X5J4W7_MOUSE Loading...

IgA heavy chain VDJ region

AlphaFold DB , UniProt , Accession X5J4W7, Species MOUSE (Mus musculus, Mouse), Gene n/a, Length 85 aa.

						>X5J4W7_MOUSE|X5J4W7
AELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYRQLSSLTSEDTAV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	67.6	Low	88.5	Confident	162 Å²	162	99.3 Å²	99.3	100%	1.339	60%	0.597	S	S	*	*				0	135.1	0	0	0	0	0	0	107.9
2	E	76.3	Confident	89.1	Confident	122 Å²	122	95.9 Å²	95.9	57%	0.57	57%	0.573	S	S	*	*			trans	-104.6	117.9	179.4	-164.4	177.5	159.3	0	0	108.3	V4 V10	E2-V4 HydrophobicContact CG-CG1 3.96Å; E2-V10 HydrophobicContact CB-CG2 4.43Å; E2-V10 VanDerWaalsContact CD-CG2 3.48Å; E2-V10 HydrophobicContact CG-CG2 4.36Å; E2-V10 WeakPolarHBondContact OE2-CG2 3.35Å
3	L	86.7	Confident	89.6	Confident	178 Å²	178	94.6 Å²	94.6	93%	0.932	57%	0.571	S	S	*	*			trans	-92.5	118	176.7	-171.5	72.6	0	0	0	108.5
4	V	89.7	Confident	90.1	Very high	51 Å²	51	91.5 Å²	91.5	31%	0.309	56%	0.555	S	S	.	*			trans	-124.1	153.8	-176	-63.6	0	0	0	0	110.5	E2 A8 V10 L78	E2-V4 HydrophobicContact CG-CG1 3.96Å; V4-A8 HydrophobicContact CB-CB 4.27Å; V4-V10 HydrophobicContact CG1-CG2 4.49Å; V4-L78 HydrophobicContact CG2-CD1 3.38Å
5	K	90.3	Very high	90.6	Very high	173 Å²	173	91.5 Å²	91.5	75%	0.752	56%	0.556	S	S	*	*			trans	-71.2	147.9	176.3	-66.3	178.9	-179	178.3	0	110.1	G7 A8	K5-G7 PolarHBondContact O-N 2.95Å; K5-A8 WeakPolarHBondContact O-CB 3.44Å; K5-A8 PolarHBondContact O-N 3.18Å; K5-A8 VanDerWaalsContact O-N 3.08Å
6	P	91.2	Very high	90.9	Very high	118 Å²	118	86.4 Å²	86.4	77%	0.766	53%	0.526	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.1	141.5	168.7	-25.5	34.6	0	0	0	111.6	A8	P6-A8 PolarHBondContact O-N 3.18Å
7	G	92.1	Very high	91.3	Very high	52 Å²	52	87.4 Å²	87.4	54%	0.536	54%	0.537	S	S	.	.	T	Hydrogen-bonded Turn	trans	80	-11.3	-175.5	0	0	0	0	0	115	K5 L78	K5-G7 PolarHBondContact O-N 2.95Å; G7-L78 PolarHBondContact N-O 3.21Å
8	A	94.4	Very high	91.6	Very high	35 Å²	35	87.6 Å²	87.6	29%	0.289	56%	0.56	S	S	.	*			trans	-69.7	170	174.4	0	0	0	0	0	111.6	V4 K5 P6 S77 L78	V4-A8 HydrophobicContact CB-CB 4.27Å; K5-A8 WeakPolarHBondContact O-CB 3.44Å; K5-A8 PolarHBondContact O-N 3.18Å; K5-A8 VanDerWaalsContact O-N 3.08Å; P6-A8 PolarHBondContact O-N 3.18Å; A8-S77 PolarHBondContact O-N 3.14Å; A8-L78 WeakPolarHBondContact O-CB 3.2Å; A8-L78 VanDerWaalsContact O-CG 3.31Å; A8-L78 WeakPolarHBondContact O-CG 3.24Å; A8-L78 PolarHBondContact O-N 3.04Å
9	S	94.9	Very high	91.7	Very high	64 Å²	64	88.2 Å²	88.2	45%	0.448	55%	0.553	S	S	.	*			trans	-114.1	144	170.3	-56.9	0	0	0	0	109.8	L75 S76	S9-L75 CarbonylContact C-O 3.59Å; S9-L75 WeakPolarHBondContact CA-O 3.49Å; S9-L75 WeakPolarHBondContact CB-O 3.24Å; S9-S76 WeakPolarHBondContact OG-CA 3.27Å
10	V	94.8	Very high	91.9	Very high	18 Å²	18	87.5 Å²	87.5	11%	0.109	55%	0.545	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123	139.7	176.5	71.5	0	0	0	0	109.7	E2 V4 L12 Q74 L75 L78	E2-V10 HydrophobicContact CB-CG2 4.43Å; E2-V10 VanDerWaalsContact CD-CG2 3.48Å; E2-V10 HydrophobicContact CG-CG2 4.36Å; E2-V10 WeakPolarHBondContact OE2-CG2 3.35Å; V4-V10 HydrophobicContact CG1-CG2 4.49Å; V10-L12 HydrophobicContact CG2-CD2 4.24Å; V10-Q74 CarbonylContact O-C 3.39Å; V10-Q74 VanDerWaalsContact O-CA 3.22Å; V10-Q74 WeakPolarHBondContact O-CA 3.35Å; V10-Q74 WeakPolarHBondContact O-CG 3.08Å; V10-L75 HydrophobicContact CG1-CB 4.27Å; V10-L75 PolarHBondContact N-O 3.01Å; V10-L75 PolarHBondContact O-N 2.81Å; V10-L78 HydrophobicContact CB-CD1 3.93Å; V10-L78 HydrophobicContact CG1-CD1 3.75Å; V10-L78 HydrophobicContact CG1-CD2 4.44Å
11	K	95.6	Very high	92.2	Very high	119 Å²	119	83.3 Å²	83.3	52%	0.517	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	116.6	175.4	-176.4	-179.8	177.2	-175.7	0	109.6	Y72 R73 Q74	K11-Y72 VanDerWaalsContact CE-CD1 3.47Å; K11-R73 WeakPolarHBondContact CA-O 3.35Å; K11-Q74 HydrophobicContact CB-CB 4.41Å; K11-Q74 HydrophobicContact CB-CG 4.39Å; K11-Q74 HydrophobicContact CG-CB 4.45Å
12	L	95.1	Very high	93.6	Very high	59 Å²	59	80.3 Å²	80.3	31%	0.309	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	153.8	175.1	-57.9	179.5	0	0	0	110.6	V10 W28 Y72 R73	V10-L12 HydrophobicContact CG2-CD2 4.24Å; L12-W28 HydrophobicContact CB-CH2 4.44Å; L12-W28 HydrophobicContact CB-CZ3 4.42Å; L12-Y72 VanDerWaalsContact O-CA 3.22Å; L12-Y72 WeakPolarHBondContact O-CA 3.49Å; L12-R73 VanDerWaalsContact CD1-NH2 3.29Å; L12-R73 PolarHBondContact N-O 3.19Å; L12-R73 PolarHBondContact O-N 2.79Å
13	S	96.8	Very high	94.5	Very high	79 Å²	79	80.6 Å²	80.6	55%	0.552	48%	0.481	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-124.3	149.7	175.3	63.2	0	0	0	0	110.5	A71 Y72	S13-A71 CarbonylContact C-O 3.58Å; S13-A71 WeakPolarHBondContact CA-O 3.47Å; S13-Y72 VanDerWaalsContact CB-CE1 3.48Å
14	C	96.1	Very high	94.9	Very high	51 Å²	51	74.3 Å²	74.3	35%	0.345	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.8	106.9	175.7	176.9	0	0	0	0	108.4	W28 T70 A71	C14-W28 HydrophobicContact CB-CH2 3.7Å; C14-W28 HydrophobicContact CB-CZ2 4.08Å; C14-W28 HydrophobicContact CB-CZ3 4.47Å; C14-T70 CarbonylContact O-C 3.55Å; C14-T70 WeakPolarHBondContact O-CA 3.47Å; C14-A71 PolarHBondContact N-O 3.16Å; C14-A71 PolarHBondContact O-N 2.73Å
