X5J551_MOUSE Loading...

IgG1 heavy chain VDJ region

AlphaFold DB , UniProt , Accession X5J551, Species MOUSE (Mus musculus, Mouse), Gene n/a, Length 113 aa.

						>X5J551_MOUSE|X5J551
AELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCARRNGNYVSTTLTTGAKAPLSQSPQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	51.5	Low	74.8	Confident	112 Å²	112	81.3 Å²	81.3	93%	0.926	48%	0.483	S	S	*	.				0	114.1	0	0	0	0	0	0	107.7	T101	A1-T101 VanDerWaalsContact CB-OG1 3.27Å; A1-T101 WeakPolarHBondContact CB-OG1 3.33Å
2	E	57.2	Low	76.2	Confident	98 Å²	98	74.9 Å²	74.9	46%	0.458	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	118	175.7	-177.9	-179	177.3	0	0	109.1	V4 V10 L100 T101	E2-V4 HydrophobicContact CG-CG2 3.94Å; E2-V10 WeakPolarHBondContact OE1-CG2 3.49Å; E2-L100 HydrophobicContact CB-CD1 3.99Å; E2-L100 HydrophobicContact CG-CD1 4.37Å; E2-T101 CarbonylContact C-O 3.5Å; E2-T101 CarbonylContact O-C 3.58Å; E2-T101 VanDerWaalsContact O-C 3.24Å; E2-T101 PolarHBondContact O-N 2.82Å
3	L	63.4	Low	77.4	Confident	137 Å²	137	74.8 Å²	74.8	72%	0.717	45%	0.45	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.3	108.5	-178.4	-166	77.2	0	0	0	111.1	T101	L3-T101 VanDerWaalsContact CA-O 3.26Å; L3-T101 WeakPolarHBondContact CA-O 3.37Å
4	V	70.3	Confident	78.3	Confident	16 Å²	16	69.9 Å²	69.9	10%	0.097	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	140.2	-176.2	-167.1	0	0	0	0	111.3	E2 A8 V10 L78 L100 T102 G103	E2-V4 HydrophobicContact CG-CG2 3.94Å; V4-A8 HydrophobicContact CG1-CB 3.8Å; V4-V10 HydrophobicContact CG2-CB 4.28Å; V4-V10 HydrophobicContact CG2-CG2 4.12Å; V4-L78 HydrophobicContact CB-CD1 4.03Å; V4-L78 HydrophobicContact CG1-CD1 3.64Å; V4-L100 HydrophobicContact CG2-CD1 3.95Å; V4-T102 HydrophobicContact CB-CG2 4.36Å; V4-G103 PolarHBondContact O-N 2.79Å
5	K	73.8	Confident	79.2	Confident	173 Å²	173	70.8 Å²	70.8	75%	0.752	43%	0.427	S	S	*	.			trans	-69.4	144.7	176.8	-67	178.7	-176.7	176.7	0	110.9	A8	K5-A8 HydrophobicContact CB-CB 4.46Å; K5-A8 VanDerWaalsContact O-CB 3.26Å; K5-A8 WeakPolarHBondContact O-CB 3.44Å; K5-A8 PolarHBondContact O-N 3.25Å
6	P	74.5	Confident	79.5	Confident	81 Å²	81	66.9 Å²	66.9	53%	0.526	41%	0.405	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.7	143.4	170.4	-22.8	34	0	0	0	111.4	A8 L78 G103	P6-A8 PolarHBondContact O-N 3.21Å; P6-L78 CarbonylContact C-O 3.51Å; P6-L78 WeakPolarHBondContact CA-O 3.36Å; P6-G103 WeakPolarHBondContact CD-O 3.39Å
7	G	79.1	Confident	79.9	Confident	52 Å²	52	69.1 Å²	69.1	54%	0.536	42%	0.423	S	S	.	.	T	Hydrogen-bonded Turn	trans	78.3	-13	-176.1	0	0	0	0	0	114.8	L78	G7-L78 PolarHBondContact N-O 3.01Å
8	A	85.3	Confident	80.1	Confident	36 Å²	36	70.4 Å²	70.4	30%	0.298	45%	0.454	S	S	.	.			trans	-75.5	166.1	174.4	0	0	0	0	0	111.4	V4 K5 P6 S77 L78	V4-A8 HydrophobicContact CG1-CB 3.8Å; K5-A8 HydrophobicContact CB-CB 4.46Å; K5-A8 VanDerWaalsContact O-CB 3.26Å; K5-A8 WeakPolarHBondContact O-CB 3.44Å; K5-A8 PolarHBondContact O-N 3.25Å; P6-A8 PolarHBondContact O-N 3.21Å; A8-S77 PolarHBondContact O-N 2.87Å; A8-L78 WeakPolarHBondContact O-CB 3.48Å; A8-L78 VanDerWaalsContact O-CG 3.31Å; A8-L78 WeakPolarHBondContact O-CG 3.47Å; A8-L78 PolarHBondContact O-N 2.98Å
9	S	88.1	Confident	80.3	Confident	65 Å²	65	69.1 Å²	69.1	46%	0.455	44%	0.44	S	S	.	.			trans	-106.6	148.8	170.9	-55.9	0	0	0	0	109.8	L75 S76	S9-L75 CarbonylContact C-O 3.58Å; S9-L75 WeakPolarHBondContact CA-O 3.24Å; S9-L75 WeakPolarHBondContact CB-O 3.18Å; S9-S76 WeakPolarHBondContact OG-CA 3.35Å
10	V	89.3	Confident	80.7	Confident	6 Å²	6	69.3 Å²	69.3	4%	0.036	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	149.5	173.9	70.4	0	0	0	0	109.8	E2 V4 L12 Q74 L75 L78 L100	E2-V10 WeakPolarHBondContact OE1-CG2 3.49Å; V4-V10 HydrophobicContact CG2-CB 4.28Å; V4-V10 HydrophobicContact CG2-CG2 4.12Å; V10-L12 HydrophobicContact CG2-CD2 4.22Å; V10-Q74 CarbonylContact O-C 3.57Å; V10-Q74 VanDerWaalsContact O-CA 3.27Å; V10-Q74 WeakPolarHBondContact O-CA 3.42Å; V10-L75 HydrophobicContact CG1-CB 4.13Å; V10-L75 HydrophobicContact CG1-CD1 4.4Å; V10-L75 PolarHBondContact N-O 2.79Å; V10-L75 PolarHBondContact O-N 2.93Å; V10-L78 HydrophobicContact CB-CD1 3.95Å; V10-L78 HydrophobicContact CG1-CD1 3.74Å; V10-L78 HydrophobicContact CG1-CD2 4.4Å; V10-L100 HydrophobicContact CG1-CD1 4.33Å; V10-L100 HydrophobicContact CG1-CD2 3.73Å; V10-L100 HydrophobicContact CG2-CD1 4.06Å
11	K	90.9	Very high	81.2	Confident	118 Å²	118	66 Å²	66	51%	0.513	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.2	108.8	173.4	-175.5	179	177.6	-177.2	0	109.3	Y72 L73	K11-Y72 HydrophobicContact CD-CD1 4.37Å; K11-Y72 HydrophobicContact CG-CD1 4.35Å; K11-L73 CarbonylContact C-O 3.57Å; K11-L73 WeakPolarHBondContact CA-O 3.45Å
12	L	90.8	Very high	83.1	Confident	5 Å²	5	65.1 Å²	65.1	3%	0.026	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84	145	173.8	-54.8	178.6	0	0	0	109.6	V10 W28 Y72 L73 Y86 T98 L100	V10-L12 HydrophobicContact CG2-CD2 4.22Å; L12-W28 HydrophobicContact CB-CH2 3.95Å; L12-W28 HydrophobicContact CB-CZ3 3.99Å; L12-W28 HydrophobicContact CD1-CZ3 4.33Å; L12-Y72 CarbonylContact O-C 3.59Å; L12-Y72 WeakPolarHBondContact O-CA 3.14Å; L12-L73 HydrophobicContact CB-CB 4.42Å; L12-L73 HydrophobicContact CD1-CD2 4.25Å; L12-L73 PolarHBondContact N-O 2.01Å; L12-L73 PolarHBondContact O-N 3.34Å; L12-Y86 HydrophobicContact CD1-CD1 4.18Å; L12-Y86 HydrophobicContact CD1-CD2 4.21Å; L12-Y86 HydrophobicContact CD1-CG 3.74Å; L12-T98 HydrophobicContact CD1-CG2 4.24Å; L12-T98 HydrophobicContact CD2-CG2 4.34Å; L12-L100 HydrophobicContact CD2-CB 4.48Å; L12-L100 HydrophobicContact CD2-CD1 4.22Å; L12-L100 HydrophobicContact CD2-CD2 4.49Å
13	S	91.9	Very high	84.6	Confident	73 Å²	73	66.8 Å²	66.8	51%	0.51	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	150.1	174.9	60.3	0	0	0	0	111.3	A71	S13-A71 CarbonylContact C-O 3.54Å; S13-A71 WeakPolarHBondContact CA-O 3.24Å
14	C	90.7	Very high	85.7	Confident	6 Å²	6	60.9 Å²	60.9	4%	0.041	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.1	101.4	177.2	177.5	0	0	0	0	109.5	W28 T70 A71 C88	C14-W28 HydrophobicContact CB-CH2 3.8Å; C14-W28 HydrophobicContact CB-CZ2 3.89Å; C14-T70 CarbonylContact O-C 3.38Å; C14-T70 WeakPolarHBondContact O-CA 3.41Å; C14-A71 PolarHBondContact N-O 3.12Å; C14-A71 PolarHBondContact O-N 3.25Å; C14-C88 HydrophobicContact CB-CB 3.52Å; C14-C88 WeakPolarHBondContact CB-SG 3.3Å; C14-C88 WeakPolarHBondContact SG-CB 3.4Å; C14-C88 CovalentContact SG-SG 2.01Å; C14-C88 PolarHBondContact SG-SG 3.45Å
15	T	91.1	Very high	86.7	Confident	84 Å²	84	63 Å²	63	52%	0.515	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	122.4	179.5	-55.1	0	0	0	0	110	T70	T15-T70 WeakPolarHBondContact CB-OG1 3.3Å; T15-T70 WeakPolarHBondContact CG2-OG1 3.19Å; T15-T70 PolarHBondContact OG1-OG1 2.91Å
16	A	84.9	Confident	87.5	Confident	8 Å²	8	55 Å²	55	7%	0.066	35%	0.346	C	S	.	.			trans	-73.4	133.3	174.2	0	0	0	0	0	110.1	F19 I21 N69	A16-F19 HydrophobicContact CB-CD1 4.35Å; A16-F19 HydrophobicContact CB-CD2 4.15Å; A16-F19 HydrophobicContact CB-CE1 3.73Å; A16-F19 HydrophobicContact CB-CE2 3.49Å; A16-F19 VanDerWaalsContact CB-CE2 3.49Å; A16-F19 HydrophobicContact CB-CZ 3.26Å; A16-I21 HydrophobicContact CB-CB 4.2Å; A16-I21 HydrophobicContact CB-CD1 4.23Å; A16-I21 HydrophobicContact CB-CG1 4.26Å; A16-N69 WeakPolarHBondContact CB-ND2 3.42Å; A16-N69 PolarHBondContact N-O 3.28Å; A16-N69 PolarHBondContact O-ND2 2.78Å
