X5J5D5_MOUSE Loading...

IgG1 heavy chain VDJ region

AlphaFold DB , UniProt , Accession X5J5D5, Species MOUSE (Mus musculus, Mouse), Gene n/a, Length 107 aa.

						>X5J5D5_MOUSE|X5J5D5
PELVKPGASVKISCKASGYAFSSSWMNWVKQRPGKGLEWIGRIYPGDGDTNYNGKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYFCARELPRGYWGQGTTPTVSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	P	60.3	Low	82	Confident	140 Å²	140	81.9 Å²	81.9	91%	0.909	47%	0.47	S	S	*	.				0	126.7	0	-11.1	28.9	0	0	0	109.6	T102	P1-T102 VanDerWaalsContact CA-O 3.26Å; P1-T102 WeakPolarHBondContact CA-O 3.47Å
2	E	67.1	Low	83	Confident	104 Å²	104	75.7 Å²	75.7	49%	0.486	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.3	119.7	176.1	-171.4	177.9	172.9	0	0	108.5	T102 T104	E2-T102 PolarHBondContact N-O 2.65Å; E2-T104 PolarHBondContact O-N 3.23Å
3	L	75.3	Confident	83.8	Confident	130 Å²	130	75.4 Å²	75.4	68%	0.681	44%	0.439	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.2	117.4	179.6	-156.4	94.7	0	0	0	109.1	T104	L3-T104 CarbonylContact C-O 3.6Å; L3-T104 WeakPolarHBondContact CA-O 3.42Å; L3-T104 HydrophobicContact CD1-CG2 4.46Å
4	V	80.3	Confident	84.5	Confident	14 Å²	14	71 Å²	71	9%	0.085	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	142.3	-175.4	-134.4	0	0	0	0	110.3	A8 L78 P103 T104 V105 S106	V4-A8 HydrophobicContact CG1-CB 3.97Å; V4-L78 HydrophobicContact CB-CD1 4Å; V4-L78 HydrophobicContact CG1-CD1 3.87Å; V4-L78 HydrophobicContact CG2-CD1 4.16Å; V4-P103 HydrophobicContact CG2-CB 4.04Å; V4-T104 PolarHBondContact N-O 2.9Å; V4-V105 WeakPolarHBondContact O-CA 3.25Å; V4-S106 PolarHBondContact O-N 2.62Å
5	K	82.8	Confident	85	Confident	163 Å²	163	76.8 Å²	76.8	71%	0.709	43%	0.433	S	S	*	.			trans	-76.5	149.8	175.3	-64.8	-177.2	-178.2	-178.8	0	110.7	A8	K5-A8 HydrophobicContact CB-CB 4.5Å; K5-A8 WeakPolarHBondContact O-CB 3.34Å; K5-A8 PolarHBondContact O-N 3.23Å
6	P	84.8	Confident	85.3	Confident	71 Å²	71	72.6 Å²	72.6	46%	0.461	41%	0.411	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59	143.6	172.1	-20.4	34.4	0	0	0	110.5	A8 L78 V105 S106	P6-A8 PolarHBondContact O-N 3.01Å; P6-L78 WeakPolarHBondContact CA-O 3.47Å; P6-V105 HydrophobicContact CB-CG1 4.4Å; P6-V105 HydrophobicContact CG-CG1 4.17Å; P6-S106 WeakPolarHBondContact CD-O 3.32Å; P6-S106 WeakPolarHBondContact CG-O 3.39Å
7	G	86.4	Confident	85.4	Confident	53 Å²	53	74.3 Å²	74.3	55%	0.546	43%	0.428	S	S	.	.	T	Hydrogen-bonded Turn	trans	77.4	-12.2	-176.5	0	0	0	0	0	114.9	L78	G7-L78 PolarHBondContact N-O 2.86Å
8	A	89.4	Confident	85.4	Confident	34 Å²	34	75.2 Å²	75.2	28%	0.281	46%	0.456	S	S	.	.			trans	-68.8	167.9	174.5	0	0	0	0	0	111.6	V4 K5 P6 S77 L78	V4-A8 HydrophobicContact CG1-CB 3.97Å; K5-A8 HydrophobicContact CB-CB 4.5Å; K5-A8 WeakPolarHBondContact O-CB 3.34Å; K5-A8 PolarHBondContact O-N 3.23Å; P6-A8 PolarHBondContact O-N 3.01Å; A8-S77 PolarHBondContact O-N 3.29Å; A8-L78 WeakPolarHBondContact O-CB 3.42Å; A8-L78 WeakPolarHBondContact O-CG 3.27Å; A8-L78 PolarHBondContact O-N 3.42Å
9	S	91	Very high	85.2	Confident	63 Å²	63	74.3 Å²	74.3	44%	0.441	44%	0.444	S	S	.	.			trans	-110.9	144.7	169.8	-57.8	0	0	0	0	110.1	L75 S76	S9-L75 CarbonylContact C-O 3.59Å; S9-L75 WeakPolarHBondContact CA-O 3.36Å; S9-L75 WeakPolarHBondContact CB-O 3.11Å; S9-S76 WeakPolarHBondContact OG-CA 3.31Å
10	V	91.6	Very high	85.4	Confident	5 Å²	5	73.5 Å²	73.5	3%	0.03	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	143.3	172.8	69.7	0	0	0	0	109.8	I12 Q74 L75 L78	V10-I12 HydrophobicContact CG1-CD1 4.44Å; V10-I12 HydrophobicContact CG1-CG1 4.44Å; V10-Q74 CarbonylContact O-C 3.54Å; V10-Q74 VanDerWaalsContact O-CA 3.31Å; V10-Q74 WeakPolarHBondContact O-CA 3.4Å; V10-L75 HydrophobicContact CG1-CB 4.08Å; V10-L75 HydrophobicContact CG1-CD1 4.27Å; V10-L75 PolarHBondContact N-O 3.17Å; V10-L75 PolarHBondContact O-N 3.35Å; V10-L78 HydrophobicContact CB-CD1 3.93Å; V10-L78 HydrophobicContact CG1-CD1 3.76Å; V10-L78 HydrophobicContact CG1-CD2 4.26Å; V10-L78 HydrophobicContact CG1-CG 4.5Å
11	K	93.2	Very high	85.6	Confident	124 Å²	124	70.3 Å²	70.3	54%	0.539	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	112.5	174.8	-174.1	177	179.6	-180	0	109.2	Y72	K11-Y72 HydrophobicContact CD-CD1 4.33Å; K11-Y72 HydrophobicContact CG-CD1 4.31Å
12	I	93.3	Very high	87.1	Confident	7 Å²	7	66.5 Å²	66.5	4%	0.036	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.6	134.2	177.9	-59.6	161.9	0	0	0	108.2	V10 W28 Y72 M73 L75 Y86 P103	V10-I12 HydrophobicContact CG1-CD1 4.44Å; V10-I12 HydrophobicContact CG1-CG1 4.44Å; I12-W28 HydrophobicContact CB-CH2 4.34Å; I12-W28 HydrophobicContact CB-CZ3 4.12Å; I12-W28 HydrophobicContact CG2-CH2 3.95Å; I12-W28 HydrophobicContact CG2-CZ3 3.59Å; I12-Y72 CarbonylContact O-C 3.54Å; I12-Y72 WeakPolarHBondContact O-CA 3.4Å; I12-M73 HydrophobicContact CD1-CE 3.55Å; I12-M73 PolarHBondContact N-O 2.97Å; I12-M73 PolarHBondContact O-N 2.85Å; I12-L75 HydrophobicContact CD1-CD1 4.2Å; I12-Y86 HydrophobicContact CD1-CD1 4.42Å; I12-Y86 HydrophobicContact CD1-CD2 3.94Å; I12-Y86 HydrophobicContact CD1-CG 3.79Å; I12-P103 HydrophobicContact CD1-CG 4.48Å
13	S	94.2	Very high	88.2	Confident	72 Å²	72	64.7 Å²	64.7	50%	0.503	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	149.6	177.7	62.1	0	0	0	0	111.7	A71	S13-A71 CarbonylContact C-O 3.53Å; S13-A71 WeakPolarHBondContact CA-O 3.44Å
14	C	93.4	Very high	88.9	Confident	14 Å²	14	59.7 Å²	59.7	10%	0.095	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139	108.1	173.1	176.8	0	0	0	0	109.3	W28 T70 A71 C88	C14-W28 HydrophobicContact CB-CH2 3.72Å; C14-W28 HydrophobicContact CB-CZ2 3.98Å; C14-W28 HydrophobicContact CB-CZ3 4.49Å; C14-T70 WeakPolarHBondContact O-CA 3.33Å; C14-A71 PolarHBondContact N-O 2.85Å; C14-A71 PolarHBondContact O-N 3.08Å; C14-C88 HydrophobicContact CB-CB 3.45Å; C14-C88 VanDerWaalsContact CB-CB 3.45Å; C14-C88 WeakPolarHBondContact CB-SG 3.26Å; C14-C88 WeakPolarHBondContact SG-CB 3.36Å; C14-C88 CovalentContact SG-SG 2.02Å; C14-C88 PolarHBondContact SG-SG 2.83Å
15	K	92.6	Very high	89.5	Confident	158 Å²	158	62.4 Å²	62.4	69%	0.687	39%	0.386	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.1	120.5	177.8	-171.5	173.6	-176	177.6	0	109.9
16	A	89.1	Confident	90	Very high	10 Å²	10	54.7 Å²	54.7	8%	0.083	35%	0.353	C	S	.	.			trans	-76.8	146.3	174.1	0	0	0	0	0	111	Y19 F21 M26 S69	A16-Y19 HydrophobicContact CB-CE1 3.83Å; A16-Y19 HydrophobicContact CB-CE2 4.16Å; A16-Y19 VanDerWaalsContact CB-CZ 3.49Å; A16-Y19 VanDerWaalsContact CB-OH 3.27Å; A16-Y19 WeakPolarHBondContact CB-OH 3.4Å; A16-F21 HydrophobicContact CB-CB 4.05Å; A16-F21 HydrophobicContact CB-CD2 3.4Å; A16-F21 HydrophobicContact CB-CE2 4.13Å; A16-F21 HydrophobicContact CB-CG 4.01Å; A16-M26 HydrophobicContact CB-CE 4.27Å; A16-S69 PolarHBondContact N-O 2.92Å