15	T	97.7	Very high	95.3	Very high	92 Å²	92	77.9 Å²	77.9	56%	0.564	46%	0.46	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.5	121.2	178.7	-55.5	0	0	0	0	109.8	T70	T15-T70 WeakPolarHBondContact CB-OG1 3.32Å; T15-T70 WeakPolarHBondContact CG2-OG1 3.3Å; T15-T70 PolarHBondContact OG1-OG1 3.35Å
16	A	96	Very high	95.6	Very high	10 Å²	10	71 Å²	71	8%	0.083	43%	0.43	C	S	.	.			trans	-77.1	146.6	175.7	0	0	0	0	0	110.8	F19 I21 N69	A16-F19 HydrophobicContact CB-CD2 4.35Å; A16-F19 HydrophobicContact CB-CE1 3.97Å; A16-F19 HydrophobicContact CB-CE2 3.67Å; A16-F19 HydrophobicContact CB-CZ 3.46Å; A16-F19 VanDerWaalsContact CB-CZ 3.46Å; A16-I21 HydrophobicContact CB-CB 4.24Å; A16-I21 HydrophobicContact CB-CD1 4.33Å; A16-I21 HydrophobicContact CB-CG1 4.37Å; A16-N69 WeakPolarHBondContact CB-ND2 3.47Å; A16-N69 PolarHBondContact N-O 3.13Å; A16-N69 PolarHBondContact O-ND2 2.97Å
17	S	97.1	Very high	95.9	Very high	102 Å²	102	70.2 Å²	70.2	71%	0.713	42%	0.416	S	S	*	.			trans	-136.9	145.7	173.8	63.1	0	0	0	0	110	F19	S17-F19 VanDerWaalsContact C-N 3.27Å; S17-F19 VanDerWaalsContact O-CD1 3.31Å; S17-F19 WeakPolarHBondContact O-CD1 3.24Å; S17-F19 PolarHBondContact O-N 2.9Å
18	G	96.4	Very high	96.1	Very high	91 Å²	91	69 Å²	69	94%	0.938	40%	0.396	S	S	*	.	S	Bend	trans	81.1	-4.1	-177.7	0	0	0	0	0	115.5
19	F	94.1	Very high	96.2	Very high	99 Å²	99	70.4 Å²	70.4	43%	0.434	40%	0.4	S	S	.	.	S	Bend	trans	-152.8	162.4	174.1	63.7	-84.1	0	0	0	111.2	A16 S17 T24 N69	A16-F19 HydrophobicContact CB-CD2 4.35Å; A16-F19 HydrophobicContact CB-CE1 3.97Å; A16-F19 HydrophobicContact CB-CE2 3.67Å; A16-F19 HydrophobicContact CB-CZ 3.46Å; A16-F19 VanDerWaalsContact CB-CZ 3.46Å; S17-F19 VanDerWaalsContact C-N 3.27Å; S17-F19 VanDerWaalsContact O-CD1 3.31Å; S17-F19 WeakPolarHBondContact O-CD1 3.24Å; S17-F19 PolarHBondContact O-N 2.9Å; F19-T24 HydrophobicContact CD2-CG2 3.7Å; F19-T24 HydrophobicContact CE2-CG2 3.81Å; F19-T24 WeakPolarHBondContact CE2-OG1 3.31Å; F19-N69 PolarHBondContact O-ND2 2.88Å
20	N	96.1	Very high	96.1	Very high	75 Å²	75	68 Å²	68	40%	0.401	38%	0.381	S	S	.	.			trans	-84.6	120.3	173.1	-175	-11	0	0	0	109.7	K22 D23	N20-K22 PolarHBondContact O-N 3.2Å; N20-K22 VanDerWaalsContact O-N 3.13Å; N20-K22 WeakPolarHBondContact OD1-CB 3.46Å; N20-K22 PolarHBondContact OD1-N 3.17Å; N20-D23 WeakPolarHBondContact CB-OD2 3.22Å; N20-D23 PolarHBondContact O-N 3.3Å; N20-D23 VanDerWaalsContact O-N 3.08Å
21	I	97.1	Very high	96.1	Very high	0 Å²	0	71.8 Å²	71.8	0%	0	40%	0.398	C	S	.	.	G	3₁₀ helix	trans	-59.6	-27	-178.7	-159	167.5	0	0	0	111.8	A16 D23 T24 M26 P45 T66 N69 A71	A16-I21 HydrophobicContact CB-CB 4.24Å; A16-I21 HydrophobicContact CB-CD1 4.33Å; A16-I21 HydrophobicContact CB-CG1 4.37Å; I21-D23 PolarHBondContact O-N 2.75Å; I21-T24 PolarHBondContact O-N 3.13Å; I21-T24 PolarHBondContact O-OG1 3.42Å; I21-T24 VanDerWaalsContact O-OG1 3.06Å; I21-M26 HydrophobicContact CD1-CE 3.89Å; I21-M26 HydrophobicContact CG1-CE 3.85Å; I21-P45 HydrophobicContact CG1-CG 4.12Å; I21-P45 HydrophobicContact CG2-CB 4.41Å; I21-P45 WeakPolarHBondContact O-CG 3.22Å; I21-T66 HydrophobicContact CG2-CG2 4.34Å; I21-N69 WeakPolarHBondContact CB-OD1 3.25Å; I21-N69 VanDerWaalsContact CG2-OD1 3.24Å; I21-N69 WeakPolarHBondContact CG2-OD1 3.48Å; I21-N69 PolarHBondContact N-OD1 2.87Å; I21-A71 HydrophobicContact CD1-CB 3.88Å
22	K	97	Very high	95.9	Very high	98 Å²	98	68 Å²	68	43%	0.426	38%	0.381	S	S	.	.	G	3₁₀ helix	trans	-58.4	-27.8	177.6	-161.3	178.4	177.8	178.7	0	113	N20 T24 A46 T66	N20-K22 PolarHBondContact O-N 3.2Å; N20-K22 VanDerWaalsContact O-N 3.13Å; N20-K22 WeakPolarHBondContact OD1-CB 3.46Å; N20-K22 PolarHBondContact OD1-N 3.17Å; K22-T24 VanDerWaalsContact C-N 3.34Å; K22-A46 HydrophobicContact CG-CB 4.07Å; K22-A46 WeakPolarHBondContact O-CB 3.49Å; K22-T66 HydrophobicContact CB-CG2 4.1Å; K22-T66 HydrophobicContact CG-CG2 4.12Å
23	D	96.2	Very high	95.5	Very high	128 Å²	128	71.4 Å²	71.4	68%	0.684	41%	0.406	S	S	*	.	G	3₁₀ helix	trans	-94.3	7.6	-174.7	-54.5	-39.1	0	0	0	112.6	N20 I21	N20-D23 WeakPolarHBondContact CB-OD2 3.22Å; N20-D23 PolarHBondContact O-N 3.3Å; N20-D23 VanDerWaalsContact O-N 3.08Å; I21-D23 PolarHBondContact O-N 2.75Å
24	T	94.7	Very high	95.1	Very high	47 Å²	47	75.8 Å²	75.8	29%	0.288	42%	0.418	S	S	.	.	S	Bend	trans	-136.1	141.4	-172.3	62.4	0	0	0	0	112.8	F19 I21 K22 M26 P45	F19-T24 HydrophobicContact CD2-CG2 3.7Å; F19-T24 HydrophobicContact CE2-CG2 3.81Å; F19-T24 WeakPolarHBondContact CE2-OG1 3.31Å; I21-T24 PolarHBondContact O-N 3.13Å; I21-T24 PolarHBondContact O-OG1 3.42Å; I21-T24 VanDerWaalsContact O-OG1 3.06Å; K22-T24 VanDerWaalsContact C-N 3.34Å; T24-M26 PolarHBondContact O-N 2.89Å; T24-P45 WeakPolarHBondContact O-CD 3.23Å
25	Y	96.9	Very high	94.6	Very high	126 Å²	126	78.5 Å²	78.5	49%	0.494	43%	0.425	S	S	.	.	P	Polyproline II helix	trans	-73.5	127.4	166.4	-67.8	-60.8	0	0	0	110.3	D44	Y25-D44 HydrophobicContact CD1-CB 3.87Å; Y25-D44 HydrophobicContact CE1-CB 3.56Å; Y25-D44 WeakPolarHBondContact CE1-OD2 3.48Å
26	M	96.9	Very high	94.2	Very high	28 Å²	28	75.5 Å²	75.5	14%	0.138	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	116.1	174.9	-164.6	58.6	57.6	0	0	109.9	I21 T24 R42 I43 A71	I21-M26 HydrophobicContact CD1-CE 3.89Å; I21-M26 HydrophobicContact CG1-CE 3.85Å; T24-M26 PolarHBondContact O-N 2.89Å; M26-R42 CarbonylContact O-C 3.55Å; M26-R42 WeakPolarHBondContact O-CA 3.32Å; M26-R42 WeakPolarHBondContact O-CB 3.16Å; M26-I43 HydrophobicContact CB-CG2 3.86Å; M26-I43 PolarHBondContact N-O 2.84Å; M26-I43 PolarHBondContact O-N 3.22Å; M26-A71 HydrophobicContact CB-CB 4.31Å; M26-A71 HydrophobicContact CG-CB 3.75Å