17	S	85.4	Confident	88.4	Confident	104 Å²	104	53.2 Å²	53.2	73%	0.727	33%	0.331	S	S	*	.			trans	-121.3	141.7	171.9	71.7	0	0	0	0	110	F19	S17-F19 VanDerWaalsContact C-N 3.27Å; S17-F19 VanDerWaalsContact O-CD1 3.24Å; S17-F19 WeakPolarHBondContact O-CD1 3.36Å; S17-F19 PolarHBondContact O-N 3.44Å
18	G	84.6	Confident	89.1	Confident	94 Å²	94	50.8 Å²	50.8	97%	0.969	31%	0.305	S	S	*	.	S	Bend	trans	74.5	7.9	179	0	0	0	0	0	115.7
19	F	82.7	Confident	89.4	Confident	45 Å²	45	50 Å²	50	20%	0.197	30%	0.297	C	S	.	.	S	Bend	trans	-155.8	158.6	171.1	65.4	-84.6	0	0	0	111.4	A16 S17 T24 M26 N69 R90	A16-F19 HydrophobicContact CB-CD1 4.35Å; A16-F19 HydrophobicContact CB-CD2 4.15Å; A16-F19 HydrophobicContact CB-CE1 3.73Å; A16-F19 HydrophobicContact CB-CE2 3.49Å; A16-F19 VanDerWaalsContact CB-CE2 3.49Å; A16-F19 HydrophobicContact CB-CZ 3.26Å; S17-F19 VanDerWaalsContact C-N 3.27Å; S17-F19 VanDerWaalsContact O-CD1 3.24Å; S17-F19 WeakPolarHBondContact O-CD1 3.36Å; S17-F19 PolarHBondContact O-N 3.44Å; F19-T24 HydrophobicContact CD2-CG2 4.11Å; F19-T24 HydrophobicContact CE2-CG2 3.71Å; F19-M26 HydrophobicContact CE2-SD 4.3Å; F19-M26 HydrophobicContact CZ-SD 4.36Å; F19-N69 PolarHBondContact O-ND2 2.87Å; F19-R90 VanDerWaalsContact CB-NH1 3.34Å; F19-R90 HydrophobicContact CE2-CG 4.31Å; F19-R90 VanDerWaalsContact CG-NH1 3.27Å; F19-R90 HydrophobicContact CZ-CB 4.45Å; F19-R90 HydrophobicContact CZ-CG 4.37Å
20	N	89.1	Confident	89.5	Confident	73 Å²	73	47.1 Å²	47.1	39%	0.39	28%	0.276	S	S	.	.			trans	-81.8	123.7	171	178.8	-5.3	0	0	0	109.8	K22 D23	N20-K22 PolarHBondContact O-N 2.84Å; N20-K22 VanDerWaalsContact O-N 3.17Å; N20-K22 WeakPolarHBondContact OD1-CB 3.39Å; N20-K22 PolarHBondContact OD1-N 2.74Å; N20-D23 WeakPolarHBondContact CB-OD2 3.4Å; N20-D23 PolarHBondContact O-N 3.02Å; N20-D23 VanDerWaalsContact O-N 3.1Å
21	I	89.9	Confident	89.4	Confident	0 Å²	0	50.1 Å²	50.1	0%	0	29%	0.289	C	S	.	.	G	3₁₀ helix	trans	-62.6	-23	-176	-156.7	166.8	0	0	0	112.5	A16 D23 M26 P45 T66 N69 A71	A16-I21 HydrophobicContact CB-CB 4.2Å; A16-I21 HydrophobicContact CB-CD1 4.23Å; A16-I21 HydrophobicContact CB-CG1 4.26Å; I21-D23 PolarHBondContact O-N 3.47Å; I21-M26 HydrophobicContact CD1-CG 3.94Å; I21-M26 HydrophobicContact CD1-SD 4.42Å; I21-M26 HydrophobicContact CG1-CG 3.64Å; I21-M26 HydrophobicContact CG1-SD 4.03Å; I21-P45 HydrophobicContact CG1-CB 4.38Å; I21-P45 HydrophobicContact CG1-CG 3.97Å; I21-P45 HydrophobicContact CG2-CB 4.11Å; I21-P45 VanDerWaalsContact O-CG 3.23Å; I21-P45 WeakPolarHBondContact O-CG 3.26Å; I21-T66 HydrophobicContact CG2-CG2 4.2Å; I21-N69 WeakPolarHBondContact CB-OD1 3.25Å; I21-N69 VanDerWaalsContact CG2-OD1 3.29Å; I21-N69 WeakPolarHBondContact CG2-OD1 3.37Å; I21-N69 PolarHBondContact N-OD1 3.28Å; I21-A71 HydrophobicContact CD1-CB 3.98Å
22	K	92.1	Very high	89.1	Confident	94 Å²	94	47.3 Å²	47.3	41%	0.409	28%	0.276	S	S	.	.	G	3₁₀ helix	trans	-66	-23.1	175.8	-67.7	-173	-179.6	-176.1	0	113.6	N20 T24 A46 T66	N20-K22 PolarHBondContact O-N 2.84Å; N20-K22 VanDerWaalsContact O-N 3.17Å; N20-K22 WeakPolarHBondContact OD1-CB 3.39Å; N20-K22 PolarHBondContact OD1-N 2.74Å; K22-T24 PolarHBondContact O-N 2.69Å; K22-A46 HydrophobicContact CB-CB 4.4Å; K22-T66 HydrophobicContact CD-CG2 4.18Å; K22-T66 VanDerWaalsContact CE-CG2 3.49Å; K22-T66 WeakPolarHBondContact CE-OG1 3.37Å; K22-T66 HydrophobicContact CG-CG2 3.61Å
23	D	89.6	Confident	88.5	Confident	132 Å²	132	53.3 Å²	53.3	71%	0.706	32%	0.315	S	S	*	.	G	3₁₀ helix	trans	-85.8	7.3	-172	-57.9	-26.7	0	0	0	113	N20 I21	N20-D23 WeakPolarHBondContact CB-OD2 3.4Å; N20-D23 PolarHBondContact O-N 3.02Å; N20-D23 VanDerWaalsContact O-N 3.1Å; I21-D23 PolarHBondContact O-N 3.47Å
24	T	86.4	Confident	87.9	Confident	13 Å²	13	59.1 Å²	59.1	8%	0.08	33%	0.334	C	S	.	.	S	Bend	trans	-154.6	156.7	-172.6	-175.6	0	0	0	0	112.6	F19 K22 M26 P45 R90	F19-T24 HydrophobicContact CD2-CG2 4.11Å; F19-T24 HydrophobicContact CE2-CG2 3.71Å; K22-T24 PolarHBondContact O-N 2.69Å; T24-M26 HydrophobicContact CG2-SD 4.05Å; T24-P45 WeakPolarHBondContact O-CD 2.99Å; T24-R90 HydrophobicContact CG2-CG 3.53Å; T24-R90 WeakPolarHBondContact OG1-CG 3.45Å
25	Y	90.8	Very high	87.1	Confident	60 Å²	60	63.5 Å²	63.5	24%	0.235	35%	0.354	C	S	.	.			trans	-74.2	139.9	161.9	-58	-67.6	0	0	0	111.2	R42 I43 D44 R91	Y25-R42 VanDerWaalsContact CE1-CZ 3.49Å; Y25-I43 WeakPolarHBondContact CA-O 3.37Å; Y25-D44 HydrophobicContact CD1-CB 3.78Å; Y25-D44 HydrophobicContact CE1-CB 3.56Å; Y25-D44 WeakPolarHBondContact CE1-OD2 3.21Å; Y25-R91 PolarHBondContact O-N 3.23Å
26	M	90.8	Very high	86.8	Confident	5 Å²	5	62.1 Å²	62.1	3%	0.025	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	117.9	171.3	-66.3	-57.5	-62	0	0	108.9	F19 I21 T24 R42 I43 P45 A71 C88	F19-M26 HydrophobicContact CE2-SD 4.3Å; F19-M26 HydrophobicContact CZ-SD 4.36Å; I21-M26 HydrophobicContact CD1-CG 3.94Å; I21-M26 HydrophobicContact CD1-SD 4.42Å; I21-M26 HydrophobicContact CG1-CG 3.64Å; I21-M26 HydrophobicContact CG1-SD 4.03Å; T24-M26 HydrophobicContact CG2-SD 4.05Å; M26-R42 CarbonylContact O-C 3.52Å; M26-R42 WeakPolarHBondContact O-CA 3.22Å; M26-R42 WeakPolarHBondContact O-CB 3.32Å; M26-I43 HydrophobicContact CB-CG2 3.97Å; M26-I43 PolarHBondContact N-O 2.79Å; M26-I43 PolarHBondContact O-N 2.91Å; M26-P45 HydrophobicContact CG-CG 4.06Å; M26-A71 HydrophobicContact CB-CB 4.15Å; M26-A71 HydrophobicContact CG-CB 4.26Å; M26-C88 HydrophobicContact CE-CB 4.48Å
27	H	92.8	Very high	86.9	Confident	45 Å²	45	66.9 Å²	66.9	21%	0.208	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	146.1	-178.8	-65.9	-108.5	0	0	0	110	W39 G41 C88 A89	H27-W39 AromaticContact CG-NE1 3.97Å; H27-W39 AromaticContact ND1-NE1 3.21Å; H27-W39 PolarHBondContact ND1-NE1 2.8Å; H27-G41 WeakPolarHBondContact CA-O 3.48Å; H27-C88 CarbonylContact O-C 3.51Å; H27-C88 WeakPolarHBondContact O-CA 3.5Å; H27-A89 HydrophobicContact CB-CB 4.45Å; H27-A89 PolarHBondContact N-O 3.4Å; H27-A89 PolarHBondContact O-N 3.05Å
28	W	94.1	Very high	87.3	Confident	1 Å²	1	63.2 Å²	63.2	0%	0.004	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.2	135.6	170.9	-72.7	95.1	0	0	0	110	L12 C14 I40 G41 A71 L73 Y87 C88	L12-W28 HydrophobicContact CB-CH2 3.95Å; L12-W28 HydrophobicContact CB-CZ3 3.99Å; L12-W28 HydrophobicContact CD1-CZ3 4.33Å; C14-W28 HydrophobicContact CB-CH2 3.8Å; C14-W28 HydrophobicContact CB-CZ2 3.89Å; W28-I40 HydrophobicContact CB-CB 4.14Å; W28-I40 HydrophobicContact CB-CD1 4.33Å; W28-I40 WeakPolarHBondContact O-CB 3.27Å; W28-I40 PolarHBondContact O-N 3.06Å; W28-G41 PolarHBondContact N-O 3.47Å; W28-A71 HydrophobicContact CZ2-CB 4.43Å; W28-L73 HydrophobicContact CB-CD2 4.13Å; W28-L73 HydrophobicContact CD2-CB 3.48Å; W28-L73 VanDerWaalsContact CD2-CB 3.48Å; W28-L73 HydrophobicContact CD2-CD2 3.88Å; W28-L73 HydrophobicContact CD2-CG 4.25Å; W28-L73 VanDerWaalsContact CE2-CB 3.49Å; W28-L73 HydrophobicContact CE3-CB 3.7Å; W28-L73 HydrophobicContact CE3-CD2 3.64Å; W28-L73 HydrophobicContact CE3-CG 4.32Å; W28-L73 HydrophobicContact CG-CB 4.02Å; W28-L73 HydrophobicContact CG-CD2 4.11Å; W28-L73 HydrophobicContact CG-CG 4.49Å; W28-L73 HydrophobicContact CH2-CB 3.93Å; W28-L73 HydrophobicContact CZ2-CB 3.73Å; W28-L73 HydrophobicContact CZ3-CB 3.91Å; W28-L73 HydrophobicContact CZ3-CD2 4.3Å; W28-Y87 CarbonylContact C-O 3.45Å; W28-Y87 WeakPolarHBondContact CA-O 3.29Å; W28-C88 HydrophobicContact CD2-CB 4.28Å; W28-C88 HydrophobicContact CE3-CB 4.13Å; W28-C88 HydrophobicContact CH2-CB 4.18Å; W28-C88 HydrophobicContact CZ2-CB 4.29Å; W28-C88 HydrophobicContact CZ3-CB 4.1Å