17	S	87.3	Confident	90.5	Very high	101 Å²	101	51.9 Å²	51.9	71%	0.706	33%	0.333	S	S	*	.			trans	-148.2	149.5	172.9	60.5	0	0	0	0	110	Y19	S17-Y19 VanDerWaalsContact O-CD1 3.24Å; S17-Y19 WeakPolarHBondContact O-CD1 3.17Å; S17-Y19 PolarHBondContact O-N 2.99Å
18	G	84.4	Confident	90.9	Very high	90 Å²	90	49.4 Å²	49.4	93%	0.928	31%	0.308	S	S	*	.	S	Bend	trans	77.7	11.7	176.1	0	0	0	0	0	116.1
19	Y	82.6	Confident	91.1	Very high	59 Å²	59	48 Å²	48	23%	0.231	30%	0.295	C	S	.	.	S	Bend	trans	-156.8	167.1	173.3	64.9	-84.7	0	0	0	112.3	A16 S17 F21 S24 M26 R90	A16-Y19 HydrophobicContact CB-CE1 3.83Å; A16-Y19 HydrophobicContact CB-CE2 4.16Å; A16-Y19 VanDerWaalsContact CB-CZ 3.49Å; A16-Y19 VanDerWaalsContact CB-OH 3.27Å; A16-Y19 WeakPolarHBondContact CB-OH 3.4Å; S17-Y19 VanDerWaalsContact O-CD1 3.24Å; S17-Y19 WeakPolarHBondContact O-CD1 3.17Å; S17-Y19 PolarHBondContact O-N 2.99Å; Y19-F21 PolarHBondContact O-N 3.49Å; Y19-S24 WeakPolarHBondContact CD2-OG 3.39Å; Y19-M26 WeakPolarHBondContact OH-CE 3.35Å; Y19-R90 HydrophobicContact CE2-CG 4.08Å
20	A	88.4	Confident	91.3	Very high	57 Å²	57	45 Å²	45	47%	0.471	27%	0.274	S	S	.	.			trans	-71.7	97.4	174.2	0	0	0	0	0	110.7	S22 S23 S24	A20-S22 VanDerWaalsContact C-N 3.32Å; A20-S22 PolarHBondContact O-N 2.9Å; A20-S23 WeakPolarHBondContact CB-OG 3.47Å; A20-S23 PolarHBondContact O-N 2.82Å; A20-S23 PolarHBondContact O-OG 2.76Å; A20-S24 PolarHBondContact O-OG 2.96Å
21	F	90.3	Very high	91.3	Very high	7 Å²	7	48.3 Å²	48.3	3%	0.031	29%	0.289	C	S	.	.	G	3₁₀ helix	trans	-59.1	-39.9	-177.3	175.8	-112.8	0	0	0	113	A16 Y19 S23 S24 M26 P45 A64 A71	A16-F21 HydrophobicContact CB-CB 4.05Å; A16-F21 HydrophobicContact CB-CD2 3.4Å; A16-F21 HydrophobicContact CB-CE2 4.13Å; A16-F21 HydrophobicContact CB-CG 4.01Å; Y19-F21 PolarHBondContact O-N 3.49Å; F21-S23 PolarHBondContact O-N 2.79Å; F21-S24 PolarHBondContact O-N 3.15Å; F21-M26 HydrophobicContact CD2-CE 4.28Å; F21-M26 HydrophobicContact CE2-CE 3.87Å; F21-P45 HydrophobicContact CD1-CB 3.8Å; F21-P45 HydrophobicContact CD1-CG 4.05Å; F21-P45 HydrophobicContact CD2-CG 3.99Å; F21-P45 HydrophobicContact CE1-CB 3.45Å; F21-P45 VanDerWaalsContact CE1-CB 3.45Å; F21-P45 HydrophobicContact CE1-CG 3.65Å; F21-P45 HydrophobicContact CE2-CB 4.32Å; F21-P45 HydrophobicContact CE2-CG 3.57Å; F21-P45 HydrophobicContact CG-CB 4.4Å; F21-P45 HydrophobicContact CG-CG 4.23Å; F21-P45 HydrophobicContact CZ-CB 3.74Å; F21-P45 HydrophobicContact CZ-CG 3.39Å; F21-P45 WeakPolarHBondContact O-CG 3.35Å; F21-A64 HydrophobicContact CE1-CB 4.09Å; F21-A64 HydrophobicContact CZ-CB 3.92Å; F21-A71 HydrophobicContact CE2-CB 4.07Å; F21-A71 HydrophobicContact CZ-CB 3.95Å
22	S	91.3	Very high	91	Very high	61 Å²	61	44.6 Å²	44.6	43%	0.427	27%	0.272	S	S	.	.	G	3₁₀ helix	trans	-69	-12.8	-179.7	52.6	0	0	0	0	114.6	A20 G46	A20-S22 VanDerWaalsContact C-N 3.32Å; A20-S22 PolarHBondContact O-N 2.9Å; S22-G46 WeakPolarHBondContact O-CA 3.39Å; S22-G46 PolarHBondContact O-N 3.46Å; S22-G46 VanDerWaalsContact O-N 3.11Å
23	S	90.4	Very high	90.6	Very high	66 Å²	66	49.8 Å²	49.8	46%	0.462	31%	0.306	S	S	.	.	G	3₁₀ helix	trans	-114.4	14.7	-179.6	64	0	0	0	0	113.8	A20 F21 Y44	A20-S23 WeakPolarHBondContact CB-OG 3.47Å; A20-S23 PolarHBondContact O-N 2.82Å; A20-S23 PolarHBondContact O-OG 2.76Å; F21-S23 PolarHBondContact O-N 2.79Å; S23-Y44 VanDerWaalsContact C-CE2 3.41Å; S23-Y44 WeakPolarHBondContact CA-OH 3.14Å
24	S	89.6	Confident	90.2	Very high	24 Å²	24	50.8 Å²	50.8	17%	0.168	33%	0.328	C	S	.	.	S	Bend	trans	-133.5	136.3	-174.9	-61.6	0	0	0	0	111.7	Y19 A20 F21 P45	Y19-S24 WeakPolarHBondContact CD2-OG 3.39Å; A20-S24 PolarHBondContact O-OG 2.96Å; F21-S24 PolarHBondContact O-N 3.15Å; S24-P45 WeakPolarHBondContact O-CD 3.49Å
25	W	92.4	Very high	89.8	Confident	71 Å²	71	56.3 Å²	56.3	27%	0.269	35%	0.351	S	S	.	.			trans	-64.4	139.4	171.4	-72.7	97.2	0	0	0	111.1	R42 Y44 D49 R90	W25-R42 HydrophobicContact CD2-CG 4.27Å; W25-R42 HydrophobicContact CE3-CB 3.97Å; W25-R42 HydrophobicContact CE3-CG 3.45Å; W25-R42 VanDerWaalsContact CE3-CG 3.45Å; W25-R42 HydrophobicContact CZ3-CG 3.74Å; W25-Y44 AromaticContact CD1-CD2 3.95Å; W25-Y44 AromaticContact CD2-CD2 3.94Å; W25-Y44 HydrophobicContact CD2-CD2 3.94Å; W25-Y44 HydrophobicContact CD2-CG 4.34Å; W25-Y44 AromaticContact CE2-CD2 3.82Å; W25-Y44 VanDerWaalsContact CE3-N 3.26Å; W25-Y44 HydrophobicContact CG-CD2 4.04Å; W25-Y44 HydrophobicContact CZ2-CD2 4.36Å; W25-Y44 HydrophobicContact CZ2-CG 4.23Å; W25-Y44 AromaticContact NE1-CD2 3.79Å; W25-D49 HydrophobicContact CH2-CB 3.94Å; W25-D49 WeakPolarHBondContact CH2-OD2 3.24Å; W25-D49 WeakPolarHBondContact CZ3-O 3.14Å; W25-R90 VanDerWaalsContact O-O 3.11Å
26	M	93.8	Very high	89.5	Confident	2 Å²	2	51.5 Å²	51.5	1%	0.01	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	114.6	168.8	-174.7	68.5	76.1	0	0	109	A16 Y19 F21 R42 I43 A71 C88	A16-M26 HydrophobicContact CB-CE 4.27Å; Y19-M26 WeakPolarHBondContact OH-CE 3.35Å; F21-M26 HydrophobicContact CD2-CE 4.28Å; F21-M26 HydrophobicContact CE2-CE 3.87Å; M26-R42 CarbonylContact O-C 3.51Å; M26-R42 WeakPolarHBondContact O-CA 3.47Å; M26-R42 WeakPolarHBondContact O-CB 3.32Å; M26-I43 HydrophobicContact CB-CG2 4.02Å; M26-I43 PolarHBondContact N-O 3.25Å; M26-I43 PolarHBondContact O-N 2.87Å; M26-A71 HydrophobicContact CB-CB 4.2Å; M26-A71 HydrophobicContact CE-CB 4.37Å; M26-A71 HydrophobicContact CG-CB 3.73Å; M26-C88 HydrophobicContact CG-CB 4.37Å; M26-C88 HydrophobicContact SD-CB 3.76Å
27	N	95	Very high	89.6	Confident	11 Å²	11	55.5 Å²	55.5	6%	0.059	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91	149.3	177.3	-59.8	-90.4	0	0	0	110.4	W39 G41 R42 C88 A89 R90 L92	N27-W39 PolarHBondContact OD1-NE1 2.85Å; N27-G41 CarbonylContact C-O 3.56Å; N27-G41 WeakPolarHBondContact CA-O 3.03Å; N27-R42 HydrophobicContact CB-CB 4.47Å; N27-R42 WeakPolarHBondContact OD1-CB 3.42Å; N27-C88 CarbonylContact O-C 3.5Å; N27-C88 WeakPolarHBondContact O-CA 3.22Å; N27-A89 WeakPolarHBondContact CA-O 3.24Å; N27-A89 HydrophobicContact CB-CB 4.47Å; N27-A89 VanDerWaalsContact CB-O 3.28Å; N27-A89 WeakPolarHBondContact CB-O 3.22Å; N27-A89 PolarHBondContact N-O 3.04Å; N27-A89 PolarHBondContact ND2-O 3.24Å; N27-A89 PolarHBondContact O-N 3.3Å; N27-R90 PolarHBondContact ND2-O 3.11Å; N27-R90 VanDerWaalsContact ND2-O 3.17Å; N27-L92 HydrophobicContact CB-CD1 3.79Å; N27-L92 HydrophobicContact CB-CG 4.17Å