27	H	97.4	Very high	94.2	Very high	101 Å²	101	80.7 Å²	80.7	47%	0.468	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	140.5	179.2	-72	-109.8	0	0	0	110.6	W39	H27-W39 AromaticContact ND1-CD1 3.96Å; H27-W39 AromaticContact ND1-NE1 3.21Å; H27-W39 PolarHBondContact ND1-NE1 3.09Å
28	W	97.5	Very high	94.1	Very high	28 Å²	28	77.2 Å²	77.2	11%	0.106	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	127.4	172.3	-69	96.1	0	0	0	109.1	L12 C14 I40 G41 A71 R73	L12-W28 HydrophobicContact CB-CH2 4.44Å; L12-W28 HydrophobicContact CB-CZ3 4.42Å; C14-W28 HydrophobicContact CB-CH2 3.7Å; C14-W28 HydrophobicContact CB-CZ2 4.08Å; C14-W28 HydrophobicContact CB-CZ3 4.47Å; W28-I40 HydrophobicContact CB-CB 4.3Å; W28-I40 WeakPolarHBondContact O-CB 3.15Å; W28-I40 PolarHBondContact O-N 2.97Å; W28-G41 PolarHBondContact N-O 3.04Å; W28-G41 PolarHBondContact O-N 3.46Å; W28-A71 HydrophobicContact CZ2-CB 4.17Å; W28-R73 HydrophobicContact CD2-CB 3.66Å; W28-R73 HydrophobicContact CD2-CG 4.32Å; W28-R73 HydrophobicContact CE3-CB 3.99Å; W28-R73 HydrophobicContact CG-CB 4.13Å; W28-R73 HydrophobicContact CG-CG 4.39Å; W28-R73 HydrophobicContact CH2-CB 4.07Å; W28-R73 HydrophobicContact CZ2-CB 3.81Å; W28-R73 HydrophobicContact CZ3-CB 4.17Å
29	V	96.1	Very high	94.1	Very high	63 Å²	63	77 Å²	77	38%	0.382	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	161.6	174.8	-66.5	0	0	0	0	108.7	L37 E38 R73	V29-L37 HydrophobicContact CG2-CD2 4.32Å; V29-E38 CarbonylContact C-O 3.51Å; V29-E38 VanDerWaalsContact CA-O 3.25Å; V29-E38 WeakPolarHBondContact CA-O 3.49Å; V29-R73 PolarHBondContact O-NH1 2.58Å
30	K	93.4	Very high	94.2	Very high	13 Å²	13	72.3 Å²	72.3	6%	0.057	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.5	143.1	162.3	72.3	174.4	-163.7	179.4	0	109.2	E38 I40 F56 E81 A84 V85	K30-E38 WeakPolarHBondContact CE-OE1 3.36Å; K30-E38 HydrophobicContact CG-CB 3.88Å; K30-E38 PolarHBondContact N-O 3.21Å; K30-E38 IonicContact NZ-OE1 3.88Å; K30-E38 PolarHBondContact O-N 3.03Å; K30-I40 HydrophobicContact CB-CD1 4.03Å; K30-I40 HydrophobicContact CG-CD1 4.43Å; K30-F56 HydrophobicContact CD-CE1 4.14Å; K30-F56 HydrophobicContact CD-CZ 3.88Å; K30-F56 HydrophobicContact CG-CZ 4.44Å; K30-E81 PolarHBondContact NZ-O 2.8Å; K30-A84 HydrophobicContact CB-CB 3.68Å; K30-A84 HydrophobicContact CD-CB 4.14Å; K30-A84 HydrophobicContact CG-CB 4.18Å; K30-V85 CarbonylContact C-O 3.46Å; K30-V85 VanDerWaalsContact CA-O 3.31Å; K30-V85 WeakPolarHBondContact CA-O 3.37Å
31	Q	93.8	Very high	94.3	Very high	98 Å²	98	68.7 Å²	68.7	46%	0.458	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	127.4	177.5	-163.8	175.4	14.6	0	0	111.3	G36 L37 A84 V85	Q31-G36 WeakPolarHBondContact CA-O 3.4Å; Q31-L37 HydrophobicContact CB-CD2 3.8Å; Q31-L37 HydrophobicContact CG-CD2 3.83Å; Q31-L37 HydrophobicContact CG-CG 4.48Å; Q31-A84 WeakPolarHBondContact O-CA 3.1Å; Q31-A84 WeakPolarHBondContact O-CB 2.99Å; Q31-V85 PolarHBondContact N-O 2.78Å; Q31-V85 PolarHBondContact O-N 2.79Å
32	R	90.9	Very high	94.3	Very high	41 Å²	41	70.5 Å²	70.5	16%	0.155	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	140.8	169.1	-70.1	-172.5	-80.3	173.9	0.8	109.7	E34 Q35 G36 E38 E81 T83 A84	R32-E34 PolarHBondContact O-N 2.91Å; R32-Q35 HydrophobicContact CB-CB 4.28Å; R32-Q35 VanDerWaalsContact NH1-OE1 3.09Å; R32-Q35 PolarHBondContact O-N 3.4Å; R32-G36 PolarHBondContact N-O 3.21Å; R32-G36 VanDerWaalsContact N-O 3.14Å; R32-G36 PolarHBondContact O-N 3.33Å; R32-E38 IonicContact CZ-OE1 3.16Å; R32-E38 IonicContact NE-OE1 2.73Å; R32-E38 PolarHBondContact NE-OE1 2.88Å; R32-E38 VanDerWaalsContact NE-OE1 3.16Å; R32-E38 IonicContact NH2-OE1 3.85Å; R32-E38 PolarHBondContact NH2-OE1 2.96Å; R32-E38 IonicContact NH2-OE2 3.73Å; R32-E81 PolarHBondContact NH1-O 3.09Å; R32-T83 WeakPolarHBondContact CD-O 3.31Å; R32-T83 WeakPolarHBondContact CG-O 3.46Å; R32-A84 HydrophobicContact CG-CB 3.84Å
33	P	87.4	Confident	94.4	Very high	129 Å²	129	66 Å²	66	84%	0.838	33%	0.33	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.7	-39.9	178.3	-27.6	35.2	0	0	0	113.2
34	E	88.1	Confident	94.5	Very high	171 Å²	171	60.9 Å²	60.9	80%	0.799	30%	0.302	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.1	-26.2	-176.5	-15.3	-76.8	154.5	0	0	114.4	R32	R32-E34 PolarHBondContact O-N 2.91Å
35	Q	85.3	Confident	94.7	Very high	108 Å²	108	59.2 Å²	59.2	51%	0.505	29%	0.292	S	S	.	.	T	Hydrogen-bonded Turn	trans	-122.8	-4.8	-164.2	-80.6	150.3	-31.8	0	0	114.1	R32	R32-Q35 HydrophobicContact CB-CB 4.28Å; R32-Q35 VanDerWaalsContact NH1-OE1 3.09Å; R32-Q35 PolarHBondContact O-N 3.4Å
36	G	90.9	Very high	94.7	Very high	30 Å²	30	55.7 Å²	55.7	31%	0.309	29%	0.289	S	S	.	.	E	Extended strand (participates in β ladder)	trans	71.2	-149.4	-179.5	0	0	0	0	0	112.5	Q31 R32	Q31-G36 WeakPolarHBondContact CA-O 3.4Å; R32-G36 PolarHBondContact N-O 3.21Å; R32-G36 VanDerWaalsContact N-O 3.14Å; R32-G36 PolarHBondContact O-N 3.33Å