29	V	91.5	Very high	87.7	Confident	20 Å²	20	62.9 Å²	62.9	12%	0.121	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137	137.6	-174.9	-175.8	0	0	0	0	108.9	L37 E38 Y86 Y87	V29-L37 HydrophobicContact CG1-CB 3.77Å; V29-L37 HydrophobicContact CG1-CD2 3.88Å; V29-L37 HydrophobicContact CG1-CG 4.3Å; V29-E38 CarbonylContact C-O 3.54Å; V29-E38 WeakPolarHBondContact CA-O 3.26Å; V29-E38 WeakPolarHBondContact CG1-O 3.43Å; V29-Y86 CarbonylContact O-C 3.56Å; V29-Y86 WeakPolarHBondContact O-CA 3.49Å; V29-Y87 PolarHBondContact N-O 2.79Å; V29-Y87 PolarHBondContact O-N 3.35Å
30	K	90.5	Very high	88.3	Confident	3 Å²	3	60.8 Å²	60.8	1%	0.013	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	137.4	173.1	-178.2	-177.8	178.6	-177	0	109.1	E38 I40 F56 E81 D82 A84 V85 Y86	K30-E38 HydrophobicContact CB-CB 4.33Å; K30-E38 PolarHBondContact N-O 3.24Å; K30-E38 PolarHBondContact O-N 3.22Å; K30-I40 HydrophobicContact CB-CD1 4.06Å; K30-I40 HydrophobicContact CB-CG1 4.19Å; K30-F56 HydrophobicContact CD-CE1 4.08Å; K30-F56 HydrophobicContact CD-CZ 4.09Å; K30-E81 WeakPolarHBondContact CE-O 3.27Å; K30-E81 PolarHBondContact NZ-O 2.96Å; K30-D82 IonicContact NZ-OD1 3.79Å; K30-A84 HydrophobicContact CD-CB 4.08Å; K30-A84 HydrophobicContact CG-CB 3.4Å; K30-A84 VanDerWaalsContact CG-CB 3.4Å; K30-V85 CarbonylContact C-O 3.57Å; K30-Y86 HydrophobicContact CB-CD1 4.27Å; K30-Y86 HydrophobicContact CB-CE1 3.99Å; K30-Y86 HydrophobicContact CD-CE1 4.16Å; K30-Y86 HydrophobicContact CG-CD1 4.48Å; K30-Y86 HydrophobicContact CG-CE1 3.9Å
31	Q	87.2	Confident	88.7	Confident	69 Å²	69	57.3 Å²	57.3	32%	0.322	29%	0.293	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	125.9	172.7	-170.5	-176.7	29.7	0	0	109.9	L37 A84 V85 Y87	Q31-L37 HydrophobicContact CB-CD2 3.74Å; Q31-L37 HydrophobicContact CG-CD2 3.82Å; Q31-A84 WeakPolarHBondContact O-CA 3.38Å; Q31-A84 VanDerWaalsContact O-CB 3.24Å; Q31-A84 WeakPolarHBondContact O-CB 3.34Å; Q31-V85 HydrophobicContact CB-CB 4.45Å; Q31-V85 PolarHBondContact N-O 3.27Å; Q31-V85 PolarHBondContact O-N 2.79Å; Q31-Y87 HydrophobicContact CB-CD2 4.25Å; Q31-Y87 HydrophobicContact CB-CE2 3.62Å; Q31-Y87 HydrophobicContact CG-CE2 4.44Å; Q31-Y87 VanDerWaalsContact OE1-CZ 3.31Å; Q31-Y87 PolarHBondContact OE1-OH 2.93Å
32	R	84.5	Confident	88.9	Confident	59 Å²	59	59 Å²	59	22%	0.223	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.1	152	172.1	-54.3	-176.5	-146.7	-174.5	-2.3	109.1	E34 Q35 E38 A84	R32-E34 PolarHBondContact O-N 2.7Å; R32-Q35 HydrophobicContact CB-CB 3.76Å; R32-Q35 VanDerWaalsContact CD-OE1 3.29Å; R32-Q35 HydrophobicContact CG-CB 4.3Å; R32-Q35 PolarHBondContact N-O 2.68Å; R32-Q35 VanDerWaalsContact NH1-OE1 3.08Å; R32-Q35 PolarHBondContact O-N 3.21Å; R32-E38 IonicContact CZ-OE2 3.16Å; R32-E38 IonicContact NE-OE2 2.87Å; R32-E38 PolarHBondContact NE-OE2 3.2Å; R32-E38 IonicContact NH2-OE1 3.47Å; R32-E38 PolarHBondContact NH2-OE1 3.34Å; R32-E38 IonicContact NH2-OE2 2.74Å; R32-E38 PolarHBondContact NH2-OE2 2.61Å; R32-A84 HydrophobicContact CG-CB 4.17Å
33	P	77.3	Confident	89.1	Confident	132 Å²	132	54.9 Å²	54.9	86%	0.857	28%	0.282	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.8	-34.8	178.3	-26	35	0	0	0	113.5
34	E	80.1	Confident	89.4	Confident	194 Å²	194	49.5 Å²	49.5	91%	0.907	25%	0.253	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.9	-4.6	-175.9	-60.4	-86.8	152.9	0	0	113	R32	R32-E34 PolarHBondContact O-N 2.7Å
35	Q	74.2	Confident	89.8	Confident	98 Å²	98	49.3 Å²	49.3	46%	0.458	25%	0.253	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.8	138.9	-169	-136.4	163.7	11.7	0	0	110	R32	R32-Q35 HydrophobicContact CB-CB 3.76Å; R32-Q35 VanDerWaalsContact CD-OE1 3.29Å; R32-Q35 HydrophobicContact CG-CB 4.3Å; R32-Q35 PolarHBondContact N-O 2.68Å; R32-Q35 VanDerWaalsContact NH1-OE1 3.08Å; R32-Q35 PolarHBondContact O-N 3.21Å
36	G	84.2	Confident	90	Very high	55 Å²	55	49.4 Å²	49.4	57%	0.567	27%	0.266	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-58.8	-179	-179.8	0	0	0	0	0	113.9	E38	G36-E38 PolarHBondContact O-N 2.76Å
37	L	88.1	Confident	90.2	Very high	109 Å²	109	54.3 Å²	54.3	57%	0.571	29%	0.292	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-64.4	122.3	176	-64.7	176.3	0	0	0	110.8	V29 Q31	V29-L37 HydrophobicContact CG1-CB 3.77Å; V29-L37 HydrophobicContact CG1-CD2 3.88Å; V29-L37 HydrophobicContact CG1-CG 4.3Å; Q31-L37 HydrophobicContact CB-CD2 3.74Å; Q31-L37 HydrophobicContact CG-CD2 3.82Å
38	E	92.4	Very high	90.3	Very high	27 Å²	27	54.2 Å²	54.2	13%	0.126	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	116.7	173.8	-63.4	-174.8	99.1	0	0	109.4	V29 K30 R32 G36 I40 K55 F56	V29-E38 CarbonylContact C-O 3.54Å; V29-E38 WeakPolarHBondContact CA-O 3.26Å; V29-E38 WeakPolarHBondContact CG1-O 3.43Å; K30-E38 HydrophobicContact CB-CB 4.33Å; K30-E38 PolarHBondContact N-O 3.24Å; K30-E38 PolarHBondContact O-N 3.22Å; R32-E38 IonicContact CZ-OE2 3.16Å; R32-E38 IonicContact NE-OE2 2.87Å; R32-E38 PolarHBondContact NE-OE2 3.2Å; R32-E38 IonicContact NH2-OE1 3.47Å; R32-E38 PolarHBondContact NH2-OE1 3.34Å; R32-E38 IonicContact NH2-OE2 2.74Å; R32-E38 PolarHBondContact NH2-OE2 2.61Å; G36-E38 PolarHBondContact O-N 2.76Å; E38-I40 PolarHBondContact O-N 3.02Å; E38-K55 IonicContact OE1-NZ 3.94Å; E38-F56 HydrophobicContact CB-CE2 4.46Å; E38-F56 HydrophobicContact CB-CZ 4.36Å
39	W	93.7	Very high	90.4	Very high	87 Å²	87	58.1 Å²	58.1	33%	0.33	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.5	126.7	176	-178	69.1	0	0	0	110.3	H27 G41 R42 K51 D53	H27-W39 AromaticContact CG-NE1 3.97Å; H27-W39 AromaticContact ND1-NE1 3.21Å; H27-W39 PolarHBondContact ND1-NE1 2.8Å; W39-G41 VanDerWaalsContact CE2-C 3.43Å; W39-G41 VanDerWaalsContact CE2-CA 3.49Å; W39-G41 PolarHBondContact NE1-O 2.79Å; W39-R42 HydrophobicContact CZ2-CB 4Å; W39-R42 HydrophobicContact CZ2-CG 4Å; W39-K51 HydrophobicContact CH2-CB 4.09Å; W39-D53 HydrophobicContact CE3-CB 3.94Å; W39-D53 HydrophobicContact CZ3-CB 4.21Å; W39-D53 WeakPolarHBondContact O-CB 3.36Å
40	I	95.6	Very high	90.7	Very high	0 Å²	0	59.6 Å²	59.6	0%	0	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.1	-46.2	-179.9	-62.1	172.9	0	0	0	110	W28 K30 E38 Y52 D53 F56 A60 L73 Y86	W28-I40 HydrophobicContact CB-CB 4.14Å; W28-I40 HydrophobicContact CB-CD1 4.33Å; W28-I40 WeakPolarHBondContact O-CB 3.27Å; W28-I40 PolarHBondContact O-N 3.06Å; K30-I40 HydrophobicContact CB-CD1 4.06Å; K30-I40 HydrophobicContact CB-CG1 4.19Å; E38-I40 PolarHBondContact O-N 3.02Å; I40-Y52 WeakPolarHBondContact O-CA 3.49Å; I40-D53 PolarHBondContact O-N 2.73Å; I40-F56 HydrophobicContact CB-CD2 4.34Å; I40-F56 HydrophobicContact CB-CG 4.28Å; I40-F56 HydrophobicContact CG1-CD1 4.11Å; I40-F56 HydrophobicContact CG1-CD2 4.29Å; I40-F56 HydrophobicContact CG1-CE1 3.99Å; I40-F56 HydrophobicContact CG1-CE2 4.15Å; I40-F56 HydrophobicContact CG1-CG 4.25Å; I40-F56 HydrophobicContact CG1-CZ 4Å; I40-F56 HydrophobicContact CG2-CB 3.9Å; I40-F56 HydrophobicContact CG2-CD1 4.15Å; I40-F56 HydrophobicContact CG2-CD2 4.42Å; I40-F56 HydrophobicContact CG2-CG 3.91Å; I40-A60 HydrophobicContact CG2-CB 3.69Å; I40-L73 HydrophobicContact CD1-CD2 3.67Å; I40-L73 HydrophobicContact CG2-CD1 4.21Å; I40-Y86 HydrophobicContact CD1-CD1 3.65Å; I40-Y86 HydrophobicContact CD1-CE1 3.73Å