28	W	95.5	Very high	89.9	Confident	2 Å²	2	52.3 Å²	52.3	1%	0.008	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	134.8	173.1	-69.6	91.8	0	0	0	110	I12 C14 I40 G41 L62 A71 M73 F87 C88	I12-W28 HydrophobicContact CB-CH2 4.34Å; I12-W28 HydrophobicContact CB-CZ3 4.12Å; I12-W28 HydrophobicContact CG2-CH2 3.95Å; I12-W28 HydrophobicContact CG2-CZ3 3.59Å; C14-W28 HydrophobicContact CB-CH2 3.72Å; C14-W28 HydrophobicContact CB-CZ2 3.98Å; C14-W28 HydrophobicContact CB-CZ3 4.49Å; W28-I40 HydrophobicContact CB-CB 4.14Å; W28-I40 HydrophobicContact CB-CD1 4.33Å; W28-I40 WeakPolarHBondContact O-CB 3.47Å; W28-I40 PolarHBondContact O-N 2.98Å; W28-G41 PolarHBondContact N-O 3.14Å; W28-L62 VanDerWaalsContact CD1-CD2 3.48Å; W28-L62 HydrophobicContact CG-CD2 4Å; W28-A71 HydrophobicContact CZ2-CB 4.16Å; W28-M73 HydrophobicContact CB-SD 3.95Å; W28-M73 HydrophobicContact CD2-CB 3.64Å; W28-M73 HydrophobicContact CD2-CG 4.43Å; W28-M73 HydrophobicContact CD2-SD 4.13Å; W28-M73 HydrophobicContact CE3-CB 3.83Å; W28-M73 HydrophobicContact CE3-CE 3.9Å; W28-M73 HydrophobicContact CE3-SD 4.1Å; W28-M73 HydrophobicContact CG-CB 4.18Å; W28-M73 HydrophobicContact CG-SD 4.1Å; W28-M73 HydrophobicContact CH2-CB 4.04Å; W28-M73 HydrophobicContact CZ2-CB 3.87Å; W28-M73 HydrophobicContact CZ3-CB 4.03Å; W28-M73 HydrophobicContact CZ3-CE 4.34Å; W28-F87 CarbonylContact C-O 3.5Å; W28-F87 WeakPolarHBondContact CA-O 3.07Å; W28-C88 HydrophobicContact CD2-CB 4.47Å; W28-C88 HydrophobicContact CE3-CB 4.26Å; W28-C88 HydrophobicContact CH2-CB 4.4Å; W28-C88 HydrophobicContact CZ3-CB 4.22Å
29	V	94.4	Very high	90.4	Very high	3 Å²	3	51.1 Å²	51.1	2%	0.018	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	135.9	-172.7	-175.5	0	0	0	0	109.6	L37 E38 Y86 F87 L92 W97	V29-L37 HydrophobicContact CG1-CB 3.78Å; V29-L37 HydrophobicContact CG1-CD2 3.93Å; V29-L37 HydrophobicContact CG1-CG 4.32Å; V29-E38 CarbonylContact C-O 3.6Å; V29-E38 WeakPolarHBondContact CA-O 3.43Å; V29-Y86 CarbonylContact O-C 3.59Å; V29-Y86 WeakPolarHBondContact O-CA 3.4Å; V29-F87 PolarHBondContact N-O 2.79Å; V29-F87 PolarHBondContact O-N 3Å; V29-L92 HydrophobicContact CG2-CD1 4.1Å; V29-L92 HydrophobicContact CG2-CD2 4.34Å; V29-W97 HydrophobicContact CB-CH2 4.33Å; V29-W97 HydrophobicContact CB-CZ3 3.93Å; V29-W97 HydrophobicContact CG1-CH2 4.27Å; V29-W97 HydrophobicContact CG1-CZ3 4.19Å; V29-W97 HydrophobicContact CG2-CH2 3.93Å; V29-W97 HydrophobicContact CG2-CZ3 3.82Å
30	K	93.8	Very high	91	Very high	1 Å²	1	48.3 Å²	48.3	0%	0.004	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	134.2	173.8	-177.3	176.8	-178.1	174.2	0	109.6	E38 I40 F56 E81 D82 A84 V85 Y86	K30-E38 HydrophobicContact CB-CB 4.38Å; K30-E38 PolarHBondContact N-O 3.44Å; K30-E38 PolarHBondContact O-N 2.58Å; K30-I40 HydrophobicContact CB-CD1 3.99Å; K30-I40 HydrophobicContact CB-CG1 4.15Å; K30-F56 HydrophobicContact CB-CZ 4.42Å; K30-F56 HydrophobicContact CD-CE1 3.93Å; K30-F56 HydrophobicContact CD-CZ 3.98Å; K30-E81 WeakPolarHBondContact CE-O 3.34Å; K30-E81 PolarHBondContact NZ-O 3.21Å; K30-D82 IonicContact NZ-OD1 2.98Å; K30-D82 PolarHBondContact NZ-OD1 2.85Å; K30-D82 VanDerWaalsContact NZ-OD1 3.14Å; K30-A84 HydrophobicContact CD-CB 4.16Å; K30-A84 HydrophobicContact CG-CB 3.56Å; K30-V85 CarbonylContact C-O 3.57Å; K30-Y86 HydrophobicContact CB-CD1 4.1Å; K30-Y86 HydrophobicContact CB-CE1 3.87Å; K30-Y86 HydrophobicContact CD-CE1 3.85Å; K30-Y86 WeakPolarHBondContact CE-OH 3.49Å; K30-Y86 HydrophobicContact CG-CD1 4.27Å; K30-Y86 HydrophobicContact CG-CE1 3.71Å
31	Q	91.4	Very high	91.4	Very high	74 Å²	74	45.6 Å²	45.6	35%	0.346	27%	0.273	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	117.2	171.3	-169.2	-178.4	36.2	0	0	109.8	L37 A84 V85 F87	Q31-L37 HydrophobicContact CB-CD2 3.75Å; Q31-L37 HydrophobicContact CG-CD2 3.83Å; Q31-A84 WeakPolarHBondContact O-CB 3.28Å; Q31-V85 HydrophobicContact CB-CB 4.48Å; Q31-V85 PolarHBondContact N-O 2.91Å; Q31-V85 PolarHBondContact O-N 3.11Å; Q31-F87 HydrophobicContact CB-CD2 4.31Å; Q31-F87 HydrophobicContact CB-CE2 3.74Å
32	R	88.1	Confident	91.6	Very high	46 Å²	46	49.7 Å²	49.7	17%	0.174	29%	0.288	C	S	.	.			trans	-92.8	144	172.7	-73.1	169.3	170.9	155.8	-13.3	109.8	G34 K35 E38 E81 A84	R32-G34 PolarHBondContact O-N 2.92Å; R32-K35 HydrophobicContact CB-CB 4.04Å; R32-K35 HydrophobicContact CB-CD 4.25Å; R32-K35 HydrophobicContact CB-CG 4.28Å; R32-K35 PolarHBondContact O-N 3.43Å; R32-E38 IonicContact CZ-OE1 3.53Å; R32-E38 IonicContact NE-OE1 3.14Å; R32-E38 IonicContact NH1-OE1 3.49Å; R32-E38 PolarHBondContact NH1-OE1 3.44Å; R32-E81 PolarHBondContact NE-O 3.13Å; R32-E81 VanDerWaalsContact NE-O 3.08Å; R32-E81 PolarHBondContact NH2-O 3.06Å; R32-E81 IonicContact NH2-OE2 2.85Å; R32-E81 PolarHBondContact NH2-OE2 3.18Å; R32-A84 HydrophobicContact CG-CB 4Å
33	P	84.1	Confident	91.9	Very high	116 Å²	116	47 Å²	47	75%	0.753	27%	0.269	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.4	129.4	172.7	-25.6	34.4	0	0	0	111.2	K35	P33-K35 PolarHBondContact O-N 3.28Å
34	G	85.4	Confident	92.1	Very high	93 Å²	93	46.7 Å²	46.7	96%	0.959	26%	0.258	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.8	6.1	-179.3	0	0	0	0	0	115.8	R32	R32-G34 PolarHBondContact O-N 2.92Å
35	K	86	Confident	92.4	Very high	131 Å²	131	45.7 Å²	45.7	57%	0.57	25%	0.251	S	S	*	.	S	Bend	trans	-121.7	162.2	174	-59.1	-169.2	179.3	-174.3	0	111.5	R32 P33	R32-K35 HydrophobicContact CB-CB 4.04Å; R32-K35 HydrophobicContact CB-CD 4.25Å; R32-K35 HydrophobicContact CB-CG 4.28Å; R32-K35 PolarHBondContact O-N 3.43Å; P33-K35 PolarHBondContact O-N 3.28Å
36	G	87.2	Confident	92.5	Very high	56 Å²	56	43.5 Å²	43.5	58%	0.577	25%	0.251	S	S	*	.			trans	-67.7	174.9	174.6	0	0	0	0	0	113.6
37	L	90.7	Very high	92.5	Very high	94 Å²	94	49.1 Å²	49.1	49%	0.492	28%	0.281	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.4	129.8	173.6	-64.3	174.2	0	0	0	110.5	V29 Q31 W97	V29-L37 HydrophobicContact CG1-CB 3.78Å; V29-L37 HydrophobicContact CG1-CD2 3.93Å; V29-L37 HydrophobicContact CG1-CG 4.32Å; Q31-L37 HydrophobicContact CB-CD2 3.75Å; Q31-L37 HydrophobicContact CG-CD2 3.83Å; L37-W97 HydrophobicContact CD1-CH2 3.86Å; L37-W97 HydrophobicContact CD1-CZ2 4.33Å
38	E	93.3	Very high	92.5	Very high	34 Å²	34	50.5 Å²	50.5	16%	0.159	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	113	174.5	-60.7	-170.5	-109	0	0	109.2	V29 K30 R32 I40 K55 F56	V29-E38 CarbonylContact C-O 3.6Å; V29-E38 WeakPolarHBondContact CA-O 3.43Å; K30-E38 HydrophobicContact CB-CB 4.38Å; K30-E38 PolarHBondContact N-O 3.44Å; K30-E38 PolarHBondContact O-N 2.58Å; R32-E38 IonicContact CZ-OE1 3.53Å; R32-E38 IonicContact NE-OE1 3.14Å; R32-E38 IonicContact NH1-OE1 3.49Å; R32-E38 PolarHBondContact NH1-OE1 3.44Å; E38-I40 PolarHBondContact O-N 2.84Å; E38-K55 IonicContact OE2-NZ 3.63Å; E38-F56 HydrophobicContact CB-CE2 4.39Å; E38-F56 HydrophobicContact CB-CZ 4.35Å
39	W	94.3	Very high	92.5	Very high	66 Å²	66	54.5 Å²	54.5	25%	0.25	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.9	128.1	175.1	-177.6	78.5	0	0	0	110.5	N27 G41 R42 N51 N53 L92	N27-W39 PolarHBondContact OD1-NE1 2.85Å; W39-G41 PolarHBondContact NE1-O 3.02Å; W39-R42 HydrophobicContact CZ2-CB 4.01Å; W39-R42 HydrophobicContact CZ2-CG 3.84Å; W39-N51 HydrophobicContact CH2-CB 4.36Å; W39-N51 WeakPolarHBondContact CH2-OD1 3.4Å; W39-N53 HydrophobicContact CE3-CB 3.79Å; W39-N53 HydrophobicContact CZ3-CB 4Å; W39-N53 WeakPolarHBondContact O-CB 3.39Å; W39-N53 PolarHBondContact O-ND2 3.21Å; W39-L92 VanDerWaalsContact CD1-CD1 3.46Å