37	L	94.2	Very high	94.7	Very high	118 Å²	118	59.3 Å²	59.3	62%	0.618	31%	0.309	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.3	122.8	-178.4	-66.4	172.8	0	0	0	110.9	V29 Q31	V29-L37 HydrophobicContact CG2-CD2 4.32Å; Q31-L37 HydrophobicContact CB-CD2 3.8Å; Q31-L37 HydrophobicContact CG-CD2 3.83Å; Q31-L37 HydrophobicContact CG-CG 4.48Å
38	E	95	Very high	94.6	Very high	30 Å²	30	56.6 Å²	56.6	14%	0.14	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	124.5	170.3	-66	-177.1	-96	0	0	109.3	V29 K30 R32 K55	V29-E38 CarbonylContact C-O 3.51Å; V29-E38 VanDerWaalsContact CA-O 3.25Å; V29-E38 WeakPolarHBondContact CA-O 3.49Å; K30-E38 WeakPolarHBondContact CE-OE1 3.36Å; K30-E38 HydrophobicContact CG-CB 3.88Å; K30-E38 PolarHBondContact N-O 3.21Å; K30-E38 IonicContact NZ-OE1 3.88Å; K30-E38 PolarHBondContact O-N 3.03Å; R32-E38 IonicContact CZ-OE1 3.16Å; R32-E38 IonicContact NE-OE1 2.73Å; R32-E38 PolarHBondContact NE-OE1 2.88Å; R32-E38 VanDerWaalsContact NE-OE1 3.16Å; R32-E38 IonicContact NH2-OE1 3.85Å; R32-E38 PolarHBondContact NH2-OE1 2.96Å; R32-E38 IonicContact NH2-OE2 3.73Å; E38-K55 IonicContact OE2-NZ 3.37Å
39	W	96.6	Very high	94.7	Very high	86 Å²	86	59.2 Å²	59.2	33%	0.326	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.6	129	176.7	-177	67.1	0	0	0	110.6	H27 G41 R42 K51 D53	H27-W39 AromaticContact ND1-CD1 3.96Å; H27-W39 AromaticContact ND1-NE1 3.21Å; H27-W39 PolarHBondContact ND1-NE1 3.09Å; W39-G41 VanDerWaalsContact CE2-C 3.45Å; W39-G41 VanDerWaalsContact CE2-CA 3.48Å; W39-G41 PolarHBondContact NE1-O 3.08Å; W39-R42 HydrophobicContact CZ2-CB 4.05Å; W39-R42 HydrophobicContact CZ2-CG 4.04Å; W39-K51 HydrophobicContact CH2-CB 4.03Å; W39-D53 HydrophobicContact CE3-CB 3.84Å; W39-D53 HydrophobicContact CZ3-CB 4.11Å; W39-D53 VanDerWaalsContact O-CB 3.22Å; W39-D53 WeakPolarHBondContact O-CB 3.24Å
40	I	96.9	Very high	94.8	Very high	0 Å²	0	58.5 Å²	58.5	0%	0	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	-45.5	178.8	-66.6	166.5	0	0	0	110.2	W28 K30 Y52 D53 F56 A60	W28-I40 HydrophobicContact CB-CB 4.3Å; W28-I40 WeakPolarHBondContact O-CB 3.15Å; W28-I40 PolarHBondContact O-N 2.97Å; K30-I40 HydrophobicContact CB-CD1 4.03Å; K30-I40 HydrophobicContact CG-CD1 4.43Å; I40-Y52 WeakPolarHBondContact O-CA 3.31Å; I40-D53 PolarHBondContact O-N 3.5Å; I40-F56 HydrophobicContact CB-CD2 4.29Å; I40-F56 HydrophobicContact CB-CG 4.3Å; I40-F56 HydrophobicContact CG1-CD1 4.12Å; I40-F56 HydrophobicContact CG1-CD2 4.16Å; I40-F56 HydrophobicContact CG1-CE1 3.95Å; I40-F56 HydrophobicContact CG1-CE2 3.97Å; I40-F56 HydrophobicContact CG1-CG 4.21Å; I40-F56 HydrophobicContact CG1-CZ 3.86Å; I40-F56 HydrophobicContact CG2-CB 3.95Å; I40-F56 HydrophobicContact CG2-CD1 4.17Å; I40-F56 HydrophobicContact CG2-CD2 4.35Å; I40-F56 HydrophobicContact CG2-CG 3.9Å; I40-A60 HydrophobicContact CG2-CB 3.81Å
41	G	98.1	Very high	95	Very high	0 Å²	0	63.4 Å²	63.4	0%	0	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	169.4	179.3	-173.7	0	0	0	0	0	112.9	W28 W39 K51	W28-G41 PolarHBondContact N-O 3.04Å; W28-G41 PolarHBondContact O-N 3.46Å; W39-G41 VanDerWaalsContact CE2-C 3.45Å; W39-G41 VanDerWaalsContact CE2-CA 3.48Å; W39-G41 PolarHBondContact NE1-O 3.08Å; G41-K51 CarbonylContact C-O 3.58Å; G41-K51 WeakPolarHBondContact CA-O 3.49Å
42	R	98.2	Very high	95.2	Very high	37 Å²	37	61.6 Å²	61.6	14%	0.14	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.3	159.3	172.2	73.6	171.3	-176.7	76.8	-12.5	111.5	M26 W39 T50 K51	M26-R42 CarbonylContact O-C 3.55Å; M26-R42 WeakPolarHBondContact O-CA 3.32Å; M26-R42 WeakPolarHBondContact O-CB 3.16Å; W39-R42 HydrophobicContact CZ2-CB 4.05Å; W39-R42 HydrophobicContact CZ2-CG 4.04Å; R42-T50 VanDerWaalsContact O-CA 3.31Å; R42-T50 WeakPolarHBondContact O-CA 3.17Å; R42-K51 HydrophobicContact CG-CB 4.23Å; R42-K51 PolarHBondContact N-O 2.82Å; R42-K51 PolarHBondContact O-N 2.98Å
43	I	98.5	Very high	95.5	Very high	5 Å²	5	61.7 Å²	61.7	3%	0.026	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	143.2	165.6	-174.7	162.9	0	0	0	110.4	M26 P45 N49 T50 I62 A64	M26-I43 HydrophobicContact CB-CG2 3.86Å; M26-I43 PolarHBondContact N-O 2.84Å; M26-I43 PolarHBondContact O-N 3.22Å; I43-P45 HydrophobicContact CG2-CG 4.34Å; I43-P45 WeakPolarHBondContact O-CD 3.42Å; I43-N49 CarbonylContact C-O 3.59Å; I43-N49 WeakPolarHBondContact CA-O 2.97Å; I43-T50 HydrophobicContact CB-CG2 4.04Å; I43-T50 HydrophobicContact CD1-CG2 4.03Å; I43-T50 HydrophobicContact CG1-CG2 3.96Å; I43-I62 HydrophobicContact CB-CG2 3.64Å; I43-I62 HydrophobicContact CD1-CG2 4.44Å; I43-I62 HydrophobicContact CG2-CG2 3.56Å; I43-A64 HydrophobicContact CD1-CB 3.91Å; I43-A64 HydrophobicContact CG2-CB 4.48Å
44	D	98.3	Very high	95.9	Very high	20 Å²	20	60.4 Å²	60.4	11%	0.107	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	101.9	159.5	-172.2	-20.6	0	0	0	108.7	Y25 A46 N47 G48 N49	Y25-D44 HydrophobicContact CD1-CB 3.87Å; Y25-D44 HydrophobicContact CE1-CB 3.56Å; Y25-D44 WeakPolarHBondContact CE1-OD2 3.48Å; D44-A46 PolarHBondContact O-N 2.88Å; D44-A46 VanDerWaalsContact OD1-CB 3.24Å; D44-A46 WeakPolarHBondContact OD1-CB 3.4Å; D44-A46 PolarHBondContact OD1-N 3.26Å; D44-N47 WeakPolarHBondContact CB-OD1 3.22Å; D44-N47 PolarHBondContact O-N 3.19Å; D44-N47 PolarHBondContact OD2-ND2 3.36Å; D44-N47 PolarHBondContact OD2-OD1 3.33Å; D44-G48 VanDerWaalsContact O-CA 3.27Å; D44-G48 WeakPolarHBondContact O-CA 3.45Å; D44-G48 PolarHBondContact O-N 3.07Å; D44-N49 HydrophobicContact CB-CB 4.18Å; D44-N49 PolarHBondContact N-O 2.79Å