41	G	96.4	Very high	91	Very high	0 Å²	0	65 Å²	65	0%	0	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	169	-178.9	-172.7	0	0	0	0	0	113.2	H27 W28 W39 K51	H27-G41 WeakPolarHBondContact CA-O 3.48Å; W28-G41 PolarHBondContact N-O 3.47Å; W39-G41 VanDerWaalsContact CE2-C 3.43Å; W39-G41 VanDerWaalsContact CE2-CA 3.49Å; W39-G41 PolarHBondContact NE1-O 2.79Å; G41-K51 CarbonylContact C-O 3.56Å; G41-K51 WeakPolarHBondContact CA-O 3.47Å
42	R	95.4	Very high	91.5	Very high	36 Å²	36	64.5 Å²	64.5	14%	0.136	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.3	159.5	171.7	71.2	165.6	-177.9	78.7	-12.3	111.7	Y25 M26 W39 T50 K51	Y25-R42 VanDerWaalsContact CE1-CZ 3.49Å; M26-R42 CarbonylContact O-C 3.52Å; M26-R42 WeakPolarHBondContact O-CA 3.22Å; M26-R42 WeakPolarHBondContact O-CB 3.32Å; W39-R42 HydrophobicContact CZ2-CB 4Å; W39-R42 HydrophobicContact CZ2-CG 4Å; R42-T50 VanDerWaalsContact O-CA 3.28Å; R42-T50 WeakPolarHBondContact O-CA 2.99Å; R42-K51 HydrophobicContact CG-CB 4.19Å; R42-K51 PolarHBondContact N-O 2.77Å; R42-K51 PolarHBondContact O-N 3.02Å
43	I	96.3	Very high	92	Very high	7 Å²	7	63.8 Å²	63.8	4%	0.036	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	144.8	164.5	-173.1	163	0	0	0	110.4	Y25 M26 P45 N49 T50 I62 A64	Y25-I43 WeakPolarHBondContact CA-O 3.37Å; M26-I43 HydrophobicContact CB-CG2 3.97Å; M26-I43 PolarHBondContact N-O 2.79Å; M26-I43 PolarHBondContact O-N 2.91Å; I43-P45 HydrophobicContact CG2-CG 4.34Å; I43-P45 WeakPolarHBondContact O-CD 2.94Å; I43-N49 CarbonylContact C-O 3.52Å; I43-N49 WeakPolarHBondContact CA-O 3.47Å; I43-T50 HydrophobicContact CB-CG2 3.98Å; I43-T50 HydrophobicContact CD1-CG2 3.98Å; I43-T50 HydrophobicContact CG1-CG2 3.87Å; I43-I62 HydrophobicContact CB-CG2 3.64Å; I43-I62 HydrophobicContact CG2-CG2 3.58Å; I43-A64 HydrophobicContact CD1-CB 3.96Å; I43-A64 HydrophobicContact CG2-CB 4.38Å
44	D	95.8	Very high	92.9	Very high	19 Å²	19	62.4 Å²	62.4	10%	0.102	34%	0.344	C	S	.	.			trans	-91.6	103.5	159.8	-170.7	-24.8	0	0	0	108.9	Y25 A46 N47 G48 N49	Y25-D44 HydrophobicContact CD1-CB 3.78Å; Y25-D44 HydrophobicContact CE1-CB 3.56Å; Y25-D44 WeakPolarHBondContact CE1-OD2 3.21Å; D44-A46 PolarHBondContact O-N 3.2Å; D44-A46 WeakPolarHBondContact OD1-CB 3.42Å; D44-A46 PolarHBondContact OD1-N 2.88Å; D44-N47 VanDerWaalsContact CB-OD1 3.29Å; D44-N47 WeakPolarHBondContact CB-OD1 3.31Å; D44-N47 VanDerWaalsContact CG-OD1 3.32Å; D44-N47 PolarHBondContact O-N 2.96Å; D44-N47 PolarHBondContact OD2-ND2 3.05Å; D44-N47 PolarHBondContact OD2-OD1 3.38Å; D44-G48 VanDerWaalsContact O-CA 3.25Å; D44-G48 WeakPolarHBondContact O-CA 3.47Å; D44-G48 PolarHBondContact O-N 3.28Å; D44-N49 HydrophobicContact CB-CB 4.16Å; D44-N49 PolarHBondContact N-O 2.71Å
45	P	94.6	Very high	93.5	Very high	10 Å²	10	60.4 Å²	60.4	7%	0.065	33%	0.332	C	S	.	.	T	Hydrogen-bonded Turn	trans	-68.8	-16	-176.7	-21.6	37.7	0	0	0	113.2	I21 T24 M26 I43 A64 T66	I21-P45 HydrophobicContact CG1-CB 4.38Å; I21-P45 HydrophobicContact CG1-CG 3.97Å; I21-P45 HydrophobicContact CG2-CB 4.11Å; I21-P45 VanDerWaalsContact O-CG 3.23Å; I21-P45 WeakPolarHBondContact O-CG 3.26Å; T24-P45 WeakPolarHBondContact O-CD 2.99Å; M26-P45 HydrophobicContact CG-CG 4.06Å; I43-P45 HydrophobicContact CG2-CG 4.34Å; I43-P45 WeakPolarHBondContact O-CD 2.94Å; P45-A64 HydrophobicContact CB-CB 3.89Å; P45-A64 HydrophobicContact CG-CB 4.19Å; P45-T66 HydrophobicContact CB-CG2 4.09Å; P45-T66 VanDerWaalsContact O-CG2 3.3Å; P45-T66 WeakPolarHBondContact O-CG2 3.47Å
46	A	94.1	Very high	94.4	Very high	62 Å²	62	56.2 Å²	56.2	51%	0.512	31%	0.312	S	S	.	.	T	Hydrogen-bonded Turn	trans	-72	-33.6	178.4	0	0	0	0	0	112.8	K22 D44	K22-A46 HydrophobicContact CB-CB 4.4Å; D44-A46 PolarHBondContact O-N 3.2Å; D44-A46 WeakPolarHBondContact OD1-CB 3.42Å; D44-A46 PolarHBondContact OD1-N 2.88Å
47	N	95.4	Very high	94.8	Very high	108 Å²	108	60.2 Å²	60.2	58%	0.578	32%	0.316	S	S	*	.	T	Hydrogen-bonded Turn	trans	-132.6	-0.7	-175.1	59.7	39	0	0	0	114.2	D44 N49	D44-N47 VanDerWaalsContact CB-OD1 3.29Å; D44-N47 WeakPolarHBondContact CB-OD1 3.31Å; D44-N47 VanDerWaalsContact CG-OD1 3.32Å; D44-N47 PolarHBondContact O-N 2.96Å; D44-N47 PolarHBondContact OD2-ND2 3.05Å; D44-N47 PolarHBondContact OD2-OD1 3.38Å; N47-N49 VanDerWaalsContact C-N 3.3Å; N47-N49 PolarHBondContact O-N 2.89Å; N47-N49 WeakPolarHBondContact OD1-CB 3Å; N47-N49 PolarHBondContact OD1-N 2.98Å
48	G	95.1	Very high	95	Very high	42 Å²	42	58.6 Å²	58.6	43%	0.433	33%	0.326	S	S	.	.			trans	77.9	4.7	179	0	0	0	0	0	115.1	D44 T50	D44-G48 VanDerWaalsContact O-CA 3.25Å; D44-G48 WeakPolarHBondContact O-CA 3.47Å; D44-G48 PolarHBondContact O-N 3.28Å; G48-T50 PolarHBondContact O-N 3.11Å
49	N	96.3	Very high	95	Very high	84 Å²	84	59.6 Å²	59.6	45%	0.449	33%	0.33	S	S	.	.			trans	-66.2	124	-177.7	-174.5	-36.8	0	0	0	111	I43 D44 N47	I43-N49 CarbonylContact C-O 3.52Å; I43-N49 WeakPolarHBondContact CA-O 3.47Å; D44-N49 HydrophobicContact CB-CB 4.16Å; D44-N49 PolarHBondContact N-O 2.71Å; N47-N49 VanDerWaalsContact C-N 3.3Å; N47-N49 PolarHBondContact O-N 2.89Å; N47-N49 WeakPolarHBondContact OD1-CB 3Å; N47-N49 PolarHBondContact OD1-N 2.98Å
50	T	97.3	Very high	95.1	Very high	51 Å²	51	55.7 Å²	55.7	31%	0.313	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	146.2	179.2	51.4	0	0	0	0	112	R42 I43 G48 Y52 I62	R42-T50 VanDerWaalsContact O-CA 3.28Å; R42-T50 WeakPolarHBondContact O-CA 2.99Å; I43-T50 HydrophobicContact CB-CG2 3.98Å; I43-T50 HydrophobicContact CD1-CG2 3.98Å; I43-T50 HydrophobicContact CG1-CG2 3.87Å; G48-T50 PolarHBondContact O-N 3.11Å; T50-Y52 WeakPolarHBondContact OG1-CE2 3.19Å; T50-I62 HydrophobicContact CG2-CB 4.36Å
51	K	96.9	Very high	95.2	Very high	115 Å²	115	59 Å²	59	50%	0.5	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.1	141.2	166.9	-67	-167	175.5	-167.4	0	108.7	W39 G41 R42	W39-K51 HydrophobicContact CH2-CB 4.09Å; G41-K51 CarbonylContact C-O 3.56Å; G41-K51 WeakPolarHBondContact CA-O 3.47Å; R42-K51 HydrophobicContact CG-CB 4.19Å; R42-K51 PolarHBondContact N-O 2.77Å; R42-K51 PolarHBondContact O-N 3.02Å
52	Y	97.6	Very high	95.3	Very high	59 Å²	59	59.3 Å²	59.3	23%	0.231	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.5	152	-179	-62.4	-88.4	0	0	0	110.1	I40 T50 A60 I62	I40-Y52 WeakPolarHBondContact O-CA 3.49Å; T50-Y52 WeakPolarHBondContact OG1-CE2 3.19Å; Y52-A60 HydrophobicContact CD1-CB 4.37Å; Y52-A60 HydrophobicContact CE1-CB 4.26Å; Y52-A60 WeakPolarHBondContact CE1-O 3.36Å; Y52-I62 HydrophobicContact CD1-CD1 4.13Å; Y52-I62 HydrophobicContact CE1-CB 4.32Å; Y52-I62 HydrophobicContact CE1-CD1 3.69Å; Y52-I62 HydrophobicContact CE1-CG1 3.79Å; Y52-I62 PolarHBondContact OH-N 2.89Å
53	D	96.3	Very high	95.3	Very high	44 Å²	44	60.5 Å²	60.5	24%	0.235	35%	0.349	C	S	.	.			trans	-71.4	135.9	156.6	-178.4	-65	0	0	0	108.4	W39 I40 K55 F56 Q57	W39-D53 HydrophobicContact CE3-CB 3.94Å; W39-D53 HydrophobicContact CZ3-CB 4.21Å; W39-D53 WeakPolarHBondContact O-CB 3.36Å; I40-D53 PolarHBondContact O-N 2.73Å; D53-K55 PolarHBondContact O-N 2.87Å; D53-K55 VanDerWaalsContact OD1-CB 3.27Å; D53-K55 WeakPolarHBondContact OD1-CB 3.39Å; D53-K55 WeakPolarHBondContact OD1-CG 3.4Å; D53-K55 PolarHBondContact OD1-N 2.87Å; D53-F56 HydrophobicContact CB-CD2 4.07Å; D53-F56 PolarHBondContact O-N 3.27Å; D53-Q57 PolarHBondContact O-N 3.21Å