40	I	95.8	Very high	92.6	Very high	0 Å²	0	56.7 Å²	56.7	0%	0	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	-48	-176.8	-60	174.1	0	0	0	110.1	W28 K30 E38 N53 F56 A60 M73 Y86	W28-I40 HydrophobicContact CB-CB 4.14Å; W28-I40 HydrophobicContact CB-CD1 4.33Å; W28-I40 WeakPolarHBondContact O-CB 3.47Å; W28-I40 PolarHBondContact O-N 2.98Å; K30-I40 HydrophobicContact CB-CD1 3.99Å; K30-I40 HydrophobicContact CB-CG1 4.15Å; E38-I40 PolarHBondContact O-N 2.84Å; I40-N53 WeakPolarHBondContact O-CB 3.36Å; I40-N53 PolarHBondContact O-N 3.19Å; I40-F56 HydrophobicContact CB-CD2 4.27Å; I40-F56 HydrophobicContact CB-CG 4.22Å; I40-F56 HydrophobicContact CG1-CD1 4.15Å; I40-F56 HydrophobicContact CG1-CD2 4.24Å; I40-F56 HydrophobicContact CG1-CE1 4.06Å; I40-F56 HydrophobicContact CG1-CE2 4.13Å; I40-F56 HydrophobicContact CG1-CG 4.24Å; I40-F56 HydrophobicContact CG1-CZ 4.04Å; I40-F56 HydrophobicContact CG2-CB 3.73Å; I40-F56 HydrophobicContact CG2-CD1 4.05Å; I40-F56 HydrophobicContact CG2-CD2 4.31Å; I40-F56 HydrophobicContact CG2-CG 3.78Å; I40-A60 HydrophobicContact CG2-CB 3.72Å; I40-M73 HydrophobicContact CD1-CE 4.04Å; I40-M73 HydrophobicContact CD1-SD 3.55Å; I40-M73 VanDerWaalsContact CD1-SD 3.55Å; I40-M73 HydrophobicContact CG2-SD 3.97Å; I40-Y86 HydrophobicContact CD1-CD1 3.64Å; I40-Y86 HydrophobicContact CD1-CE1 3.84Å
41	G	96.2	Very high	92.7	Very high	0 Å²	0	60.4 Å²	60.4	0%	0	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	169.1	-179.3	-172.5	0	0	0	0	0	111.7	N27 W28 W39 N51	N27-G41 CarbonylContact C-O 3.56Å; N27-G41 WeakPolarHBondContact CA-O 3.03Å; W28-G41 PolarHBondContact N-O 3.14Å; W39-G41 PolarHBondContact NE1-O 3.02Å; G41-N51 CarbonylContact C-O 3.47Å; G41-N51 WeakPolarHBondContact CA-O 2.97Å
42	R	96	Very high	93	Very high	92 Å²	92	59.6 Å²	59.6	35%	0.347	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.1	154.9	174	67.5	-177	-174.2	-168.9	-0.5	111.5	W25 M26 N27 W39 T50 N51	W25-R42 HydrophobicContact CD2-CG 4.27Å; W25-R42 HydrophobicContact CE3-CB 3.97Å; W25-R42 HydrophobicContact CE3-CG 3.45Å; W25-R42 VanDerWaalsContact CE3-CG 3.45Å; W25-R42 HydrophobicContact CZ3-CG 3.74Å; M26-R42 CarbonylContact O-C 3.51Å; M26-R42 WeakPolarHBondContact O-CA 3.47Å; M26-R42 WeakPolarHBondContact O-CB 3.32Å; N27-R42 HydrophobicContact CB-CB 4.47Å; N27-R42 WeakPolarHBondContact OD1-CB 3.42Å; W39-R42 HydrophobicContact CZ2-CB 4.01Å; W39-R42 HydrophobicContact CZ2-CG 3.84Å; R42-T50 WeakPolarHBondContact O-CA 3.2Å; R42-N51 HydrophobicContact CG-CB 4.15Å; R42-N51 PolarHBondContact N-O 2.87Å; R42-N51 PolarHBondContact O-N 2.82Å
43	I	96.6	Very high	93.3	Very high	4 Å²	4	59.6 Å²	59.6	2%	0.021	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	140.1	174.1	-176.8	165.8	0	0	0	110	M26 P45 D49 T50 L62 A64 A71	M26-I43 HydrophobicContact CB-CG2 4.02Å; M26-I43 PolarHBondContact N-O 3.25Å; M26-I43 PolarHBondContact O-N 2.87Å; I43-P45 WeakPolarHBondContact O-CD 3.41Å; I43-D49 CarbonylContact C-O 3.6Å; I43-D49 VanDerWaalsContact CA-O 3.31Å; I43-D49 WeakPolarHBondContact CA-O 3.12Å; I43-T50 HydrophobicContact CB-CG2 3.99Å; I43-T50 HydrophobicContact CD1-CG2 3.98Å; I43-T50 HydrophobicContact CG1-CG2 3.82Å; I43-L62 HydrophobicContact CB-CB 4.09Å; I43-L62 HydrophobicContact CB-CD1 4.42Å; I43-L62 HydrophobicContact CD1-CB 4.36Å; I43-L62 HydrophobicContact CG2-CB 4.42Å; I43-A64 HydrophobicContact CD1-CB 3.92Å; I43-A71 HydrophobicContact CG2-CB 4.48Å
44	Y	95.5	Very high	93.7	Very high	60 Å²	60	57 Å²	57	24%	0.235	34%	0.344	C	S	.	.			trans	-99.4	108	168.3	-169.2	-108	0	0	0	108.6	S23 W25 G46 D47 G48 D49	S23-Y44 VanDerWaalsContact C-CE2 3.41Å; S23-Y44 WeakPolarHBondContact CA-OH 3.14Å; W25-Y44 AromaticContact CD1-CD2 3.95Å; W25-Y44 AromaticContact CD2-CD2 3.94Å; W25-Y44 HydrophobicContact CD2-CD2 3.94Å; W25-Y44 HydrophobicContact CD2-CG 4.34Å; W25-Y44 AromaticContact CE2-CD2 3.82Å; W25-Y44 VanDerWaalsContact CE3-N 3.26Å; W25-Y44 HydrophobicContact CG-CD2 4.04Å; W25-Y44 HydrophobicContact CZ2-CD2 4.36Å; W25-Y44 HydrophobicContact CZ2-CG 4.23Å; W25-Y44 AromaticContact NE1-CD2 3.79Å; Y44-G46 PolarHBondContact O-N 2.81Å; Y44-G46 VanDerWaalsContact O-N 3.12Å; Y44-D47 WeakPolarHBondContact CD1-OD1 3.35Å; Y44-G48 VanDerWaalsContact O-CA 3.26Å; Y44-G48 WeakPolarHBondContact O-CA 3.47Å; Y44-G48 PolarHBondContact O-N 2.69Å; Y44-D49 PolarHBondContact N-O 2.85Å
45	P	94.9	Very high	94	Very high	4 Å²	4	59.7 Å²	59.7	3%	0.026	33%	0.329	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.9	-17.4	-172.9	-24	36.2	0	0	0	114.6	F21 S24 I43 A64 K66	F21-P45 HydrophobicContact CD1-CB 3.8Å; F21-P45 HydrophobicContact CD1-CG 4.05Å; F21-P45 HydrophobicContact CD2-CG 3.99Å; F21-P45 HydrophobicContact CE1-CB 3.45Å; F21-P45 VanDerWaalsContact CE1-CB 3.45Å; F21-P45 HydrophobicContact CE1-CG 3.65Å; F21-P45 HydrophobicContact CE2-CB 4.32Å; F21-P45 HydrophobicContact CE2-CG 3.57Å; F21-P45 HydrophobicContact CG-CB 4.4Å; F21-P45 HydrophobicContact CG-CG 4.23Å; F21-P45 HydrophobicContact CZ-CB 3.74Å; F21-P45 HydrophobicContact CZ-CG 3.39Å; F21-P45 WeakPolarHBondContact O-CG 3.35Å; S24-P45 WeakPolarHBondContact O-CD 3.49Å; I43-P45 WeakPolarHBondContact O-CD 3.41Å; P45-A64 HydrophobicContact CB-CB 3.78Å; P45-A64 HydrophobicContact CG-CB 4.09Å; P45-K66 VanDerWaalsContact O-CD 3.25Å; P45-K66 WeakPolarHBondContact O-CD 3.22Å; P45-K66 WeakPolarHBondContact O-CG 3.25Å
46	G	93.7	Very high	94.3	Very high	25 Å²	25	54 Å²	54	26%	0.258	30%	0.304	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.9	-55.7	-179	0	0	0	0	0	112.6	S22 Y44 K66	S22-G46 WeakPolarHBondContact O-CA 3.39Å; S22-G46 PolarHBondContact O-N 3.46Å; S22-G46 VanDerWaalsContact O-N 3.11Å; Y44-G46 PolarHBondContact O-N 2.81Å; Y44-G46 VanDerWaalsContact O-N 3.12Å; G46-K66 PolarHBondContact O-NZ 2.82Å
47	D	94.8	Very high	94.5	Very high	119 Å²	119	59 Å²	59	64%	0.636	31%	0.31	S	S	*	.	T	Hydrogen-bonded Turn	trans	-113.9	-9.6	-177.6	56.8	20	0	0	0	113.6	Y44 D49	Y44-D47 WeakPolarHBondContact CD1-OD1 3.35Å; D47-D49 VanDerWaalsContact OD1-CB 3.3Å; D47-D49 WeakPolarHBondContact OD1-CB 3.48Å; D47-D49 PolarHBondContact OD1-N 2.99Å
48	G	94.4	Very high	94.5	Very high	40 Å²	40	57.9 Å²	57.9	41%	0.412	32%	0.322	S	S	.	.			trans	83.9	11.8	-178.3	0	0	0	0	0	114.1	Y44	Y44-G48 VanDerWaalsContact O-CA 3.26Å; Y44-G48 WeakPolarHBondContact O-CA 3.47Å; Y44-G48 PolarHBondContact O-N 2.69Å
49	D	96.1	Very high	94.5	Very high	87 Å²	87	58.7 Å²	58.7	47%	0.465	33%	0.325	S	S	.	.			trans	-60.1	139.6	176.8	-172.5	24.8	0	0	0	110.8	W25 I43 Y44 D47	W25-D49 HydrophobicContact CH2-CB 3.94Å; W25-D49 WeakPolarHBondContact CH2-OD2 3.24Å; W25-D49 WeakPolarHBondContact CZ3-O 3.14Å; I43-D49 CarbonylContact C-O 3.6Å; I43-D49 VanDerWaalsContact CA-O 3.31Å; I43-D49 WeakPolarHBondContact CA-O 3.12Å; Y44-D49 PolarHBondContact N-O 2.85Å; D47-D49 VanDerWaalsContact OD1-CB 3.3Å; D47-D49 WeakPolarHBondContact OD1-CB 3.48Å; D47-D49 PolarHBondContact OD1-N 2.99Å