45	P	97.9	Very high	96.2	Very high	11 Å²	11	59.5 Å²	59.5	7%	0.071	32%	0.32	C	S	.	.	T	Hydrogen-bonded Turn	trans	-68.6	-14.3	-177	-19.6	35.6	0	0	0	113	I21 T24 I43 A64 T66	I21-P45 HydrophobicContact CG1-CG 4.12Å; I21-P45 HydrophobicContact CG2-CB 4.41Å; I21-P45 WeakPolarHBondContact O-CG 3.22Å; T24-P45 WeakPolarHBondContact O-CD 3.23Å; I43-P45 HydrophobicContact CG2-CG 4.34Å; I43-P45 WeakPolarHBondContact O-CD 3.42Å; P45-A64 HydrophobicContact CB-CB 3.83Å; P45-A64 HydrophobicContact CG-CB 4.13Å; P45-T66 HydrophobicContact CB-CG2 4.16Å; P45-T66 WeakPolarHBondContact O-CG2 3.15Å
46	A	97.2	Very high	96.6	Very high	52 Å²	52	54.8 Å²	54.8	43%	0.43	30%	0.298	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.7	-35.1	177.3	0	0	0	0	0	113.1	K22 D44	K22-A46 HydrophobicContact CG-CB 4.07Å; K22-A46 WeakPolarHBondContact O-CB 3.49Å; D44-A46 PolarHBondContact O-N 2.88Å; D44-A46 VanDerWaalsContact OD1-CB 3.24Å; D44-A46 WeakPolarHBondContact OD1-CB 3.4Å; D44-A46 PolarHBondContact OD1-N 3.26Å
47	N	96.9	Very high	96.8	Very high	105 Å²	105	60 Å²	60	56%	0.561	31%	0.314	S	S	*	.	T	Hydrogen-bonded Turn	trans	-134.3	-0.1	-173.7	58.2	40.8	0	0	0	113.7	D44 N49	D44-N47 WeakPolarHBondContact CB-OD1 3.22Å; D44-N47 PolarHBondContact O-N 3.19Å; D44-N47 PolarHBondContact OD2-ND2 3.36Å; D44-N47 PolarHBondContact OD2-OD1 3.33Å; N47-N49 VanDerWaalsContact C-N 3.27Å; N47-N49 PolarHBondContact O-N 3.02Å; N47-N49 WeakPolarHBondContact OD1-CB 3.36Å; N47-N49 PolarHBondContact OD1-N 3.34Å
48	G	96.5	Very high	96.8	Very high	44 Å²	44	58.1 Å²	58.1	45%	0.454	32%	0.323	S	S	.	.	T	Hydrogen-bonded Turn	trans	75.8	7	179.3	0	0	0	0	0	114.9	D44 T50	D44-G48 VanDerWaalsContact O-CA 3.27Å; D44-G48 WeakPolarHBondContact O-CA 3.45Å; D44-G48 PolarHBondContact O-N 3.07Å; G48-T50 PolarHBondContact O-N 3.29Å
49	N	97.8	Very high	96.8	Very high	83 Å²	83	58.7 Å²	58.7	44%	0.444	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.2	126.2	-178.8	-174.2	-30.1	0	0	0	110.5	I43 D44 N47	I43-N49 CarbonylContact C-O 3.59Å; I43-N49 WeakPolarHBondContact CA-O 2.97Å; D44-N49 HydrophobicContact CB-CB 4.18Å; D44-N49 PolarHBondContact N-O 2.79Å; N47-N49 VanDerWaalsContact C-N 3.27Å; N47-N49 PolarHBondContact O-N 3.02Å; N47-N49 WeakPolarHBondContact OD1-CB 3.36Å; N47-N49 PolarHBondContact OD1-N 3.34Å
50	T	98.4	Very high	96.8	Very high	48 Å²	48	54.9 Å²	54.9	29%	0.294	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	143.2	178.7	51.5	0	0	0	0	111.4	R42 I43 G48 Y52 I62	R42-T50 VanDerWaalsContact O-CA 3.31Å; R42-T50 WeakPolarHBondContact O-CA 3.17Å; I43-T50 HydrophobicContact CB-CG2 4.04Å; I43-T50 HydrophobicContact CD1-CG2 4.03Å; I43-T50 HydrophobicContact CG1-CG2 3.96Å; G48-T50 PolarHBondContact O-N 3.29Å; T50-Y52 WeakPolarHBondContact OG1-CE2 3.4Å; T50-I62 HydrophobicContact CG2-CB 4.3Å
51	K	98.1	Very high	96.8	Very high	115 Å²	115	58.2 Å²	58.2	50%	0.5	33%	0.332	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126	141.6	166.9	-63.3	-168.1	177.6	-169.5	0	108.6	W39 G41 R42	W39-K51 HydrophobicContact CH2-CB 4.03Å; G41-K51 CarbonylContact C-O 3.58Å; G41-K51 WeakPolarHBondContact CA-O 3.49Å; R42-K51 HydrophobicContact CG-CB 4.23Å; R42-K51 PolarHBondContact N-O 2.82Å; R42-K51 PolarHBondContact O-N 2.98Å
52	Y	98.3	Very high	96.9	Very high	60 Å²	60	58.5 Å²	58.5	24%	0.235	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.3	150.6	-179.7	-60.5	-85.8	0	0	0	109.6	I40 T50 A60 I62	I40-Y52 WeakPolarHBondContact O-CA 3.31Å; T50-Y52 WeakPolarHBondContact OG1-CE2 3.4Å; Y52-A60 HydrophobicContact CD1-CB 4.14Å; Y52-A60 HydrophobicContact CE1-CB 4.09Å; Y52-A60 WeakPolarHBondContact CE1-O 3.41Å; Y52-I62 HydrophobicContact CD1-CD1 4.15Å; Y52-I62 HydrophobicContact CE1-CB 4.34Å; Y52-I62 HydrophobicContact CE1-CD1 3.71Å; Y52-I62 HydrophobicContact CE1-CG1 3.85Å; Y52-I62 PolarHBondContact OH-N 2.95Å; Y52-I62 VanDerWaalsContact OH-N 3.11Å
53	D	97.1	Very high	96.9	Very high	44 Å²	44	59.7 Å²	59.7	24%	0.235	35%	0.345	C	S	.	.			trans	-69	137.5	157.8	179.7	-71.1	0	0	0	108.4	W39 I40 K55 F56 Q57	W39-D53 HydrophobicContact CE3-CB 3.84Å; W39-D53 HydrophobicContact CZ3-CB 4.11Å; W39-D53 VanDerWaalsContact O-CB 3.22Å; W39-D53 WeakPolarHBondContact O-CB 3.24Å; I40-D53 PolarHBondContact O-N 3.5Å; D53-K55 PolarHBondContact O-N 3.5Å; D53-K55 VanDerWaalsContact OD1-CB 3.24Å; D53-K55 WeakPolarHBondContact OD1-CB 3.31Å; D53-K55 VanDerWaalsContact OD1-CG 3.3Å; D53-K55 WeakPolarHBondContact OD1-CG 3.4Å; D53-K55 PolarHBondContact OD1-N 3.18Å; D53-F56 HydrophobicContact CB-CD2 4.04Å; D53-F56 PolarHBondContact O-N 3Å; D53-Q57 PolarHBondContact O-N 2.83Å
54	P	96.6	Very high	96.8	Very high	102 Å²	102	61 Å²	61	66%	0.662	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52	-30.1	-177.8	-29.2	35.9	0	0	0	114.6	F56 Q57	P54-F56 PolarHBondContact O-N 3.06Å; P54-Q57 PolarHBondContact O-N 2.93Å
55	K	93.3	Very high	96.8	Very high	152 Å²	152	62.8 Å²	62.8	66%	0.661	37%	0.367	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65	-27.2	177.7	-64.2	175.5	-178.9	176.3	0	113.4	E38 D53	E38-K55 IonicContact OE2-NZ 3.37Å; D53-K55 PolarHBondContact O-N 3.5Å; D53-K55 VanDerWaalsContact OD1-CB 3.24Å; D53-K55 WeakPolarHBondContact OD1-CB 3.31Å; D53-K55 VanDerWaalsContact OD1-CG 3.3Å; D53-K55 WeakPolarHBondContact OD1-CG 3.4Å; D53-K55 PolarHBondContact OD1-N 3.18Å
