3.53Å; P60-Q74 WeakPolarHBondContact CA-O 3.33Å; T61-Q74 PolarHBondContact N-O 3.42Å; T61-Q74 PolarHBondContact O-N 2.73Å; T61-Q74 VanDerWaalsContact O-N 3.13Å

Retrieved 74 of 74 residues in 17.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).