50	T	97	Very high	94.6	Very high	48 Å²	48	55.8 Å²	55.8	29%	0.294	31%	0.314	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.4	139.7	-176	54.5	0	0	0	0	111.7	R42 I43 Y52 L62	R42-T50 WeakPolarHBondContact O-CA 3.2Å; I43-T50 HydrophobicContact CB-CG2 3.99Å; I43-T50 HydrophobicContact CD1-CG2 3.98Å; I43-T50 HydrophobicContact CG1-CG2 3.82Å; T50-Y52 HydrophobicContact CG2-CE2 4.5Å; T50-Y52 WeakPolarHBondContact OG1-CE2 3.26Å; T50-L62 HydrophobicContact CG2-CB 4.1Å
51	N	96	Very high	94.7	Very high	79 Å²	79	59.1 Å²	59.1	42%	0.422	34%	0.335	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.7	139.3	171.4	-172.1	-126	0	0	0	109.9	W39 G41 R42	W39-N51 HydrophobicContact CH2-CB 4.36Å; W39-N51 WeakPolarHBondContact CH2-OD1 3.4Å; G41-N51 CarbonylContact C-O 3.47Å; G41-N51 WeakPolarHBondContact CA-O 2.97Å; R42-N51 HydrophobicContact CG-CB 4.15Å; R42-N51 PolarHBondContact N-O 2.87Å; R42-N51 PolarHBondContact O-N 2.82Å
52	Y	96.5	Very high	94.7	Very high	57 Å²	57	59.5 Å²	59.5	22%	0.224	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	147.3	-173.4	-65.8	-90.9	0	0	0	110.7	T50 A60 L62	T50-Y52 HydrophobicContact CG2-CE2 4.5Å; T50-Y52 WeakPolarHBondContact OG1-CE2 3.26Å; Y52-A60 HydrophobicContact CE1-CB 4.37Å; Y52-A60 WeakPolarHBondContact CE1-O 3.28Å; Y52-L62 HydrophobicContact CE1-CD1 4.05Å; Y52-L62 HydrophobicContact CE1-CG 3.71Å; Y52-L62 PolarHBondContact OH-N 2.79Å
53	N	94.9	Very high	94.7	Very high	47 Å²	47	58.1 Å²	58.1	25%	0.251	34%	0.339	S	S	.	.			trans	-70.2	135.1	158.5	-177.8	-24.5	0	0	0	108.9	W39 I40 K55 F56 K57	W39-N53 HydrophobicContact CE3-CB 3.79Å; W39-N53 HydrophobicContact CZ3-CB 4Å; W39-N53 WeakPolarHBondContact O-CB 3.39Å; W39-N53 PolarHBondContact O-ND2 3.21Å; I40-N53 WeakPolarHBondContact O-CB 3.36Å; I40-N53 PolarHBondContact O-N 3.19Å; N53-K55 PolarHBondContact O-N 2.95Å; N53-K55 PolarHBondContact OD1-N 3.01Å; N53-K55 VanDerWaalsContact OD1-N 3.13Å; N53-F56 HydrophobicContact CB-CD2 4.04Å; N53-F56 PolarHBondContact O-N 3.39Å; N53-K57 PolarHBondContact O-N 2.87Å
54	G	93.3	Very high	94.7	Very high	60 Å²	60	59.7 Å²	59.7	62%	0.619	35%	0.353	S	S	*	.	G	3₁₀ helix	trans	-51.7	-33.6	-179.4	0	0	0	0	0	113.8	F56 K57	G54-F56 PolarHBondContact O-N 3.27Å; G54-K57 PolarHBondContact O-N 3.29Å
55	K	90.9	Very high	94.7	Very high	151 Å²	151	59.5 Å²	59.5	66%	0.657	36%	0.355	S	S	*	.	G	3₁₀ helix	trans	-62.6	-27.5	177.2	-68.4	-176.7	178.2	179.2	0	114.4	E38 N53	E38-K55 IonicContact OE2-NZ 3.63Å; N53-K55 PolarHBondContact O-N 2.95Å; N53-K55 PolarHBondContact OD1-N 3.01Å; N53-K55 VanDerWaalsContact OD1-N 3.13Å
56	F	92.7	Very high	94.6	Very high	10 Å²	10	65.1 Å²	65.1	4%	0.044	38%	0.379	C	S	.	.	G	3₁₀ helix	trans	-110.2	-4	-174.5	-62.9	-85.9	0	0	0	112.6	K30 E38 I40 N53 G54 G58 K59 A60	K30-F56 HydrophobicContact CB-CZ 4.42Å; K30-F56 HydrophobicContact CD-CE1 3.93Å; K30-F56 HydrophobicContact CD-CZ 3.98Å; E38-F56 HydrophobicContact CB-CE2 4.39Å; E38-F56 HydrophobicContact CB-CZ 4.35Å; I40-F56 HydrophobicContact CB-CD2 4.27Å; I40-F56 HydrophobicContact CB-CG 4.22Å; I40-F56 HydrophobicContact CG1-CD1 4.15Å; I40-F56 HydrophobicContact CG1-CD2 4.24Å; I40-F56 HydrophobicContact CG1-CE1 4.06Å; I40-F56 HydrophobicContact CG1-CE2 4.13Å; I40-F56 HydrophobicContact CG1-CG 4.24Å; I40-F56 HydrophobicContact CG1-CZ 4.04Å; I40-F56 HydrophobicContact CG2-CB 3.73Å; I40-F56 HydrophobicContact CG2-CD1 4.05Å; I40-F56 HydrophobicContact CG2-CD2 4.31Å; I40-F56 HydrophobicContact CG2-CG 3.78Å; N53-F56 HydrophobicContact CB-CD2 4.04Å; N53-F56 PolarHBondContact O-N 3.39Å; G54-F56 PolarHBondContact O-N 3.27Å; F56-G58 PolarHBondContact O-N 2.99Å; F56-K59 PolarHBondContact O-N 3.24Å; F56-A60 HydrophobicContact CB-CB 4.34Å; F56-A60 PolarHBondContact O-N 2.98Å
57	K	91.4	Very high	94.6	Very high	162 Å²	162	69.1 Å²	69.1	70%	0.704	40%	0.404	S	S	*	.	B	Isolated β-bridge	trans	-61.4	123.8	175.6	-165.8	175.5	-175.3	-179.7	0	109.3	N53 G54 K59	N53-K57 PolarHBondContact O-N 2.87Å; G54-K57 PolarHBondContact O-N 3.29Å; K57-K59 VanDerWaalsContact C-N 3.28Å; K57-K59 PolarHBondContact O-N 3Å
58	G	90.7	Very high	94.6	Very high	71 Å²	71	65.3 Å²	65.3	73%	0.732	39%	0.386	S	S	*	.	T	Hydrogen-bonded Turn	trans	86.8	-16.1	-175.8	0	0	0	0	0	115	F56	F56-G58 PolarHBondContact O-N 2.99Å
59	K	93.2	Very high	94.5	Very high	51 Å²	51	65.3 Å²	65.3	22%	0.222	38%	0.38	C	S	.	.	T	Hydrogen-bonded Turn	trans	-97.3	-37.2	173.9	-170.8	163.9	-168.3	169.9	0	112.8	F56 K57 L75 S76 D82	F56-K59 PolarHBondContact O-N 3.24Å; K57-K59 VanDerWaalsContact C-N 3.28Å; K57-K59 PolarHBondContact O-N 3Å; K59-L75 WeakPolarHBondContact O-CA 3.48Å; K59-S76 PolarHBondContact O-N 2.82Å; K59-S76 PolarHBondContact O-OG 3.2Å; K59-D82 WeakPolarHBondContact CE-OD1 3.41Å; K59-D82 WeakPolarHBondContact CE-OD2 2.98Å; K59-D82 IonicContact NZ-OD1 2.58Å; K59-D82 PolarHBondContact NZ-OD1 2.86Å; K59-D82 IonicContact NZ-OD2 3.9Å; K59-D82 PolarHBondContact NZ-OD2 3.18Å
60	A	95.8	Very high	94.5	Very high	4 Å²	4	61.7 Å²	61.7	3%	0.033	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	136.6	177	0	0	0	0	0	110.6	I40 Y52 F56 M73 Q74 L75	I40-A60 HydrophobicContact CG2-CB 3.72Å; Y52-A60 HydrophobicContact CE1-CB 4.37Å; Y52-A60 WeakPolarHBondContact CE1-O 3.28Å; F56-A60 HydrophobicContact CB-CB 4.34Å; F56-A60 PolarHBondContact O-N 2.98Å; A60-M73 HydrophobicContact CB-CG 4.37Å; A60-M73 HydrophobicContact CB-SD 4.48Å; A60-Q74 CarbonylContact C-O 3.57Å; A60-Q74 WeakPolarHBondContact CA-O 3.17Å; A60-L75 HydrophobicContact CB-CD2 3.94Å
61	T	97.1	Very high	94.4	Very high	70 Å²	70	59.4 Å²	59.4	43%	0.429	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	120.6	168.9	-59.5	0	0	0	0	108.7	T63 M73 Q74	T61-T63 HydrophobicContact CG2-CG2 4.38Å; T61-M73 WeakPolarHBondContact O-CA 3.33Å; T61-Q74 PolarHBondContact N-O 2.84Å; T61-Q74 PolarHBondContact O-N 2.88Å
62	L	97.2	Very high	94.5	Very high	9 Å²	9	58.1 Å²	58.1	5%	0.047	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	132.2	178.9	-52.9	-176.3	0	0	0	110.4	W28 I43 T50 Y52 Y72 M73	W28-L62 VanDerWaalsContact CD1-CD2 3.48Å; W28-L62 HydrophobicContact CG-CD2 4Å; I43-L62 HydrophobicContact CB-CB 4.09Å; I43-L62 HydrophobicContact CB-CD1 4.42Å; I43-L62 HydrophobicContact CD1-CB 4.36Å; I43-L62 HydrophobicContact CG2-CB 4.42Å; T50-L62 HydrophobicContact CG2-CB 4.1Å; Y52-L62 HydrophobicContact CE1-CD1 4.05Å; Y52-L62 HydrophobicContact CE1-CG 3.71Å; Y52-L62 PolarHBondContact OH-N 2.79Å; L62-Y72 WeakPolarHBondContact CA-O 3.3Å; L62-M73 HydrophobicContact CD2-CB 3.73Å; L62-M73 HydrophobicContact CD2-CG 3.63Å; L62-M73 HydrophobicContact CD2-SD 4.33Å
63	T	97	Very high	94.5	Very high	63 Å²	63	55.4 Å²	55.4	39%	0.387	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	163.1	174.6	56.2	0	0	0	0	110.5	T61 A71 Y72	T61-T63 HydrophobicContact CG2-CG2 4.38Å; T63-A71 CarbonylContact O-C 3.35Å; T63-Y72 PolarHBondContact N-O 2.86Å; T63-Y72 PolarHBondContact O-N 3.15Å