56	F	94.6	Very high	96.8	Very high	8 Å²	8	65.2 Å²	65.2	4%	0.035	38%	0.381	C	S	.	.	T	Hydrogen-bonded Turn	trans	-106.2	-4	-177.4	-61	-83.7	0	0	0	112.7	K30 I40 D53 P54 G58 K59 A60	K30-F56 HydrophobicContact CD-CE1 4.14Å; K30-F56 HydrophobicContact CD-CZ 3.88Å; K30-F56 HydrophobicContact CG-CZ 4.44Å; I40-F56 HydrophobicContact CB-CD2 4.29Å; I40-F56 HydrophobicContact CB-CG 4.3Å; I40-F56 HydrophobicContact CG1-CD1 4.12Å; I40-F56 HydrophobicContact CG1-CD2 4.16Å; I40-F56 HydrophobicContact CG1-CE1 3.95Å; I40-F56 HydrophobicContact CG1-CE2 3.97Å; I40-F56 HydrophobicContact CG1-CG 4.21Å; I40-F56 HydrophobicContact CG1-CZ 3.86Å; I40-F56 HydrophobicContact CG2-CB 3.95Å; I40-F56 HydrophobicContact CG2-CD1 4.17Å; I40-F56 HydrophobicContact CG2-CD2 4.35Å; I40-F56 HydrophobicContact CG2-CG 3.9Å; D53-F56 HydrophobicContact CB-CD2 4.04Å; D53-F56 PolarHBondContact O-N 3Å; P54-F56 PolarHBondContact O-N 3.06Å; F56-G58 PolarHBondContact O-N 3.01Å; F56-K59 PolarHBondContact O-N 2.94Å; F56-A60 HydrophobicContact CB-CB 4.04Å; F56-A60 PolarHBondContact O-N 2.84Å
57	Q	94.9	Very high	96.8	Very high	140 Å²	140	67.9 Å²	67.9	65%	0.654	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.4	126.1	175.7	-169.8	165.6	-9.7	0	0	110.1	D53 P54 K59	D53-Q57 PolarHBondContact O-N 2.83Å; P54-Q57 PolarHBondContact O-N 2.93Å; Q57-K59 PolarHBondContact O-N 2.89Å
58	G	92.9	Very high	96.8	Very high	78 Å²	78	65.1 Å²	65.1	80%	0.804	39%	0.386	S	S	*	.	T	Hydrogen-bonded Turn	trans	83.9	-16.5	-175.2	0	0	0	0	0	115	F56	F56-G58 PolarHBondContact O-N 3.01Å
59	K	95.3	Very high	96.8	Very high	42 Å²	42	64.5 Å²	64.5	18%	0.183	37%	0.372	C	S	.	.	T	Hydrogen-bonded Turn	trans	-98.9	-35.9	174.8	-167.3	175.6	-172	176.1	0	112.8	F56 Q57 L75 S76 D82	F56-K59 PolarHBondContact O-N 2.94Å; Q57-K59 PolarHBondContact O-N 2.89Å; K59-L75 WeakPolarHBondContact O-CA 3.35Å; K59-S76 WeakPolarHBondContact CE-O 3.39Å; K59-S76 VanDerWaalsContact CG-O 3.24Å; K59-S76 WeakPolarHBondContact CG-O 3.33Å; K59-S76 PolarHBondContact O-N 2.79Å; K59-S76 PolarHBondContact O-OG 3.45Å; K59-D82 VanDerWaalsContact CE-OD2 3.23Å; K59-D82 WeakPolarHBondContact CE-OD2 3.38Å; K59-D82 IonicContact NZ-OD1 2.79Å; K59-D82 PolarHBondContact NZ-OD1 3.49Å; K59-D82 IonicContact NZ-OD2 2.58Å; K59-D82 PolarHBondContact NZ-OD2 2.91Å
60	A	97	Very high	96.9	Very high	6 Å²	6	60.9 Å²	60.9	5%	0.05	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	138.4	179.6	0	0	0	0	0	111.8	I40 Y52 F56 Q74 L75	I40-A60 HydrophobicContact CG2-CB 3.81Å; Y52-A60 HydrophobicContact CD1-CB 4.14Å; Y52-A60 HydrophobicContact CE1-CB 4.09Å; Y52-A60 WeakPolarHBondContact CE1-O 3.41Å; F56-A60 HydrophobicContact CB-CB 4.04Å; F56-A60 PolarHBondContact O-N 2.84Å; A60-Q74 CarbonylContact C-O 3.5Å; A60-Q74 WeakPolarHBondContact CA-O 3.47Å; A60-L75 HydrophobicContact CB-CD2 3.65Å
61	T	98.1	Very high	96.9	Very high	71 Å²	71	58.6 Å²	58.6	44%	0.436	34%	0.339	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	119.4	167.9	-58.8	0	0	0	0	108.2	T63 R73 Q74	T61-T63 HydrophobicContact CG2-CG2 4.21Å; T61-R73 CarbonylContact O-C 3.52Å; T61-R73 WeakPolarHBondContact O-CA 3.4Å; T61-Q74 PolarHBondContact N-O 2.8Å; T61-Q74 PolarHBondContact O-N 3Å
62	I	98.4	Very high	96.8	Very high	6 Å²	6	55.9 Å²	55.9	3%	0.031	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	131	176.9	-59.5	164.6	0	0	0	108.9	I43 T50 Y52 Y72 R73	I43-I62 HydrophobicContact CB-CG2 3.64Å; I43-I62 HydrophobicContact CD1-CG2 4.44Å; I43-I62 HydrophobicContact CG2-CG2 3.56Å; T50-I62 HydrophobicContact CG2-CB 4.3Å; Y52-I62 HydrophobicContact CD1-CD1 4.15Å; Y52-I62 HydrophobicContact CE1-CB 4.34Å; Y52-I62 HydrophobicContact CE1-CD1 3.71Å; Y52-I62 HydrophobicContact CE1-CG1 3.85Å; Y52-I62 PolarHBondContact OH-N 2.95Å; Y52-I62 VanDerWaalsContact OH-N 3.11Å; I62-Y72 WeakPolarHBondContact CA-O 3.2Å; I62-R73 HydrophobicContact CG1-CG 4.31Å
63	T	98.3	Very high	96.8	Very high	61 Å²	61	53.8 Å²	53.8	37%	0.374	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.2	166.4	175.8	64.3	0	0	0	0	110.9	T61 A71 Y72	T61-T63 HydrophobicContact CG2-CG2 4.21Å; T63-A71 WeakPolarHBondContact O-CA 3.45Å; T63-Y72 PolarHBondContact N-O 2.8Å; T63-Y72 PolarHBondContact O-N 2.86Å
64	A	98.1	Very high	96.8	Very high	33 Å²	33	55.6 Å²	55.6	27%	0.273	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.1	144.1	173.7	0	0	0	0	0	110.4	I43 P45	I43-A64 HydrophobicContact CD1-CB 3.91Å; I43-A64 HydrophobicContact CG2-CB 4.48Å; P45-A64 HydrophobicContact CB-CB 3.83Å; P45-A64 HydrophobicContact CG-CB 4.13Å
65	D	97.6	Very high	96.7	Very high	58 Å²	58	51.2 Å²	51.2	31%	0.31	30%	0.296	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	105.3	170.3	175	9	0	0	0	108.4	S67 S68 N69 T70 Y72	D65-S67 PolarHBondContact O-N 2.87Å; D65-S67 WeakPolarHBondContact OD1-CB 3.43Å; D65-S67 PolarHBondContact OD1-N 3.33Å; D65-S67 PolarHBondContact OD1-OG 3.11Å; D65-S67 PolarHBondContact OD2-OG 2.82Å; D65-S68 WeakPolarHBondContact CB-OG 3.36Å; D65-S68 PolarHBondContact OD1-N 3.39Å; D65-S68 WeakPolarHBondContact OD2-CB 3.05Å; D65-S68 PolarHBondContact OD2-OG 2.81Å; D65-N69 PolarHBondContact O-N 3.08Å; D65-N69 VanDerWaalsContact O-N 3.09Å; D65-T70 PolarHBondContact N-O 2.98Å; D65-T70 PolarHBondContact O-N 2.78Å; D65-Y72 HydrophobicContact CB-CE2 4.14Å