54	P	95.9	Very high	95.3	Very high	103 Å²	103	61.7 Å²	61.7	67%	0.669	36%	0.36	S	S	*	.	G	3₁₀ helix	trans	-52.2	-30.4	-178.1	-28.7	35.7	0	0	0	114.6	F56 Q57	P54-F56 PolarHBondContact O-N 2.78Å; P54-Q57 PolarHBondContact O-N 2.88Å
55	K	92.2	Very high	95.3	Very high	152 Å²	152	63.5 Å²	63.5	66%	0.661	37%	0.37	S	S	*	.	G	3₁₀ helix	trans	-63.4	-27.3	178.3	-66	174.4	178.3	177.1	0	113.6	E38 D53	E38-K55 IonicContact OE1-NZ 3.94Å; D53-K55 PolarHBondContact O-N 2.87Å; D53-K55 VanDerWaalsContact OD1-CB 3.27Å; D53-K55 WeakPolarHBondContact OD1-CB 3.39Å; D53-K55 WeakPolarHBondContact OD1-CG 3.4Å; D53-K55 PolarHBondContact OD1-N 2.87Å
56	F	93.7	Very high	95.3	Very high	11 Å²	11	65.3 Å²	65.3	5%	0.048	38%	0.381	C	S	.	.	G	3₁₀ helix	trans	-104.7	-2.8	-176.5	-62.9	-85	0	0	0	112.6	K30 E38 I40 D53 P54 G58 K59 A60	K30-F56 HydrophobicContact CD-CE1 4.08Å; K30-F56 HydrophobicContact CD-CZ 4.09Å; E38-F56 HydrophobicContact CB-CE2 4.46Å; E38-F56 HydrophobicContact CB-CZ 4.36Å; I40-F56 HydrophobicContact CB-CD2 4.34Å; I40-F56 HydrophobicContact CB-CG 4.28Å; I40-F56 HydrophobicContact CG1-CD1 4.11Å; I40-F56 HydrophobicContact CG1-CD2 4.29Å; I40-F56 HydrophobicContact CG1-CE1 3.99Å; I40-F56 HydrophobicContact CG1-CE2 4.15Å; I40-F56 HydrophobicContact CG1-CG 4.25Å; I40-F56 HydrophobicContact CG1-CZ 4Å; I40-F56 HydrophobicContact CG2-CB 3.9Å; I40-F56 HydrophobicContact CG2-CD1 4.15Å; I40-F56 HydrophobicContact CG2-CD2 4.42Å; I40-F56 HydrophobicContact CG2-CG 3.91Å; D53-F56 HydrophobicContact CB-CD2 4.07Å; D53-F56 PolarHBondContact O-N 3.27Å; P54-F56 PolarHBondContact O-N 2.78Å; F56-G58 PolarHBondContact O-N 2.89Å; F56-K59 PolarHBondContact O-N 3.06Å; F56-K59 VanDerWaalsContact O-N 3.09Å; F56-A60 HydrophobicContact CB-CB 4.07Å; F56-A60 PolarHBondContact O-N 2.87Å
57	Q	92.9	Very high	95.3	Very high	139 Å²	139	67.4 Å²	67.4	65%	0.65	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.7	128.3	177.6	-164.5	164.3	2.2	0	0	110.1	D53 P54 K59	D53-Q57 PolarHBondContact O-N 3.21Å; P54-Q57 PolarHBondContact O-N 2.88Å; Q57-K59 PolarHBondContact O-N 3.2Å
58	G	90.9	Very high	95.3	Very high	75 Å²	75	64.4 Å²	64.4	77%	0.773	38%	0.379	S	S	*	.	T	Hydrogen-bonded Turn	trans	84.8	-18.4	-175	0	0	0	0	0	115.1	F56	F56-G58 PolarHBondContact O-N 2.89Å
59	K	93.3	Very high	95.2	Very high	47 Å²	47	64 Å²	64	20%	0.204	37%	0.367	C	S	.	.	T	Hydrogen-bonded Turn	trans	-98.3	-37.7	174.7	-168	170.6	-166.3	173.1	0	113.1	F56 Q57 L75 S76 D82	F56-K59 PolarHBondContact O-N 3.06Å; F56-K59 VanDerWaalsContact O-N 3.09Å; Q57-K59 PolarHBondContact O-N 3.2Å; K59-L75 WeakPolarHBondContact O-CA 3.45Å; K59-S76 PolarHBondContact O-N 3.21Å; K59-S76 PolarHBondContact O-OG 2.87Å; K59-D82 VanDerWaalsContact CE-OD1 3.32Å; K59-D82 WeakPolarHBondContact CE-OD1 3.23Å; K59-D82 VanDerWaalsContact CE-OD2 3.22Å; K59-D82 WeakPolarHBondContact CE-OD2 3.2Å; K59-D82 IonicContact NZ-OD1 2.77Å; K59-D82 PolarHBondContact NZ-OD1 3.29Å; K59-D82 IonicContact NZ-OD2 2.61Å; K59-D82 PolarHBondContact NZ-OD2 3.24Å
60	A	95.8	Very high	95	Very high	5 Å²	5	60.3 Å²	60.3	4%	0.041	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	135.8	-179.4	0	0	0	0	0	111.4	I40 Y52 F56 L73 Q74 L75	I40-A60 HydrophobicContact CG2-CB 3.69Å; Y52-A60 HydrophobicContact CD1-CB 4.37Å; Y52-A60 HydrophobicContact CE1-CB 4.26Å; Y52-A60 WeakPolarHBondContact CE1-O 3.36Å; F56-A60 HydrophobicContact CB-CB 4.07Å; F56-A60 PolarHBondContact O-N 2.87Å; A60-L73 HydrophobicContact CB-CD1 3.81Å; A60-Q74 CarbonylContact C-O 3.24Å; A60-Q74 WeakPolarHBondContact CA-O 3.34Å; A60-L75 HydrophobicContact CB-CD2 4.02Å
61	T	97.5	Very high	94.8	Very high	70 Å²	70	57.9 Å²	57.9	43%	0.429	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	116.6	168.3	-59.6	0	0	0	0	108.7	T63 Q74	T61-T63 HydrophobicContact CG2-CG2 4.24Å; T61-Q74 PolarHBondContact N-O 2.82Å; T61-Q74 PolarHBondContact O-N 2.98Å
62	I	97.2	Very high	94.8	Very high	6 Å²	6	54.7 Å²	54.7	3%	0.031	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	129.1	178.5	-58.6	165.8	0	0	0	109.1	I43 T50 Y52 Y72 L73	I43-I62 HydrophobicContact CB-CG2 3.64Å; I43-I62 HydrophobicContact CG2-CG2 3.58Å; T50-I62 HydrophobicContact CG2-CB 4.36Å; Y52-I62 HydrophobicContact CD1-CD1 4.13Å; Y52-I62 HydrophobicContact CE1-CB 4.32Å; Y52-I62 HydrophobicContact CE1-CD1 3.69Å; Y52-I62 HydrophobicContact CE1-CG1 3.79Å; Y52-I62 PolarHBondContact OH-N 2.89Å; I62-Y72 WeakPolarHBondContact CA-O 3.13Å; I62-L73 HydrophobicContact CG1-CD1 3.92Å
63	T	97.2	Very high	94.7	Very high	61 Å²	61	51.9 Å²	51.9	37%	0.374	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	167.5	175.3	57.8	0	0	0	0	110.9	T61 A71 Y72	T61-T63 HydrophobicContact CG2-CG2 4.24Å; T63-A71 WeakPolarHBondContact O-CA 3.35Å; T63-Y72 PolarHBondContact N-O 3.35Å; T63-Y72 PolarHBondContact O-N 3.34Å
64	A	95.8	Very high	94.7	Very high	32 Å²	32	53.9 Å²	53.9	26%	0.264	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.7	140.8	174.1	0	0	0	0	0	110.3	I43 P45 T70	I43-A64 HydrophobicContact CD1-CB 3.96Å; I43-A64 HydrophobicContact CG2-CB 4.38Å; P45-A64 HydrophobicContact CB-CB 3.89Å; P45-A64 HydrophobicContact CG-CB 4.19Å; A64-T70 WeakPolarHBondContact CA-O 3.38Å
65	D	95.3	Very high	94.5	Very high	57 Å²	57	49 Å²	49	31%	0.305	28%	0.283	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	111.2	168	175	9.3	0	0	0	108.4	S67 S68 N69 T70 Y72	D65-S67 VanDerWaalsContact C-N 3.33Å; D65-S67 WeakPolarHBondContact OD1-CB 3.34Å; D65-S67 PolarHBondContact OD1-N 2.93Å; D65-S67 PolarHBondContact OD1-OG 2.8Å; D65-S67 PolarHBondContact OD2-OG 3.02Å; D65-S68 WeakPolarHBondContact CB-OG 3.28Å; D65-S68 PolarHBondContact OD1-N 2.95Å; D65-S68 WeakPolarHBondContact OD2-CB 3.42Å; D65-S68 PolarHBondContact OD2-OG 2.77Å; D65-N69 PolarHBondContact O-N 2.99Å; D65-N69 VanDerWaalsContact O-N 3.1Å; D65-T70 PolarHBondContact N-O 3.33Å; D65-T70 PolarHBondContact O-N 3.27Å; D65-Y72 HydrophobicContact CB-CE2 3.95Å
66	T	94.6	Very high	94.5	Very high	49 Å²	49	43.5 Å²	43.5	30%	0.301	26%	0.264	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.8	-16.4	-176.4	66.4	0	0	0	0	113.1	I21 K22 P45	I21-T66 HydrophobicContact CG2-CG2 4.2Å; K22-T66 HydrophobicContact CD-CG2 4.18Å; K22-T66 VanDerWaalsContact CE-CG2 3.49Å; K22-T66 WeakPolarHBondContact CE-OG1 3.37Å; K22-T66 HydrophobicContact CG-CG2 3.61Å; P45-T66 HydrophobicContact CB-CG2 4.09Å; P45-T66 VanDerWaalsContact O-CG2 3.3Å; P45-T66 WeakPolarHBondContact O-CG2 3.47Å
67	S	94.8	Very high	94.3	Very high	106 Å²	106	46.6 Å²	46.6	74%	0.741	29%	0.287	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.9	-38	174.6	71.9	0	0	0	0	111.4	D65	D65-S67 VanDerWaalsContact C-N 3.33Å; D65-S67 WeakPolarHBondContact OD1-CB 3.34Å; D65-S67 PolarHBondContact OD1-N 2.93Å; D65-S67 PolarHBondContact OD1-OG 2.8Å; D65-S67 PolarHBondContact OD2-OG 3.02Å
68	S	94.8	Very high	94.1	Very high	45 Å²	45	40.1 Å²	40.1	32%	0.315	26%	0.256	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.1	7.3	175.4	63.3	0	0	0	0	113.7	D65 T70	D65-S68 WeakPolarHBondContact CB-OG 3.28Å; D65-S68 PolarHBondContact OD1-N 2.95Å; D65-S68 WeakPolarHBondContact OD2-CB 3.42Å; D65-S68 PolarHBondContact OD2-OG 2.77Å; S68-T70 PolarHBondContact O-N 3.19Å; S68-T70 VanDerWaalsContact O-N 3.15Å; S68-T70 PolarHBondContact O-OG1 3.09Å