64	A	96.4	Very high	94.5	Very high	37 Å²	37	57.2 Å²	57.2	31%	0.306	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.6	139.9	177.5	0	0	0	0	0	111	F21 I43 P45	F21-A64 HydrophobicContact CE1-CB 4.09Å; F21-A64 HydrophobicContact CZ-CB 3.92Å; I43-A64 HydrophobicContact CD1-CB 3.92Å; P45-A64 HydrophobicContact CB-CB 3.78Å; P45-A64 HydrophobicContact CG-CB 4.09Å
65	D	95.3	Very high	94.5	Very high	55 Å²	55	54.4 Å²	54.4	29%	0.294	30%	0.304	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	109.7	169.4	174.4	10.9	0	0	0	108.9	S67 S68 S69 T70 Y72	D65-S67 VanDerWaalsContact C-N 3.31Å; D65-S67 VanDerWaalsContact CG-OG 3.31Å; D65-S67 PolarHBondContact O-N 2.85Å; D65-S67 WeakPolarHBondContact OD1-CB 3.47Å; D65-S67 PolarHBondContact OD1-N 3.33Å; D65-S67 PolarHBondContact OD1-OG 3.17Å; D65-S67 PolarHBondContact OD2-OG 3.06Å; D65-S68 WeakPolarHBondContact CB-OG 3.39Å; D65-S68 VanDerWaalsContact OD2-CB 3.32Å; D65-S68 WeakPolarHBondContact OD2-CB 3.31Å; D65-S68 PolarHBondContact OD2-OG 2.77Å; D65-S69 WeakPolarHBondContact O-CA 3.39Å; D65-S69 PolarHBondContact O-N 2.88Å; D65-S69 VanDerWaalsContact O-N 3.09Å; D65-T70 PolarHBondContact N-O 2.94Å; D65-T70 PolarHBondContact O-N 2.84Å; D65-Y72 HydrophobicContact CB-CE2 4Å
66	K	93.3	Very high	94.6	Very high	122 Å²	122	48.8 Å²	48.8	53%	0.53	28%	0.283	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.8	-33.8	179.6	-72.9	-178.9	-91.3	-164.2	0	112.2	P45 G46 S69	P45-K66 VanDerWaalsContact O-CD 3.25Å; P45-K66 WeakPolarHBondContact O-CD 3.22Å; P45-K66 WeakPolarHBondContact O-CG 3.25Å; G46-K66 PolarHBondContact O-NZ 2.82Å; K66-S69 PolarHBondContact O-N 2.82Å
67	S	92.3	Very high	94.6	Very high	110 Å²	110	52 Å²	52	77%	0.769	31%	0.308	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.7	-40.1	-175.7	71.8	0	0	0	0	111.7	D65	D65-S67 VanDerWaalsContact C-N 3.31Å; D65-S67 VanDerWaalsContact CG-OG 3.31Å; D65-S67 PolarHBondContact O-N 2.85Å; D65-S67 WeakPolarHBondContact OD1-CB 3.47Å; D65-S67 PolarHBondContact OD1-N 3.33Å; D65-S67 PolarHBondContact OD1-OG 3.17Å; D65-S67 PolarHBondContact OD2-OG 3.06Å
68	S	94.2	Very high	94.5	Very high	38 Å²	38	44.4 Å²	44.4	27%	0.266	28%	0.275	S	S	.	.	T	Hydrogen-bonded Turn	trans	-94.2	0.5	177.7	65.4	0	0	0	0	113.7	D65 T70	D65-S68 WeakPolarHBondContact CB-OG 3.39Å; D65-S68 VanDerWaalsContact OD2-CB 3.32Å; D65-S68 WeakPolarHBondContact OD2-CB 3.31Å; D65-S68 PolarHBondContact OD2-OG 2.77Å; S68-T70 PolarHBondContact O-N 2.82Å; S68-T70 PolarHBondContact O-OG1 2.85Å; S68-T70 WeakPolarHBondContact OG-CB 3.11Å; S68-T70 PolarHBondContact OG-OG1 3.06Å
69	S	94.3	Very high	94.5	Very high	41 Å²	41	43.8 Å²	43.8	29%	0.287	26%	0.257	S	S	.	.	T	Hydrogen-bonded Turn	trans	50.2	40.3	-172.4	-63.1	0	0	0	0	112.9	A16 D65 K66	A16-S69 PolarHBondContact N-O 2.92Å; D65-S69 WeakPolarHBondContact O-CA 3.39Å; D65-S69 PolarHBondContact O-N 2.88Å; D65-S69 VanDerWaalsContact O-N 3.09Å; K66-S69 PolarHBondContact O-N 2.82Å
70	T	95.3	Very high	94.1	Very high	11 Å²	11	45.1 Å²	45.1	7%	0.067	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	125.7	-173.9	-56.1	0	0	0	0	110.8	C14 D65 S68 Y72	C14-T70 WeakPolarHBondContact O-CA 3.33Å; D65-T70 PolarHBondContact N-O 2.94Å; D65-T70 PolarHBondContact O-N 2.84Å; S68-T70 PolarHBondContact O-N 2.82Å; S68-T70 PolarHBondContact O-OG1 2.85Å; S68-T70 WeakPolarHBondContact OG-CB 3.11Å; S68-T70 PolarHBondContact OG-OG1 3.06Å; T70-Y72 HydrophobicContact CG2-CD1 4.21Å; T70-Y72 HydrophobicContact CG2-CD2 4.49Å; T70-Y72 HydrophobicContact CG2-CE1 3.58Å; T70-Y72 HydrophobicContact CG2-CE2 3.88Å; T70-Y72 WeakPolarHBondContact CG2-OH 3.45Å
71	A	95.8	Very high	93.6	Very high	0 Å²	0	51 Å²	51	0%	0	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.9	150.7	167.8	0	0	0	0	0	110	S13 C14 F21 M26 W28 I43 T63	S13-A71 CarbonylContact C-O 3.53Å; S13-A71 WeakPolarHBondContact CA-O 3.44Å; C14-A71 PolarHBondContact N-O 2.85Å; C14-A71 PolarHBondContact O-N 3.08Å; F21-A71 HydrophobicContact CE2-CB 4.07Å; F21-A71 HydrophobicContact CZ-CB 3.95Å; M26-A71 HydrophobicContact CB-CB 4.2Å; M26-A71 HydrophobicContact CE-CB 4.37Å; M26-A71 HydrophobicContact CG-CB 3.73Å; W28-A71 HydrophobicContact CZ2-CB 4.16Å; I43-A71 HydrophobicContact CG2-CB 4.48Å; T63-A71 CarbonylContact O-C 3.35Å
72	Y	96.1	Very high	93.2	Very high	51 Å²	51	47.9 Å²	47.9	20%	0.2	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	143.8	176.9	-53.8	-85.9	0	0	0	111	K11 I12 L62 T63 D65 T70	K11-Y72 HydrophobicContact CD-CD1 4.33Å; K11-Y72 HydrophobicContact CG-CD1 4.31Å; I12-Y72 CarbonylContact O-C 3.54Å; I12-Y72 WeakPolarHBondContact O-CA 3.4Å; L62-Y72 WeakPolarHBondContact CA-O 3.3Å; T63-Y72 PolarHBondContact N-O 2.86Å; T63-Y72 PolarHBondContact O-N 3.15Å; D65-Y72 HydrophobicContact CB-CE2 4Å; T70-Y72 HydrophobicContact CG2-CD1 4.21Å; T70-Y72 HydrophobicContact CG2-CD2 4.49Å; T70-Y72 HydrophobicContact CG2-CE1 3.58Å; T70-Y72 HydrophobicContact CG2-CE2 3.88Å; T70-Y72 WeakPolarHBondContact CG2-OH 3.45Å
73	M	96.6	Very high	92.8	Very high	0 Å²	0	49.3 Å²	49.3	0%	0	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	119.9	166.6	177.9	-177.5	67.8	0	0	108.4	I12 W28 I40 A60 T61 L62 L75 Y86	I12-M73 HydrophobicContact CD1-CE 3.55Å; I12-M73 PolarHBondContact N-O 2.97Å; I12-M73 PolarHBondContact O-N 2.85Å; W28-M73 HydrophobicContact CB-SD 3.95Å; W28-M73 HydrophobicContact CD2-CB 3.64Å; W28-M73 HydrophobicContact CD2-CG 4.43Å; W28-M73 HydrophobicContact CD2-SD 4.13Å; W28-M73 HydrophobicContact CE3-CB 3.83Å; W28-M73 HydrophobicContact CE3-CE 3.9Å; W28-M73 HydrophobicContact CE3-SD 4.1Å; W28-M73 HydrophobicContact CG-CB 4.18Å; W28-M73 HydrophobicContact CG-SD 4.1Å; W28-M73 HydrophobicContact CH2-CB 4.04Å; W28-M73 HydrophobicContact CZ2-CB 3.87Å; W28-M73 HydrophobicContact CZ3-CB 4.03Å; W28-M73 HydrophobicContact CZ3-CE 4.34Å; I40-M73 HydrophobicContact CD1-CE 4.04Å; I40-M73 HydrophobicContact CD1-SD 3.55Å; I40-M73 VanDerWaalsContact CD1-SD 3.55Å; I40-M73 HydrophobicContact CG2-SD 3.97Å; A60-M73 HydrophobicContact CB-CG 4.37Å; A60-M73 HydrophobicContact CB-SD 4.48Å; T61-M73 WeakPolarHBondContact O-CA 3.33Å; L62-M73 HydrophobicContact CD2-CB 3.73Å; L62-M73 HydrophobicContact CD2-CG 3.63Å; L62-M73 HydrophobicContact CD2-SD 4.33Å; M73-L75 HydrophobicContact CE-CD1 3.87Å; M73-L75 HydrophobicContact CE-CD2 4.24Å; M73-L75 HydrophobicContact CE-CG 3.95Å; M73-L75 HydrophobicContact CG-CD2 4.4Å; M73-L75 HydrophobicContact CG-CG 4.4Å; M73-L75 HydrophobicContact SD-CD2 4.1Å; M73-L75 HydrophobicContact SD-CG 4.36Å; M73-Y86 HydrophobicContact CE-CD1 3.52Å; M73-Y86 HydrophobicContact CE-CE1 4.17Å; M73-Y86 HydrophobicContact CE-CG 4.03Å