66	T	97.2	Very high	96.9	Very high	62 Å²	62	45.7 Å²	45.7	38%	0.38	28%	0.276	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.4	-20.2	-179.8	60.1	0	0	0	0	113.1	I21 K22 P45	I21-T66 HydrophobicContact CG2-CG2 4.34Å; K22-T66 HydrophobicContact CB-CG2 4.1Å; K22-T66 HydrophobicContact CG-CG2 4.12Å; P45-T66 HydrophobicContact CB-CG2 4.16Å; P45-T66 WeakPolarHBondContact O-CG2 3.15Å
67	S	96.7	Very high	96.8	Very high	108 Å²	108	49 Å²	49	76%	0.755	30%	0.3	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.8	-37.7	178.8	73.1	0	0	0	0	112	D65	D65-S67 PolarHBondContact O-N 2.87Å; D65-S67 WeakPolarHBondContact OD1-CB 3.43Å; D65-S67 PolarHBondContact OD1-N 3.33Å; D65-S67 PolarHBondContact OD1-OG 3.11Å; D65-S67 PolarHBondContact OD2-OG 2.82Å
68	S	97.8	Very high	96.8	Very high	47 Å²	47	43.1 Å²	43.1	33%	0.329	27%	0.273	S	S	.	.	T	Hydrogen-bonded Turn	trans	-95.6	6.9	175.1	62.9	0	0	0	0	113.5	D65 T70	D65-S68 WeakPolarHBondContact CB-OG 3.36Å; D65-S68 PolarHBondContact OD1-N 3.39Å; D65-S68 WeakPolarHBondContact OD2-CB 3.05Å; D65-S68 PolarHBondContact OD2-OG 2.81Å; S68-T70 PolarHBondContact O-N 3.15Å; S68-T70 VanDerWaalsContact O-N 3.15Å; S68-T70 PolarHBondContact O-OG1 2.89Å
69	N	97.6	Very high	96.8	Very high	31 Å²	31	42.5 Å²	42.5	17%	0.166	25%	0.254	C	S	.	.	T	Hydrogen-bonded Turn	trans	52.2	34.4	-178	-147.6	39.2	0	0	0	113.7	A16 F19 I21 D65	A16-N69 WeakPolarHBondContact CB-ND2 3.47Å; A16-N69 PolarHBondContact N-O 3.13Å; A16-N69 PolarHBondContact O-ND2 2.97Å; F19-N69 PolarHBondContact O-ND2 2.88Å; I21-N69 WeakPolarHBondContact CB-OD1 3.25Å; I21-N69 VanDerWaalsContact CG2-OD1 3.24Å; I21-N69 WeakPolarHBondContact CG2-OD1 3.48Å; I21-N69 PolarHBondContact N-OD1 2.87Å; D65-N69 PolarHBondContact O-N 3.08Å; D65-N69 VanDerWaalsContact O-N 3.09Å
70	T	98.3	Very high	96.5	Very high	7 Å²	7	45.4 Å²	45.4	4%	0.043	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	128.8	-168.1	-60.1	0	0	0	0	112	C14 T15 D65 S68 Y72	C14-T70 CarbonylContact O-C 3.55Å; C14-T70 WeakPolarHBondContact O-CA 3.47Å; T15-T70 WeakPolarHBondContact CB-OG1 3.32Å; T15-T70 WeakPolarHBondContact CG2-OG1 3.3Å; T15-T70 PolarHBondContact OG1-OG1 3.35Å; D65-T70 PolarHBondContact N-O 2.98Å; D65-T70 PolarHBondContact O-N 2.78Å; S68-T70 PolarHBondContact O-N 3.15Å; S68-T70 VanDerWaalsContact O-N 3.15Å; S68-T70 PolarHBondContact O-OG1 2.89Å; T70-Y72 HydrophobicContact CG2-CD1 4.38Å; T70-Y72 HydrophobicContact CG2-CD2 4.44Å; T70-Y72 HydrophobicContact CG2-CE1 3.77Å; T70-Y72 HydrophobicContact CG2-CE2 3.81Å; T70-Y72 VanDerWaalsContact CG2-CZ 3.42Å
71	A	98.1	Very high	96.1	Very high	0 Å²	0	51.1 Å²	51.1	0%	0	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	151.8	168.9	0	0	0	0	0	110.9	S13 C14 I21 M26 W28 T63	S13-A71 CarbonylContact C-O 3.58Å; S13-A71 WeakPolarHBondContact CA-O 3.47Å; C14-A71 PolarHBondContact N-O 3.16Å; C14-A71 PolarHBondContact O-N 2.73Å; I21-A71 HydrophobicContact CD1-CB 3.88Å; M26-A71 HydrophobicContact CB-CB 4.31Å; M26-A71 HydrophobicContact CG-CB 3.75Å; W28-A71 HydrophobicContact CZ2-CB 4.17Å; T63-A71 WeakPolarHBondContact O-CA 3.45Å
72	Y	98.1	Very high	95.8	Very high	57 Å²	57	48.9 Å²	48.9	22%	0.224	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	148.1	178.3	-55.1	-89.3	0	0	0	110.9	K11 L12 S13 I62 T63 D65 T70	K11-Y72 VanDerWaalsContact CE-CD1 3.47Å; L12-Y72 VanDerWaalsContact O-CA 3.22Å; L12-Y72 WeakPolarHBondContact O-CA 3.49Å; S13-Y72 VanDerWaalsContact CB-CE1 3.48Å; I62-Y72 WeakPolarHBondContact CA-O 3.2Å; T63-Y72 PolarHBondContact N-O 2.8Å; T63-Y72 PolarHBondContact O-N 2.86Å; D65-Y72 HydrophobicContact CB-CE2 4.14Å; T70-Y72 HydrophobicContact CG2-CD1 4.38Å; T70-Y72 HydrophobicContact CG2-CD2 4.44Å; T70-Y72 HydrophobicContact CG2-CE1 3.77Å; T70-Y72 HydrophobicContact CG2-CE2 3.81Å; T70-Y72 VanDerWaalsContact CG2-CZ 3.42Å
73	R	96.9	Very high	95.4	Very high	16 Å²	16	53.7 Å²	53.7	6%	0.06	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	124.9	168.7	179.6	-173.9	74	-156.6	6.7	109	K11 L12 W28 V29 T61 I62	K11-R73 WeakPolarHBondContact CA-O 3.35Å; L12-R73 VanDerWaalsContact CD1-NH2 3.29Å; L12-R73 PolarHBondContact N-O 3.19Å; L12-R73 PolarHBondContact O-N 2.79Å; W28-R73 HydrophobicContact CD2-CB 3.66Å; W28-R73 HydrophobicContact CD2-CG 4.32Å; W28-R73 HydrophobicContact CE3-CB 3.99Å; W28-R73 HydrophobicContact CG-CB 4.13Å; W28-R73 HydrophobicContact CG-CG 4.39Å; W28-R73 HydrophobicContact CH2-CB 4.07Å; W28-R73 HydrophobicContact CZ2-CB 3.81Å; W28-R73 HydrophobicContact CZ3-CB 4.17Å; V29-R73 PolarHBondContact O-NH1 2.58Å; T61-R73 CarbonylContact O-C 3.52Å; T61-R73 WeakPolarHBondContact O-CA 3.4Å; I62-R73 HydrophobicContact CG1-CG 4.31Å
74	Q	97	Very high	95.1	Very high	83 Å²	83	52.7 Å²	52.7	39%	0.388	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106	134.5	168.8	-171.8	175.7	32.5	0	0	109.6	V10 K11 A60 T61	V10-Q74 CarbonylContact O-C 3.39Å; V10-Q74 VanDerWaalsContact O-CA 3.22Å; V10-Q74 WeakPolarHBondContact O-CA 3.35Å; V10-Q74 WeakPolarHBondContact O-CG 3.08Å; K11-Q74 HydrophobicContact CB-CB 4.41Å; K11-Q74 HydrophobicContact CB-CG 4.39Å; K11-Q74 HydrophobicContact CG-CB 4.45Å; A60-Q74 CarbonylContact C-O 3.5Å; A60-Q74 WeakPolarHBondContact CA-O 3.47Å; T61-Q74 PolarHBondContact N-O 2.8Å; T61-Q74 PolarHBondContact O-N 3Å