69	N	92.4	Very high	93.9	Very high	33 Å²	33	39.2 Å²	39.2	18%	0.176	24%	0.236	C	C	.	.	T	Hydrogen-bonded Turn	trans	51.8	36.9	-179.8	-148.7	40.7	0	0	0	113.3	A16 F19 I21 D65	A16-N69 WeakPolarHBondContact CB-ND2 3.42Å; A16-N69 PolarHBondContact N-O 3.28Å; A16-N69 PolarHBondContact O-ND2 2.78Å; F19-N69 PolarHBondContact O-ND2 2.87Å; I21-N69 WeakPolarHBondContact CB-OD1 3.25Å; I21-N69 VanDerWaalsContact CG2-OD1 3.29Å; I21-N69 WeakPolarHBondContact CG2-OD1 3.37Å; I21-N69 PolarHBondContact N-OD1 3.28Å; D65-N69 PolarHBondContact O-N 2.99Å; D65-N69 VanDerWaalsContact O-N 3.1Å
70	T	93	Very high	93.4	Very high	6 Å²	6	40.9 Å²	40.9	4%	0.037	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	129.6	-168.3	-61.5	0	0	0	0	111.9	C14 T15 A64 D65 S68 Y72	C14-T70 CarbonylContact O-C 3.38Å; C14-T70 WeakPolarHBondContact O-CA 3.41Å; T15-T70 WeakPolarHBondContact CB-OG1 3.3Å; T15-T70 WeakPolarHBondContact CG2-OG1 3.19Å; T15-T70 PolarHBondContact OG1-OG1 2.91Å; A64-T70 WeakPolarHBondContact CA-O 3.38Å; D65-T70 PolarHBondContact N-O 3.33Å; D65-T70 PolarHBondContact O-N 3.27Å; S68-T70 PolarHBondContact O-N 3.19Å; S68-T70 VanDerWaalsContact O-N 3.15Å; S68-T70 PolarHBondContact O-OG1 3.09Å; T70-Y72 HydrophobicContact CG2-CD1 4.21Å; T70-Y72 HydrophobicContact CG2-CE1 3.58Å; T70-Y72 HydrophobicContact CG2-CE2 3.9Å; T70-Y72 WeakPolarHBondContact CG2-OH 3.27Å
71	A	93.9	Very high	92.8	Very high	0 Å²	0	46.8 Å²	46.8	0%	0	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.4	151.4	168.7	0	0	0	0	0	110.6	S13 C14 I21 M26 W28 T63	S13-A71 CarbonylContact C-O 3.54Å; S13-A71 WeakPolarHBondContact CA-O 3.24Å; C14-A71 PolarHBondContact N-O 3.12Å; C14-A71 PolarHBondContact O-N 3.25Å; I21-A71 HydrophobicContact CD1-CB 3.98Å; M26-A71 HydrophobicContact CB-CB 4.15Å; M26-A71 HydrophobicContact CG-CB 4.26Å; W28-A71 HydrophobicContact CZ2-CB 4.43Å; T63-A71 WeakPolarHBondContact O-CA 3.35Å
72	Y	95.6	Very high	92.2	Very high	48 Å²	48	43.7 Å²	43.7	19%	0.188	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.5	145.9	179.6	-55.3	-83.4	0	0	0	111.5	K11 L12 I62 T63 D65 T70	K11-Y72 HydrophobicContact CD-CD1 4.37Å; K11-Y72 HydrophobicContact CG-CD1 4.35Å; L12-Y72 CarbonylContact O-C 3.59Å; L12-Y72 WeakPolarHBondContact O-CA 3.14Å; I62-Y72 WeakPolarHBondContact CA-O 3.13Å; T63-Y72 PolarHBondContact N-O 3.35Å; T63-Y72 PolarHBondContact O-N 3.34Å; D65-Y72 HydrophobicContact CB-CE2 3.95Å; T70-Y72 HydrophobicContact CG2-CD1 4.21Å; T70-Y72 HydrophobicContact CG2-CE1 3.58Å; T70-Y72 HydrophobicContact CG2-CE2 3.9Å; T70-Y72 WeakPolarHBondContact CG2-OH 3.27Å
73	L	95.9	Very high	91.7	Very high	0 Å²	0	46 Å²	46	0%	0	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	115.6	168.5	168.9	65.2	0	0	0	108.1	K11 L12 W28 I40 A60 I62 L75 Y86	K11-L73 CarbonylContact C-O 3.57Å; K11-L73 WeakPolarHBondContact CA-O 3.45Å; L12-L73 HydrophobicContact CB-CB 4.42Å; L12-L73 HydrophobicContact CD1-CD2 4.25Å; L12-L73 PolarHBondContact N-O 2.01Å; L12-L73 PolarHBondContact O-N 3.34Å; W28-L73 HydrophobicContact CB-CD2 4.13Å; W28-L73 HydrophobicContact CD2-CB 3.48Å; W28-L73 VanDerWaalsContact CD2-CB 3.48Å; W28-L73 HydrophobicContact CD2-CD2 3.88Å; W28-L73 HydrophobicContact CD2-CG 4.25Å; W28-L73 VanDerWaalsContact CE2-CB 3.49Å; W28-L73 HydrophobicContact CE3-CB 3.7Å; W28-L73 HydrophobicContact CE3-CD2 3.64Å; W28-L73 HydrophobicContact CE3-CG 4.32Å; W28-L73 HydrophobicContact CG-CB 4.02Å; W28-L73 HydrophobicContact CG-CD2 4.11Å; W28-L73 HydrophobicContact CG-CG 4.49Å; W28-L73 HydrophobicContact CH2-CB 3.93Å; W28-L73 HydrophobicContact CZ2-CB 3.73Å; W28-L73 HydrophobicContact CZ3-CB 3.91Å; W28-L73 HydrophobicContact CZ3-CD2 4.3Å; I40-L73 HydrophobicContact CD1-CD2 3.67Å; I40-L73 HydrophobicContact CG2-CD1 4.21Å; A60-L73 HydrophobicContact CB-CD1 3.81Å; I62-L73 HydrophobicContact CG1-CD1 3.92Å; L73-L75 HydrophobicContact CD1-CD2 4.08Å; L73-L75 HydrophobicContact CD1-CG 4.43Å; L73-L75 HydrophobicContact CD2-CD1 4.41Å; L73-L75 HydrophobicContact CD2-CD2 4.32Å; L73-L75 HydrophobicContact CD2-CG 4.31Å; L73-L75 HydrophobicContact CG-CD2 4.26Å; L73-L75 HydrophobicContact CG-CG 4.14Å; L73-Y86 HydrophobicContact CD2-CD1 4Å
74	Q	95.4	Very high	91.2	Very high	87 Å²	87	43.4 Å²	43.4	41%	0.407	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.8	127.9	169.4	-176.4	173.3	1.3	0	0	109.3	V10 A60 T61	V10-Q74 CarbonylContact O-C 3.57Å; V10-Q74 VanDerWaalsContact O-CA 3.27Å; V10-Q74 WeakPolarHBondContact O-CA 3.42Å; A60-Q74 CarbonylContact C-O 3.24Å; A60-Q74 WeakPolarHBondContact CA-O 3.34Å; T61-Q74 PolarHBondContact N-O 2.82Å; T61-Q74 PolarHBondContact O-N 2.98Å
75	L	93.4	Very high	90.8	Very high	1 Å²	1	43.5 Å²	43.5	1%	0.005	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	126.6	172.8	-63.2	168.1	0	0	0	108.2	S9 V10 K59 A60 L73 L78 Y86 L100	S9-L75 CarbonylContact C-O 3.58Å; S9-L75 WeakPolarHBondContact CA-O 3.24Å; S9-L75 WeakPolarHBondContact CB-O 3.18Å; V10-L75 HydrophobicContact CG1-CB 4.13Å; V10-L75 HydrophobicContact CG1-CD1 4.4Å; V10-L75 PolarHBondContact N-O 2.79Å; V10-L75 PolarHBondContact O-N 2.93Å; K59-L75 WeakPolarHBondContact O-CA 3.45Å; A60-L75 HydrophobicContact CB-CD2 4.02Å; L73-L75 HydrophobicContact CD1-CD2 4.08Å; L73-L75 HydrophobicContact CD1-CG 4.43Å; L73-L75 HydrophobicContact CD2-CD1 4.41Å; L73-L75 HydrophobicContact CD2-CD2 4.32Å; L73-L75 HydrophobicContact CD2-CG 4.31Å; L73-L75 HydrophobicContact CG-CD2 4.26Å; L73-L75 HydrophobicContact CG-CG 4.14Å; L75-L78 HydrophobicContact CB-CD2 3.74Å; L75-L78 HydrophobicContact CD1-CD2 4.23Å; L75-Y86 HydrophobicContact CD1-CD1 4.19Å; L75-Y86 HydrophobicContact CD1-CE1 3.5Å; L75-Y86 VanDerWaalsContact CD1-CE1 3.5Å; L75-Y86 HydrophobicContact CD1-CE2 4.42Å; L75-L100 HydrophobicContact CD1-CD2 4.27Å
76	S	92	Very high	90.5	Very high	35 Å²	35	40.8 Å²	40.8	25%	0.245	24%	0.243	C	C	.	.			trans	-99.2	157.6	177.4	59.1	0	0	0	0	111.9	S9 K59 L78	S9-S76 WeakPolarHBondContact OG-CA 3.35Å; K59-S76 PolarHBondContact O-N 3.21Å; K59-S76 PolarHBondContact O-OG 2.87Å; S76-L78 PolarHBondContact O-N 2.98Å
77	S	89.7	Confident	90.2	Very high	77 Å²	77	41 Å²	41	54%	0.538	24%	0.239	S	C	.	.	S	Bend	trans	49.3	53.7	172	-57	0	0	0	0	113.1	A8	A8-S77 PolarHBondContact O-N 2.87Å
78	L	87.9	Confident	90	Very high	2 Å²	2	36.2 Å²	36.2	1%	0.01	21%	0.205	C	C	.	.			trans	-60.3	140.5	-175.1	-69.5	169.3	0	0	0	112	V4 P6 G7 A8 V10 L75 S76 D82 T102	V4-L78 HydrophobicContact CB-CD1 4.03Å; V4-L78 HydrophobicContact CG1-CD1 3.64Å; P6-L78 CarbonylContact C-O 3.51Å; P6-L78 WeakPolarHBondContact CA-O 3.36Å; G7-L78 PolarHBondContact N-O 3.01Å; A8-L78 WeakPolarHBondContact O-CB 3.48Å; A8-L78 VanDerWaalsContact O-CG 3.31Å; A8-L78 WeakPolarHBondContact O-CG 3.47Å; A8-L78 PolarHBondContact O-N 2.98Å; V10-L78 HydrophobicContact CB-CD1 3.95Å; V10-L78 HydrophobicContact CG1-CD1 3.74Å; V10-L78 HydrophobicContact CG1-CD2 4.4Å; L75-L78 HydrophobicContact CB-CD2 3.74Å; L75-L78 HydrophobicContact CD1-CD2 4.23Å; S76-L78 PolarHBondContact O-N 2.98Å; L78-D82 HydrophobicContact CD2-CB 3.69Å; L78-T102 HydrophobicContact CB-CG2 4.21Å; L78-T102 HydrophobicContact CD1-CG2 3.91Å; L78-T102 HydrophobicContact CD2-CG2 4.32Å; L78-T102 HydrophobicContact CG-CG2 4.39Å
79	T	86.5	Confident	89.5	Confident	57 Å²	57	34.5 Å²	34.5	35%	0.35	19%	0.194	S	C	.	.			trans	-124.3	170.5	179.6	62.4	0	0	0	0	109.6	E81 D82	T79-E81 PolarHBondContact O-N 2.84Å; T79-D82 PolarHBondContact N-OD2 3.01Å; T79-D82 WeakPolarHBondContact O-CB 3.01Å; T79-D82 PolarHBondContact O-N 2.9Å; T79-D82 PolarHBondContact OG1-OD2 3.32Å