74	Q	95.7	Very high	92.5	Very high	86 Å²	86	46.4 Å²	46.4	40%	0.402	27%	0.273	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	124.2	169.3	-176.4	173.4	-6.1	0	0	108.9	V10 A60 T61	V10-Q74 CarbonylContact O-C 3.54Å; V10-Q74 VanDerWaalsContact O-CA 3.31Å; V10-Q74 WeakPolarHBondContact O-CA 3.4Å; A60-Q74 CarbonylContact C-O 3.57Å; A60-Q74 WeakPolarHBondContact CA-O 3.17Å; T61-Q74 PolarHBondContact N-O 2.84Å; T61-Q74 PolarHBondContact O-N 2.88Å
75	L	94.1	Very high	92.3	Very high	0 Å²	0	46.3 Å²	46.3	0%	0	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	125.6	170.8	-65.4	169.1	0	0	0	108.2	S9 V10 I12 K59 A60 M73 L78 Y86	S9-L75 CarbonylContact C-O 3.59Å; S9-L75 WeakPolarHBondContact CA-O 3.36Å; S9-L75 WeakPolarHBondContact CB-O 3.11Å; V10-L75 HydrophobicContact CG1-CB 4.08Å; V10-L75 HydrophobicContact CG1-CD1 4.27Å; V10-L75 PolarHBondContact N-O 3.17Å; V10-L75 PolarHBondContact O-N 3.35Å; I12-L75 HydrophobicContact CD1-CD1 4.2Å; K59-L75 WeakPolarHBondContact O-CA 3.48Å; A60-L75 HydrophobicContact CB-CD2 3.94Å; M73-L75 HydrophobicContact CE-CD1 3.87Å; M73-L75 HydrophobicContact CE-CD2 4.24Å; M73-L75 HydrophobicContact CE-CG 3.95Å; M73-L75 HydrophobicContact CG-CD2 4.4Å; M73-L75 HydrophobicContact CG-CG 4.4Å; M73-L75 HydrophobicContact SD-CD2 4.1Å; M73-L75 HydrophobicContact SD-CG 4.36Å; L75-L78 HydrophobicContact CB-CD2 3.76Å; L75-L78 HydrophobicContact CD1-CD2 4.25Å; L75-Y86 HydrophobicContact CD1-CD1 4.15Å; L75-Y86 HydrophobicContact CD1-CE1 3.53Å; L75-Y86 HydrophobicContact CD1-CE2 4.13Å
76	S	93.1	Very high	92.2	Very high	33 Å²	33	43.8 Å²	43.8	23%	0.231	26%	0.255	C	S	.	.	P	Polyproline II helix	trans	-100.7	158	177.4	55.8	0	0	0	0	111.9	S9 K59 L78	S9-S76 WeakPolarHBondContact OG-CA 3.31Å; K59-S76 PolarHBondContact O-N 2.82Å; K59-S76 PolarHBondContact O-OG 3.2Å; S76-L78 VanDerWaalsContact C-N 3.34Å; S76-L78 PolarHBondContact O-N 2.02Å
77	S	91.6	Very high	92.2	Very high	79 Å²	79	39.4 Å²	39.4	55%	0.552	24%	0.236	S	C	*	.	S	Bend	trans	50.4	52.4	172.7	-57.3	0	0	0	0	112.7	A8	A8-S77 PolarHBondContact O-N 3.29Å
78	L	90.2	Very high	92.2	Very high	2 Å²	2	34.8 Å²	34.8	1%	0.01	20%	0.203	C	C	.	.			trans	-59.6	138.9	-175.2	-71.7	173.4	0	0	0	112.1	V4 P6 G7 A8 V10 L75 S76 D82 V105	V4-L78 HydrophobicContact CB-CD1 4Å; V4-L78 HydrophobicContact CG1-CD1 3.87Å; V4-L78 HydrophobicContact CG2-CD1 4.16Å; P6-L78 WeakPolarHBondContact CA-O 3.47Å; G7-L78 PolarHBondContact N-O 2.86Å; A8-L78 WeakPolarHBondContact O-CB 3.42Å; A8-L78 WeakPolarHBondContact O-CG 3.27Å; A8-L78 PolarHBondContact O-N 3.42Å; V10-L78 HydrophobicContact CB-CD1 3.93Å; V10-L78 HydrophobicContact CG1-CD1 3.76Å; V10-L78 HydrophobicContact CG1-CD2 4.26Å; V10-L78 HydrophobicContact CG1-CG 4.5Å; L75-L78 HydrophobicContact CB-CD2 3.76Å; L75-L78 HydrophobicContact CD1-CD2 4.25Å; S76-L78 VanDerWaalsContact C-N 3.34Å; S76-L78 PolarHBondContact O-N 2.02Å; L78-D82 WeakPolarHBondContact CA-OD2 3.44Å; L78-D82 HydrophobicContact CD2-CB 3.67Å; L78-V105 HydrophobicContact CB-CG2 3.96Å; L78-V105 HydrophobicContact CD1-CG2 4.24Å
79	T	90.1	Very high	92.1	Very high	58 Å²	58	33 Å²	33	36%	0.356	19%	0.191	S	C	.	.			trans	-121.7	170.6	173.3	67.5	0	0	0	0	110.3	E81 D82	T79-E81 PolarHBondContact O-N 2.79Å; T79-E81 VanDerWaalsContact O-N 3.11Å; T79-D82 PolarHBondContact N-OD2 3.12Å; T79-D82 WeakPolarHBondContact O-CB 3.21Å; T79-D82 PolarHBondContact O-N 2.78Å; T79-D82 PolarHBondContact OG1-OD2 3.06Å
80	S	85	Confident	91.6	Very high	78 Å²	78	33.7 Å²	33.7	55%	0.545	19%	0.187	S	C	.	.	G	3₁₀ helix	trans	-54.5	-30.9	175.5	54.2	0	0	0	0	112.5	D82 S83	S80-D82 PolarHBondContact O-N 2.88Å; S80-S83 WeakPolarHBondContact O-CB 3.36Å; S80-S83 PolarHBondContact O-N 3.46Å; S80-S83 VanDerWaalsContact O-N 3.15Å; S80-S83 PolarHBondContact O-OG 3.16Å
81	E	85.1	Confident	90.7	Very high	129 Å²	129	37.9 Å²	37.9	60%	0.603	21%	0.206	S	C	*	.	G	3₁₀ helix	trans	-66.3	-14.8	176.1	-67.5	-166.9	-172.9	0	0	115	K30 R32 T79	K30-E81 WeakPolarHBondContact CE-O 3.34Å; K30-E81 PolarHBondContact NZ-O 3.21Å; R32-E81 PolarHBondContact NE-O 3.13Å; R32-E81 VanDerWaalsContact NE-O 3.08Å; R32-E81 PolarHBondContact NH2-O 3.06Å; R32-E81 IonicContact NH2-OE2 2.85Å; R32-E81 PolarHBondContact NH2-OE2 3.18Å; T79-E81 PolarHBondContact O-N 2.79Å; T79-E81 VanDerWaalsContact O-N 3.11Å
82	D	88.4	Confident	89.6	Confident	4 Å²	4	41.1 Å²	41.1	2%	0.021	22%	0.223	C	C	.	.	G	3₁₀ helix	trans	-89.3	-5.6	176.3	-58.4	-47.1	0	0	0	113.7	K30 K59 L78 T79 S80 A84 Y86	K30-D82 IonicContact NZ-OD1 2.98Å; K30-D82 PolarHBondContact NZ-OD1 2.85Å; K30-D82 VanDerWaalsContact NZ-OD1 3.14Å; K59-D82 WeakPolarHBondContact CE-OD1 3.41Å; K59-D82 WeakPolarHBondContact CE-OD2 2.98Å; K59-D82 IonicContact NZ-OD1 2.58Å; K59-D82 PolarHBondContact NZ-OD1 2.86Å; K59-D82 IonicContact NZ-OD2 3.9Å; K59-D82 PolarHBondContact NZ-OD2 3.18Å; L78-D82 WeakPolarHBondContact CA-OD2 3.44Å; L78-D82 HydrophobicContact CD2-CB 3.67Å; T79-D82 PolarHBondContact N-OD2 3.12Å; T79-D82 WeakPolarHBondContact O-CB 3.21Å; T79-D82 PolarHBondContact O-N 2.78Å; T79-D82 PolarHBondContact OG1-OD2 3.06Å; S80-D82 PolarHBondContact O-N 2.88Å; D82-A84 PolarHBondContact O-N 3.37Å; D82-Y86 WeakPolarHBondContact CA-OH 3Å; D82-Y86 VanDerWaalsContact O-CE2 3.28Å; D82-Y86 WeakPolarHBondContact O-CE2 3.37Å; D82-Y86 PolarHBondContact O-OH 2.9Å
83	S	89.4	Confident	87.8	Confident	38 Å²	38	44 Å²	44	27%	0.266	25%	0.248	S	C	.	.			trans	-66.6	100.5	169.1	-59	0	0	0	0	109.4	S80 V105	S80-S83 WeakPolarHBondContact O-CB 3.36Å; S80-S83 PolarHBondContact O-N 3.46Å; S80-S83 VanDerWaalsContact O-N 3.15Å; S80-S83 PolarHBondContact O-OG 3.16Å; S83-V105 PolarHBondContact OG-N 3.21Å
84	A	90.8	Very high	86.2	Confident	3 Å²	3	55.7 Å²	55.7	3%	0.025	29%	0.292	C	S	.	.	S	Bend	trans	-161.1	167.5	-171.9	0	0	0	0	0	109.5	K30 Q31 R32 D82 Y86 P103	K30-A84 HydrophobicContact CD-CB 4.16Å; K30-A84 HydrophobicContact CG-CB 3.56Å; Q31-A84 WeakPolarHBondContact O-CB 3.28Å; R32-A84 HydrophobicContact CG-CB 4Å; D82-A84 PolarHBondContact O-N 3.37Å; A84-Y86 HydrophobicContact CB-CE2 3.95Å; A84-Y86 WeakPolarHBondContact O-CD2 3.04Å; A84-Y86 WeakPolarHBondContact O-CE2 3.42Å; A84-P103 WeakPolarHBondContact O-CD 3.48Å
85	V	91.7	Very high	85	Confident	35 Å²	35	52.4 Å²	52.4	21%	0.212	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.6	130.3	167.8	-166.6	0	0	0	0	108.4	K30 Q31 F87 T102	K30-V85 CarbonylContact C-O 3.57Å; Q31-V85 HydrophobicContact CB-CB 4.48Å; Q31-V85 PolarHBondContact N-O 2.91Å; Q31-V85 PolarHBondContact O-N 3.11Å; V85-F87 HydrophobicContact CB-CE2 3.74Å; V85-F87 HydrophobicContact CB-CZ 3.93Å; V85-F87 HydrophobicContact CG1-CD2 4.25Å; V85-F87 HydrophobicContact CG1-CE1 3.86Å; V85-F87 HydrophobicContact CG1-CE2 3.52Å; V85-F87 HydrophobicContact CG1-CZ 3.3Å; V85-T102 HydrophobicContact CG2-CG2 4.28Å