75	L	95.8	Very high	94.7	Very high	10 Å²	10	58 Å²	58	5%	0.052	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.4	130.3	167.7	-66.9	175.8	0	0	0	108.1	S9 V10 K59 A60 L78	S9-L75 CarbonylContact C-O 3.59Å; S9-L75 WeakPolarHBondContact CA-O 3.49Å; S9-L75 WeakPolarHBondContact CB-O 3.24Å; V10-L75 HydrophobicContact CG1-CB 4.27Å; V10-L75 PolarHBondContact N-O 3.01Å; V10-L75 PolarHBondContact O-N 2.81Å; K59-L75 WeakPolarHBondContact O-CA 3.35Å; A60-L75 HydrophobicContact CB-CD2 3.65Å; L75-L78 HydrophobicContact CB-CD2 3.71Å; L75-L78 HydrophobicContact CD1-CD2 4.28Å
76	S	95.6	Very high	94.5	Very high	35 Å²	35	58 Å²	58	25%	0.245	35%	0.349	C	S	.	.			trans	-103.7	164	176.8	60.6	0	0	0	0	111.9	S9 K59 L78	S9-S76 WeakPolarHBondContact OG-CA 3.27Å; K59-S76 WeakPolarHBondContact CE-O 3.39Å; K59-S76 VanDerWaalsContact CG-O 3.24Å; K59-S76 WeakPolarHBondContact CG-O 3.33Å; K59-S76 PolarHBondContact O-N 2.79Å; K59-S76 PolarHBondContact O-OG 3.45Å; S76-L78 VanDerWaalsContact C-N 3.33Å; S76-L78 PolarHBondContact O-N 3.39Å
77	S	94.4	Very high	94.4	Very high	79 Å²	79	57.8 Å²	57.8	55%	0.552	35%	0.347	S	S	*	.	S	Bend	trans	49.8	51.2	173.5	-57.8	0	0	0	0	113	A8	A8-S77 PolarHBondContact O-N 3.14Å
78	L	93.8	Very high	94.2	Very high	15 Å²	15	55 Å²	55	8%	0.079	33%	0.325	C	S	.	.			trans	-63.6	140	-172.3	-69.9	168.9	0	0	0	112.6	V4 G7 A8 V10 L75 S76 D82	V4-L78 HydrophobicContact CG2-CD1 3.38Å; G7-L78 PolarHBondContact N-O 3.21Å; A8-L78 WeakPolarHBondContact O-CB 3.2Å; A8-L78 VanDerWaalsContact O-CG 3.31Å; A8-L78 WeakPolarHBondContact O-CG 3.24Å; A8-L78 PolarHBondContact O-N 3.04Å; V10-L78 HydrophobicContact CB-CD1 3.93Å; V10-L78 HydrophobicContact CG1-CD1 3.75Å; V10-L78 HydrophobicContact CG1-CD2 4.44Å; L75-L78 HydrophobicContact CB-CD2 3.71Å; L75-L78 HydrophobicContact CD1-CD2 4.28Å; S76-L78 VanDerWaalsContact C-N 3.33Å; S76-L78 PolarHBondContact O-N 3.39Å; L78-D82 WeakPolarHBondContact CA-OD2 3.46Å; L78-D82 HydrophobicContact CD2-CB 3.71Å
79	T	92.8	Very high	94	Very high	65 Å²	65	55.5 Å²	55.5	40%	0.399	32%	0.324	S	S	.	.			trans	-122.5	171.6	174.7	68.7	0	0	0	0	109.9	E81 D82	T79-E81 PolarHBondContact O-N 3.01Å; T79-E81 VanDerWaalsContact O-N 3.17Å; T79-D82 PolarHBondContact N-OD2 3.4Å; T79-D82 PolarHBondContact O-N 2.61Å; T79-D82 VanDerWaalsContact O-N 3.09Å; T79-D82 PolarHBondContact OG1-OD2 3.34Å
80	S	90.2	Very high	93.8	Very high	104 Å²	104	57 Å²	57	73%	0.727	33%	0.334	S	S	*	.	G	3₁₀ helix	trans	-57.2	-29.4	176.7	48.9	0	0	0	0	112.9	D82 T83	S80-D82 PolarHBondContact O-N 2.77Å; S80-T83 VanDerWaalsContact O-CB 3.32Å; S80-T83 WeakPolarHBondContact O-CB 3.42Å; S80-T83 PolarHBondContact O-N 2.93Å; S80-T83 PolarHBondContact O-OG1 3.39Å
81	E	88.3	Confident	93.5	Very high	126 Å²	126	60.3 Å²	60.3	59%	0.589	35%	0.354	S	S	*	.	G	3₁₀ helix	trans	-69.7	-15.1	179	-60.8	-179	174	0	0	114.3	K30 R32 T79 T83	K30-E81 PolarHBondContact NZ-O 2.8Å; R32-E81 PolarHBondContact NH1-O 3.09Å; T79-E81 PolarHBondContact O-N 3.01Å; T79-E81 VanDerWaalsContact O-N 3.17Å; E81-T83 VanDerWaalsContact C-N 3.3Å
82	D	90.4	Very high	93.2	Very high	23 Å²	23	64.6 Å²	64.6	12%	0.123	38%	0.379	C	S	.	.	G	3₁₀ helix	trans	-85.1	-7.3	175.7	-56.4	-52.6	0	0	0	112.8	K59 L78 T79 S80 A84	K59-D82 VanDerWaalsContact CE-OD2 3.23Å; K59-D82 WeakPolarHBondContact CE-OD2 3.38Å; K59-D82 IonicContact NZ-OD1 2.79Å; K59-D82 PolarHBondContact NZ-OD1 3.49Å; K59-D82 IonicContact NZ-OD2 2.58Å; K59-D82 PolarHBondContact NZ-OD2 2.91Å; L78-D82 WeakPolarHBondContact CA-OD2 3.46Å; L78-D82 HydrophobicContact CD2-CB 3.71Å; T79-D82 PolarHBondContact N-OD2 3.4Å; T79-D82 PolarHBondContact O-N 2.61Å; T79-D82 VanDerWaalsContact O-N 3.09Å; T79-D82 PolarHBondContact OG1-OD2 3.34Å; S80-D82 PolarHBondContact O-N 2.77Å; D82-A84 PolarHBondContact O-N 2.62Å; D82-A84 VanDerWaalsContact O-N 3.13Å
83	T	91.4	Very high	92.8	Very high	107 Å²	107	65.2 Å²	65.2	66%	0.656	39%	0.391	S	S	*	.			trans	-66	112	176	-50.3	0	0	0	0	109.5	R32 S80 E81	R32-T83 WeakPolarHBondContact CD-O 3.31Å; R32-T83 WeakPolarHBondContact CG-O 3.46Å; S80-T83 VanDerWaalsContact O-CB 3.32Å; S80-T83 WeakPolarHBondContact O-CB 3.42Å; S80-T83 PolarHBondContact O-N 2.93Å; S80-T83 PolarHBondContact O-OG1 3.39Å; E81-T83 VanDerWaalsContact C-N 3.3Å
84	A	91.4	Very high	92.5	Very high	41 Å²	41	69.3 Å²	69.3	34%	0.339	42%	0.418	S	S	.	.			trans	-164.1	170.4	-175.7	0	0	0	0	0	110.1	K30 Q31 R32 D82	K30-A84 HydrophobicContact CB-CB 3.68Å; K30-A84 HydrophobicContact CD-CB 4.14Å; K30-A84 HydrophobicContact CG-CB 4.18Å; Q31-A84 WeakPolarHBondContact O-CA 3.1Å; Q31-A84 WeakPolarHBondContact O-CB 2.99Å; R32-A84 HydrophobicContact CG-CB 3.84Å; D82-A84 PolarHBondContact O-N 2.62Å; D82-A84 VanDerWaalsContact O-N 3.13Å
85	V	88.7	Confident	92.1	Very high	144 Å²	144	68.1 Å²	68.1	87%	0.873	42%	0.421	S	S	*	.			trans	-86.8	0	165.2	-179.7	0	0	0	0	109.6	K30 Q31	K30-V85 CarbonylContact C-O 3.46Å; K30-V85 VanDerWaalsContact CA-O 3.31Å; K30-V85 WeakPolarHBondContact CA-O 3.37Å; Q31-V85 PolarHBondContact N-O 2.78Å; Q31-V85 PolarHBondContact O-N 2.79Å

Retrieved 85 of 85 residues in 26 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).