80	S	81.9	Confident	89.1	Confident	81 Å²	81	35.8 Å²	35.8	57%	0.566	20%	0.196	S	C	*	.	G	3₁₀ helix	trans	-56.7	-31.2	173.9	48.8	0	0	0	0	112.6	D82 T83	S80-D82 PolarHBondContact O-N 2.85Å; S80-T83 WeakPolarHBondContact O-CB 3.33Å; S80-T83 PolarHBondContact O-N 3.17Å; S80-T83 PolarHBondContact O-OG1 2.84Å
81	E	83.1	Confident	88	Confident	130 Å²	130	43.6 Å²	43.6	61%	0.607	23%	0.225	S	C	*	.	G	3₁₀ helix	trans	-65.7	-19.5	177.6	-60.4	-174.8	179.5	0	0	113.4	K30 T79 T83	K30-E81 WeakPolarHBondContact CE-O 3.27Å; K30-E81 PolarHBondContact NZ-O 2.96Å; T79-E81 PolarHBondContact O-N 2.84Å; E81-T83 VanDerWaalsContact C-N 3.27Å
82	D	86.1	Confident	86.5	Confident	4 Å²	4	49 Å²	49	2%	0.021	25%	0.254	C	S	.	.	G	3₁₀ helix	trans	-84.3	-2.4	179	-55.9	-58.1	0	0	0	113.3	K30 K59 L78 T79 S80 A84 Y86	K30-D82 IonicContact NZ-OD1 3.79Å; K59-D82 VanDerWaalsContact CE-OD1 3.32Å; K59-D82 WeakPolarHBondContact CE-OD1 3.23Å; K59-D82 VanDerWaalsContact CE-OD2 3.22Å; K59-D82 WeakPolarHBondContact CE-OD2 3.2Å; K59-D82 IonicContact NZ-OD1 2.77Å; K59-D82 PolarHBondContact NZ-OD1 3.29Å; K59-D82 IonicContact NZ-OD2 2.61Å; K59-D82 PolarHBondContact NZ-OD2 3.24Å; L78-D82 HydrophobicContact CD2-CB 3.69Å; T79-D82 PolarHBondContact N-OD2 3.01Å; T79-D82 WeakPolarHBondContact O-CB 3.01Å; T79-D82 PolarHBondContact O-N 2.9Å; T79-D82 PolarHBondContact OG1-OD2 3.32Å; S80-D82 PolarHBondContact O-N 2.85Å; D82-A84 PolarHBondContact O-N 2.84Å; D82-Y86 WeakPolarHBondContact O-CE2 3.41Å; D82-Y86 PolarHBondContact O-OH 3.5Å
83	T	86.1	Confident	84.6	Confident	55 Å²	55	48.8 Å²	48.8	34%	0.337	27%	0.266	S	S	.	.			trans	-66	105.2	172.9	-44.2	0	0	0	0	109.4	S80 E81 T102	S80-T83 WeakPolarHBondContact O-CB 3.33Å; S80-T83 PolarHBondContact O-N 3.17Å; S80-T83 PolarHBondContact O-OG1 2.84Å; E81-T83 VanDerWaalsContact C-N 3.27Å; T83-T102 VanDerWaalsContact CA-OG1 3.25Å; T83-T102 WeakPolarHBondContact CA-OG1 3.5Å; T83-T102 WeakPolarHBondContact CB-OG1 3.02Å; T83-T102 PolarHBondContact N-OG1 3.1Å; T83-T102 PolarHBondContact OG1-OG1 3.1Å
84	A	87.1	Confident	82.8	Confident	7 Å²	7	53.5 Å²	53.5	6%	0.058	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-166.4	162.8	-173	0	0	0	0	0	111.3	K30 Q31 R32 D82 Y86	K30-A84 HydrophobicContact CD-CB 4.08Å; K30-A84 HydrophobicContact CG-CB 3.4Å; K30-A84 VanDerWaalsContact CG-CB 3.4Å; Q31-A84 WeakPolarHBondContact O-CA 3.38Å; Q31-A84 VanDerWaalsContact O-CB 3.24Å; Q31-A84 WeakPolarHBondContact O-CB 3.34Å; R32-A84 HydrophobicContact CG-CB 4.17Å; D82-A84 PolarHBondContact O-N 2.84Å; A84-Y86 HydrophobicContact CB-CD2 4.39Å; A84-Y86 HydrophobicContact CB-CE2 3.78Å; A84-Y86 WeakPolarHBondContact O-CD2 3.25Å; A84-Y86 VanDerWaalsContact O-CE2 3.3Å; A84-Y86 WeakPolarHBondContact O-CE2 3.29Å
85	V	87	Confident	80.9	Confident	33 Å²	33	57.4 Å²	57.4	20%	0.2	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	135.5	165.7	-172.8	0	0	0	0	108.5	K30 Q31 Y87 T98 T99	K30-V85 CarbonylContact C-O 3.57Å; Q31-V85 HydrophobicContact CB-CB 4.45Å; Q31-V85 PolarHBondContact N-O 3.27Å; Q31-V85 PolarHBondContact O-N 2.79Å; V85-Y87 HydrophobicContact CB-CE2 3.76Å; V85-Y87 HydrophobicContact CG1-CD2 4.17Å; V85-Y87 HydrophobicContact CG1-CE1 4.11Å; V85-Y87 HydrophobicContact CG1-CE2 3.44Å; V85-Y87 VanDerWaalsContact CG1-CE2 3.44Å; V85-Y87 VanDerWaalsContact CG1-CZ 3.41Å; V85-Y87 WeakPolarHBondContact CG1-OH 3.45Å; V85-T98 WeakPolarHBondContact CG1-O 3.09Å; V85-T99 HydrophobicContact CG2-CG2 4.17Å
86	Y	89.9	Confident	79.2	Confident	0 Å²	0	61.1 Å²	61.1	0%	0	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	122.3	-179.6	-69.7	-99.3	0	0	0	109.9	L12 V29 K30 I40 L73 L75 D82 A84 T98 L100	L12-Y86 HydrophobicContact CD1-CD1 4.18Å; L12-Y86 HydrophobicContact CD1-CD2 4.21Å; L12-Y86 HydrophobicContact CD1-CG 3.74Å; V29-Y86 CarbonylContact O-C 3.56Å; V29-Y86 WeakPolarHBondContact O-CA 3.49Å; K30-Y86 HydrophobicContact CB-CD1 4.27Å; K30-Y86 HydrophobicContact CB-CE1 3.99Å; K30-Y86 HydrophobicContact CD-CE1 4.16Å; K30-Y86 HydrophobicContact CG-CD1 4.48Å; K30-Y86 HydrophobicContact CG-CE1 3.9Å; I40-Y86 HydrophobicContact CD1-CD1 3.65Å; I40-Y86 HydrophobicContact CD1-CE1 3.73Å; L73-Y86 HydrophobicContact CD2-CD1 4Å; L75-Y86 HydrophobicContact CD1-CD1 4.19Å; L75-Y86 HydrophobicContact CD1-CE1 3.5Å; L75-Y86 VanDerWaalsContact CD1-CE1 3.5Å; L75-Y86 HydrophobicContact CD1-CE2 4.42Å; D82-Y86 WeakPolarHBondContact O-CE2 3.41Å; D82-Y86 PolarHBondContact O-OH 3.5Å; A84-Y86 HydrophobicContact CB-CD2 4.39Å; A84-Y86 HydrophobicContact CB-CE2 3.78Å; A84-Y86 WeakPolarHBondContact O-CD2 3.25Å; A84-Y86 VanDerWaalsContact O-CE2 3.3Å; A84-Y86 WeakPolarHBondContact O-CE2 3.29Å; Y86-T98 CarbonylContact C-O 3.6Å; Y86-T98 PolarHBondContact N-O 3.04Å; Y86-T98 CarbonylContact O-C 3.59Å; Y86-T98 WeakPolarHBondContact O-CG2 3.45Å; Y86-T98 PolarHBondContact O-N 2.81Å; Y86-L100 HydrophobicContact CD2-CB 3.56Å; Y86-L100 HydrophobicContact CD2-CD2 4.03Å; Y86-L100 HydrophobicContact CD2-CG 4.41Å; Y86-L100 HydrophobicContact CE2-CB 3.82Å; Y86-L100 HydrophobicContact CE2-CD2 3.65Å; Y86-L100 HydrophobicContact CE2-CG 4.26Å
87	Y	87.4	Confident	77.5	Confident	54 Å²	54	63.1 Å²	63.1	21%	0.212	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	141.6	-179.5	-59.9	-94.2	0	0	0	109.7	W28 V29 Q31 V85	W28-Y87 CarbonylContact C-O 3.45Å; W28-Y87 WeakPolarHBondContact CA-O 3.29Å; V29-Y87 PolarHBondContact N-O 2.79Å; V29-Y87 PolarHBondContact O-N 3.35Å; Q31-Y87 HydrophobicContact CB-CD2 4.25Å; Q31-Y87 HydrophobicContact CB-CE2 3.62Å; Q31-Y87 HydrophobicContact CG-CE2 4.44Å; Q31-Y87 VanDerWaalsContact OE1-CZ 3.31Å; Q31-Y87 PolarHBondContact OE1-OH 2.93Å; V85-Y87 HydrophobicContact CB-CE2 3.76Å; V85-Y87 HydrophobicContact CG1-CD2 4.17Å; V85-Y87 HydrophobicContact CG1-CE1 4.11Å; V85-Y87 HydrophobicContact CG1-CE2 3.44Å; V85-Y87 VanDerWaalsContact CG1-CE2 3.44Å; V85-Y87 VanDerWaalsContact CG1-CZ 3.41Å; V85-Y87 WeakPolarHBondContact CG1-OH 3.45Å
88	C	90.2	Very high	75.7	Confident	6 Å²	6	62 Å²	62	4%	0.041	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	139.1	159.9	59.2	0	0	0	0	109.3	C14 M26 H27 W28 V96	C14-C88 HydrophobicContact CB-CB 3.52Å; C14-C88 WeakPolarHBondContact CB-SG 3.3Å; C14-C88 WeakPolarHBondContact SG-CB 3.4Å; C14-C88 CovalentContact SG-SG 2.01Å; C14-C88 PolarHBondContact SG-SG 3.45Å; M26-C88 HydrophobicContact CE-CB 4.48Å; H27-C88 CarbonylContact O-C 3.51Å; H27-C88 WeakPolarHBondContact O-CA 3.5Å; W28-C88 HydrophobicContact CD2-CB 4.28Å; W28-C88 HydrophobicContact CE3-CB 4.13Å; W28-C88 HydrophobicContact CH2-CB 4.18Å; W28-C88 HydrophobicContact CZ2-CB 4.29Å; W28-C88 HydrophobicContact CZ3-CB 4.1Å; C88-V96 PolarHBondContact N-O 3.42Å; C88-V96 CarbonylContact O-C 3.58Å; C88-V96 PolarHBondContact O-N 2.94Å; C88-V96 PolarHBondContact SG-O 2.8Å
89	A	84.9	Confident	74.1	Confident	8 Å²	8	65.3 Å²	65.3	7%	0.066	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	142.9	-176.9	0	0	0	0	0	111.5	H27 Y95	H27-A89 HydrophobicContact CB-CB 4.45Å; H27-A89 PolarHBondContact N-O 3.4Å; H27-A89 PolarHBondContact O-N 3.05Å; A89-Y95 HydrophobicContact CB-CD1 3.68Å; A89-Y95 HydrophobicContact CB-CE1 4.01Å
90	R	83.9	Confident	72.2	Confident	60 Å²	60	62.7 Å²	62.7	23%	0.226	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.1	144.8	169.2	-166.6	175.2	77.9	168.7	4.3	109.7	F19 T24 N92 G93 N94	F19-R90 VanDerWaalsContact CB-NH1 3.34Å; F19-R90 HydrophobicContact CE2-CG 4.31Å; F19-R90 VanDerWaalsContact CG-NH1 3.27Å; F19-R90 HydrophobicContact CZ-CB 4.45Å; F19-R90 HydrophobicContact CZ-CG 4.37Å; T24-R90 HydrophobicContact CG2-CG 3.53Å; T24-R90 WeakPolarHBondContact OG1-CG 3.45Å; R90-N92 PolarHBondContact O-N 2.75Å; R90-G93 PolarHBondContact O-N 2.83Å; R90-G93 VanDerWaalsContact O-N 3.11Å; R90-N94 PolarHBondContact N-O 2.98Å
91	R	69.5	Low	70.5	Confident	171 Å²	171	61.1 Å²	61.1	65%	0.645	32%	0.321	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.4	-28.2	176	179.6	172.1	169.6	168.9	-1.7	114.2	Y25	Y25-R91 PolarHBondContact O-N 3.23Å
92	N	63.9	Low	68.4	Low	114 Å²	114	55.5 Å²	55.5	61%	0.61	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94	25.5	-178.3	-61.7	-5.2	0	0	0	114.6	R90	R90-N92 PolarHBondContact O-N 2.75Å
93	G	55.4	Low	66.1	Low	43 Å²	43	56.1 Å²	56.1	44%	0.443	30%	0.303	S	S	.	.	S	Bend	trans	92.7	2.9	162.2	0	0	0	0	0	118.5	R90	R90-G93 PolarHBondContact O-N 2.83Å; R90-G93 VanDerWaalsContact O-N 3.11Å
94	N	57.7	Low	63.6	Low	99 Å²	99	56.3 Å²	56.3	53%	0.529	31%	0.31	S	S	.	.			trans	-92.2	118.5	172.6	-66.7	-17.2	0	0	0	110	R90	R90-N94 PolarHBondContact N-O 2.98Å
95	Y	54.2	Low	61.1	Low	169 Å²	169	64.5 Å²	64.5	66%	0.663	35%	0.345	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.4	131	178.7	-60.3	-85.3	0	0	0	110.6	A89	A89-Y95 HydrophobicContact CB-CD1 3.68Å; A89-Y95 HydrophobicContact CB-CE1 4.01Å
96	V	58.6	Low	58.4	Low	79 Å²	79	66.4 Å²	66.4	48%	0.479	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.8	127.5	168.1	177.3	0	0	0	0	107.6	C88	C88-V96 PolarHBondContact N-O 3.42Å; C88-V96 CarbonylContact O-C 3.58Å; C88-V96 PolarHBondContact O-N 2.94Å; C88-V96 PolarHBondContact SG-O 2.8Å
97	S	55.8	Low	55.7	Low	77 Å²	77	72.1 Å²	72.1	54%	0.538	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	139.1	-170.7	64.3	0	0	0	0	112.8
98	T	53.3	Low	53.1	Low	54 Å²	54	76.7 Å²	76.7	33%	0.331	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	139	165.6	-166.8	0	0	0	0	110.9	L12 V85 Y86	L12-T98 HydrophobicContact CD1-CG2 4.24Å; L12-T98 HydrophobicContact CD2-CG2 4.34Å; V85-T98 WeakPolarHBondContact CG1-O 3.09Å; Y86-T98 CarbonylContact C-O 3.6Å; Y86-T98 PolarHBondContact N-O 3.04Å; Y86-T98 CarbonylContact O-C 3.59Å; Y86-T98 WeakPolarHBondContact O-CG2 3.45Å; Y86-T98 PolarHBondContact O-N 2.81Å
99	T	54.1	Low	50.5	Low	70 Å²	70	81.3 Å²	81.3	43%	0.429	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.2	112.6	179.6	-61.5	0	0	0	0	110.5	V85	V85-T99 HydrophobicContact CG2-CG2 4.17Å
100	L	45.5	Very low	48.3	Very low	2 Å²	2	89.6 Å²	89.6	1%	0.01	50%	0.498	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	135	171.4	-176.6	62.7	0	0	0	109.3	E2 V4 V10 L12 L75 Y86 T102	E2-L100 HydrophobicContact CB-CD1 3.99Å; E2-L100 HydrophobicContact CG-CD1 4.37Å; V4-L100 HydrophobicContact CG2-CD1 3.95Å; V10-L100 HydrophobicContact CG1-CD1 4.33Å; V10-L100 HydrophobicContact CG1-CD2 3.73Å; V10-L100 HydrophobicContact CG2-CD1 4.06Å; L12-L100 HydrophobicContact CD2-CB 4.48Å; L12-L100 HydrophobicContact CD2-CD1 4.22Å; L12-L100 HydrophobicContact CD2-CD2 4.49Å; L75-L100 HydrophobicContact CD1-CD2 4.27Å; Y86-L100 HydrophobicContact CD2-CB 3.56Å; Y86-L100 HydrophobicContact CD2-CD2 4.03Å; Y86-L100 HydrophobicContact CD2-CG 4.41Å; Y86-L100 HydrophobicContact CE2-CB 3.82Å; Y86-L100 HydrophobicContact CE2-CD2 3.65Å; Y86-L100 HydrophobicContact CE2-CG 4.26Å; L100-T102 HydrophobicContact CD2-CG2 4.49Å
101	T	47.4	Very low	45.6	Very low	49 Å²	49	91.5 Å²	91.5	30%	0.301	52%	0.52	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.7	90.7	178.9	-52.5	0	0	0	0	108.6	A1 E2 L3 G103	A1-T101 VanDerWaalsContact CB-OG1 3.27Å; A1-T101 WeakPolarHBondContact CB-OG1 3.33Å; E2-T101 CarbonylContact C-O 3.5Å; E2-T101 CarbonylContact O-C 3.58Å; E2-T101 VanDerWaalsContact O-C 3.24Å; E2-T101 PolarHBondContact O-N 2.82Å; L3-T101 VanDerWaalsContact CA-O 3.26Å; L3-T101 WeakPolarHBondContact CA-O 3.37Å; T101-G103 PolarHBondContact O-N 2.92Å
102	T	39	Very low	44	Very low	11 Å²	11	89.1 Å²	89.1	7%	0.067	53%	0.527	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.1	122.4	176.1	43.1	0	0	0	0	110.2	V4 L78 T83 L100 A104	V4-T102 HydrophobicContact CB-CG2 4.36Å; L78-T102 HydrophobicContact CB-CG2 4.21Å; L78-T102 HydrophobicContact CD1-CG2 3.91Å; L78-T102 HydrophobicContact CD2-CG2 4.32Å; L78-T102 HydrophobicContact CG-CG2 4.39Å; T83-T102 VanDerWaalsContact CA-OG1 3.25Å; T83-T102 WeakPolarHBondContact CA-OG1 3.5Å; T83-T102 WeakPolarHBondContact CB-OG1 3.02Å; T83-T102 PolarHBondContact N-OG1 3.1Å; T83-T102 PolarHBondContact OG1-OG1 3.1Å; L100-T102 HydrophobicContact CD2-CG2 4.49Å; T102-A104 PolarHBondContact O-N 3.15Å
103	G	37.1	Very low	42.8	Very low	18 Å²	18	96 Å²	96	19%	0.186	56%	0.555	C	S	.	*			trans	-83.2	93.4	178.7	0	0	0	0	0	109.9	V4 P6 T101 K105	V4-G103 PolarHBondContact O-N 2.79Å; P6-G103 WeakPolarHBondContact CD-O 3.39Å; T101-G103 PolarHBondContact O-N 2.92Å; G103-K105 PolarHBondContact O-N 2.61Å
104	A	34.6	Very low	42.2	Very low	58 Å²	58	98.7 Å²	98.7	48%	0.479	56%	0.561	S	S	.	*			trans	-68.1	121.7	161.4	0	0	0	0	0	107.6	T102 A106	T102-A104 PolarHBondContact O-N 3.15Å; A104-A106 PolarHBondContact O-N 2.83Å
105	K	33.8	Very low	41.4	Very low	180 Å²	180	98.6 Å²	98.6	78%	0.783	56%	0.563	S	S	*	*			trans	-56.9	115.8	158.9	-171.3	-177.9	-179.1	-169.8	0	104.7	G103	G103-K105 PolarHBondContact O-N 2.61Å
106	A	31.2	Very low	40.6	Very low	72 Å²	72	94.7 Å²	94.7	60%	0.595	56%	0.557	S	S	*	*			trans	-48	134.2	171	0	0	0	0	0	107.4	A104 L108	A104-A106 PolarHBondContact O-N 2.83Å; A106-L108 PolarHBondContact O-N 2.8Å
107	P	32.4	Very low	39.6	Very low	121 Å²	121	95.6 Å²	95.6	79%	0.786	56%	0.562	S	S	*	*			trans	-52.7	123.2	159.9	22.6	-27.5	0	0	0	104.6	S109	P107-S109 VanDerWaalsContact C-N 3.33Å; P107-S109 PolarHBondContact O-N 3.49Å
108	L	32.7	Very low	38.6	Very low	150 Å²	150	96.8 Å²	96.8	79%	0.785	56%	0.563	S	S	*	*			trans	-49.6	113.2	165.2	-76.8	162.5	0	0	0	104.1	A106 Q110	A106-L108 PolarHBondContact O-N 2.8Å; L108-Q110 VanDerWaalsContact C-N 3.3Å; L108-Q110 PolarHBondContact O-N 3.28Å
109	S	36.4	Very low	37.6	Very low	102 Å²	102	99.7 Å²	99.7	71%	0.713	58%	0.579	S	S	*	*			trans	-51.7	110.3	163.2	139.6	0	0	0	0	103.7	P107 S111	P107-S109 VanDerWaalsContact C-N 3.33Å; P107-S109 PolarHBondContact O-N 3.49Å; S109-S111 PolarHBondContact O-N 2.63Å; S109-S111 VanDerWaalsContact O-N 3.12Å
110	Q	37.3	Very low	36.4	Very low	183 Å²	183	101.8 Å²	101.8	86%	0.855	59%	0.589	S	S	*	*			trans	-60.8	114.7	157.3	-70.2	179.2	7.7	0	0	103.4	L108	L108-Q110 VanDerWaalsContact C-N 3.3Å; L108-Q110 PolarHBondContact O-N 3.28Å
111	S	27.5	Very low	35.7	Very low	99 Å²	99	109.5 Å²	109.5	69%	0.692	63%	0.634	S	S	*	*			trans	-51.1	130.2	166.4	-78.7	0	0	0	0	107.8	S109 Q113	S109-S111 PolarHBondContact O-N 2.63Å; S109-S111 VanDerWaalsContact O-N 3.12Å; S111-Q113 PolarHBondContact O-N 2.9Å
112	P	35.5	Very low	34.7	Very low	122 Å²	122	114.5 Å²	114.5	79%	0.792	66%	0.662	S	S	*	*			trans	-73.4	111.3	162	22.1	-14	0	0	0	107.9
113	Q	39.4	Very low	34.4	Very low	258 Å²	258	123.9 Å²	123.9	100%	1.206	72%	0.716	S	S	*	*			trans	65.8	0	172.5	-65.9	-83.9	-77.5	0	0	116.7	S111	S111-Q113 PolarHBondContact O-N 2.9Å

Retrieved 113 of 113 residues in 23.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).