86	Y	93.4	Very high	84.3	Confident	2 Å²	2	60.1 Å²	60.1	1%	0.008	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	126.8	178.1	-66.1	-92.4	0	0	0	109.8	I12 V29 K30 I40 M73 L75 D82 A84 G100 T101 P103	I12-Y86 HydrophobicContact CD1-CD1 4.42Å; I12-Y86 HydrophobicContact CD1-CD2 3.94Å; I12-Y86 HydrophobicContact CD1-CG 3.79Å; V29-Y86 CarbonylContact O-C 3.59Å; V29-Y86 WeakPolarHBondContact O-CA 3.4Å; K30-Y86 HydrophobicContact CB-CD1 4.1Å; K30-Y86 HydrophobicContact CB-CE1 3.87Å; K30-Y86 HydrophobicContact CD-CE1 3.85Å; K30-Y86 WeakPolarHBondContact CE-OH 3.49Å; K30-Y86 HydrophobicContact CG-CD1 4.27Å; K30-Y86 HydrophobicContact CG-CE1 3.71Å; I40-Y86 HydrophobicContact CD1-CD1 3.64Å; I40-Y86 HydrophobicContact CD1-CE1 3.84Å; M73-Y86 HydrophobicContact CE-CD1 3.52Å; M73-Y86 HydrophobicContact CE-CE1 4.17Å; M73-Y86 HydrophobicContact CE-CG 4.03Å; L75-Y86 HydrophobicContact CD1-CD1 4.15Å; L75-Y86 HydrophobicContact CD1-CE1 3.53Å; L75-Y86 HydrophobicContact CD1-CE2 4.13Å; D82-Y86 WeakPolarHBondContact CA-OH 3Å; D82-Y86 VanDerWaalsContact O-CE2 3.28Å; D82-Y86 WeakPolarHBondContact O-CE2 3.37Å; D82-Y86 PolarHBondContact O-OH 2.9Å; A84-Y86 HydrophobicContact CB-CE2 3.95Å; A84-Y86 WeakPolarHBondContact O-CD2 3.04Å; A84-Y86 WeakPolarHBondContact O-CE2 3.42Å; Y86-G100 CarbonylContact O-C 3.59Å; Y86-G100 WeakPolarHBondContact O-CA 3.03Å; Y86-T101 PolarHBondContact N-O 3.27Å; Y86-T101 PolarHBondContact O-N 3.33Å; Y86-P103 HydrophobicContact CD2-CG 3.62Å; Y86-P103 HydrophobicContact CE2-CG 3.5Å
87	F	92.6	Very high	83.9	Confident	30 Å²	30	63.1 Å²	63.1	13%	0.132	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	149.1	-179.8	-58.8	-85.8	0	0	0	110.6	W28 V29 Q31 V85 W97 G100	W28-F87 CarbonylContact C-O 3.5Å; W28-F87 WeakPolarHBondContact CA-O 3.07Å; V29-F87 PolarHBondContact N-O 2.79Å; V29-F87 PolarHBondContact O-N 3Å; Q31-F87 HydrophobicContact CB-CD2 4.31Å; Q31-F87 HydrophobicContact CB-CE2 3.74Å; V85-F87 HydrophobicContact CB-CE2 3.74Å; V85-F87 HydrophobicContact CB-CZ 3.93Å; V85-F87 HydrophobicContact CG1-CD2 4.25Å; V85-F87 HydrophobicContact CG1-CE1 3.86Å; V85-F87 HydrophobicContact CG1-CE2 3.52Å; V85-F87 HydrophobicContact CG1-CZ 3.3Å; F87-W97 HydrophobicContact CB-CE3 3.74Å; F87-W97 HydrophobicContact CB-CZ3 3.89Å; F87-W97 HydrophobicContact CG-CE3 4.25Å; F87-W97 HydrophobicContact CG-CZ3 4.43Å; F87-G100 VanDerWaalsContact CD1-CA 3.41Å
88	C	93	Very high	83.3	Confident	13 Å²	13	60.7 Å²	60.7	9%	0.088	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	148.7	161.1	60.1	0	0	0	0	110.1	C14 M26 N27 W28 G98	C14-C88 HydrophobicContact CB-CB 3.45Å; C14-C88 VanDerWaalsContact CB-CB 3.45Å; C14-C88 WeakPolarHBondContact CB-SG 3.26Å; C14-C88 WeakPolarHBondContact SG-CB 3.36Å; C14-C88 CovalentContact SG-SG 2.02Å; C14-C88 PolarHBondContact SG-SG 2.83Å; M26-C88 HydrophobicContact CG-CB 4.37Å; M26-C88 HydrophobicContact SD-CB 3.76Å; N27-C88 CarbonylContact O-C 3.5Å; N27-C88 WeakPolarHBondContact O-CA 3.22Å; W28-C88 HydrophobicContact CD2-CB 4.47Å; W28-C88 HydrophobicContact CE3-CB 4.26Å; W28-C88 HydrophobicContact CH2-CB 4.4Å; W28-C88 HydrophobicContact CZ3-CB 4.22Å; C88-G98 PolarHBondContact O-N 2.93Å
89	A	91.3	Very high	82.8	Confident	1 Å²	1	70.1 Å²	70.1	1%	0.008	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.2	138.8	178.1	0	0	0	0	0	112.3	N27 L92 Y96 W97	N27-A89 WeakPolarHBondContact CA-O 3.24Å; N27-A89 HydrophobicContact CB-CB 4.47Å; N27-A89 VanDerWaalsContact CB-O 3.28Å; N27-A89 WeakPolarHBondContact CB-O 3.22Å; N27-A89 PolarHBondContact N-O 3.04Å; N27-A89 PolarHBondContact ND2-O 3.24Å; N27-A89 PolarHBondContact O-N 3.3Å; A89-L92 HydrophobicContact CB-CD2 3.75Å; A89-L92 HydrophobicContact CB-CG 4.39Å; A89-Y96 CarbonylContact C-O 3.55Å; A89-Y96 VanDerWaalsContact CA-O 3.24Å; A89-Y96 WeakPolarHBondContact CA-O 3.49Å; A89-W97 HydrophobicContact CB-CD2 3.81Å; A89-W97 HydrophobicContact CB-CE3 3.8Å; A89-W97 HydrophobicContact CB-CG 4.29Å; A89-W97 HydrophobicContact CB-CZ3 4.16Å
90	R	85	Confident	82	Confident	55 Å²	55	68.7 Å²	68.7	21%	0.208	35%	0.346	C	S	.	.	S	Bend	trans	-72.9	-47.8	176.7	-169	-177.1	85.6	-168.3	7.8	111.8	Y19 W25 N27 Y96	Y19-R90 HydrophobicContact CE2-CG 4.08Å; W25-R90 VanDerWaalsContact O-O 3.11Å; N27-R90 PolarHBondContact ND2-O 3.11Å; N27-R90 VanDerWaalsContact ND2-O 3.17Å; R90-Y96 PolarHBondContact N-O 3.49Å
91	E	76.5	Confident	81.8	Confident	98 Å²	98	67.8 Å²	67.8	46%	0.458	34%	0.337	S	S	.	.	S	Bend	trans	-131.8	132.4	-175.7	-77.1	161.8	-141	0	0	109	G95	E91-G95 WeakPolarHBondContact O-CA 3.47Å; E91-G95 PolarHBondContact O-N 2.81Å
92	L	71.5	Confident	81.6	Confident	68 Å²	68	64.5 Å²	64.5	36%	0.356	33%	0.326	S	S	.	.	T	Hydrogen-bonded Turn	trans	-110.4	146.5	175.1	-67.3	177.7	0	0	0	109.5	N27 V29 W39 A89 W97	N27-L92 HydrophobicContact CB-CD1 3.79Å; N27-L92 HydrophobicContact CB-CG 4.17Å; V29-L92 HydrophobicContact CG2-CD1 4.1Å; V29-L92 HydrophobicContact CG2-CD2 4.34Å; W39-L92 VanDerWaalsContact CD1-CD1 3.46Å; A89-L92 HydrophobicContact CB-CD2 3.75Å; A89-L92 HydrophobicContact CB-CG 4.39Å; L92-W97 HydrophobicContact CD2-CH2 3.29Å; L92-W97 HydrophobicContact CD2-CZ2 3.15Å; L92-W97 HydrophobicContact CD2-CZ3 4.14Å
93	P	57.8	Low	80.8	Confident	112 Å²	112	64.3 Å²	64.3	73%	0.727	33%	0.325	S	S	*	.	T	Hydrogen-bonded Turn	cis	-94.5	-14.8	2.8	33.8	-32.3	0	0	0	115.1
94	R	63.8	Low	79.9	Confident	246 Å²	246	64.9 Å²	64.9	93%	0.928	33%	0.327	S	S	*	.	T	Hydrogen-bonded Turn	trans	-107.6	13.8	-173.7	-72.1	-173.6	175.2	141.3	-1.5	114.8
95	G	71	Confident	78.4	Confident	17 Å²	17	65.2 Å²	65.2	18%	0.175	33%	0.329	C	S	.	.	S	Bend	trans	-82.9	-163.1	-177.1	0	0	0	0	0	114.3	E91	E91-G95 WeakPolarHBondContact O-CA 3.47Å; E91-G95 PolarHBondContact O-N 2.81Å
96	Y	79.7	Confident	76.6	Confident	161 Å²	161	65.7 Å²	65.7	63%	0.631	33%	0.334	S	S	*	.			trans	-76.5	123.4	-179.2	-61.6	-85.7	0	0	0	111.6	A89 R90	A89-Y96 CarbonylContact C-O 3.55Å; A89-Y96 VanDerWaalsContact CA-O 3.24Å; A89-Y96 WeakPolarHBondContact CA-O 3.49Å; R90-Y96 PolarHBondContact N-O 3.49Å
97	W	83.4	Confident	74.5	Confident	97 Å²	97	73.4 Å²	73.4	37%	0.367	39%	0.388	S	S	.	.	B	Isolated β-bridge	trans	-108.2	142.6	178.3	-66.8	83	0	0	0	111.3	V29 L37 F87 A89 L92	V29-W97 HydrophobicContact CB-CH2 4.33Å; V29-W97 HydrophobicContact CB-CZ3 3.93Å; V29-W97 HydrophobicContact CG1-CH2 4.27Å; V29-W97 HydrophobicContact CG1-CZ3 4.19Å; V29-W97 HydrophobicContact CG2-CH2 3.93Å; V29-W97 HydrophobicContact CG2-CZ3 3.82Å; L37-W97 HydrophobicContact CD1-CH2 3.86Å; L37-W97 HydrophobicContact CD1-CZ2 4.33Å; F87-W97 HydrophobicContact CB-CE3 3.74Å; F87-W97 HydrophobicContact CB-CZ3 3.89Å; F87-W97 HydrophobicContact CG-CE3 4.25Å; F87-W97 HydrophobicContact CG-CZ3 4.43Å; A89-W97 HydrophobicContact CB-CD2 3.81Å; A89-W97 HydrophobicContact CB-CE3 3.8Å; A89-W97 HydrophobicContact CB-CG 4.29Å; A89-W97 HydrophobicContact CB-CZ3 4.16Å; L92-W97 HydrophobicContact CD2-CH2 3.29Å; L92-W97 HydrophobicContact CD2-CZ2 3.15Å; L92-W97 HydrophobicContact CD2-CZ3 4.14Å
98	G	80.4	Confident	73.6	Confident	28 Å²	28	75.6 Å²	75.6	29%	0.289	40%	0.401	S	S	.	.			trans	-73.6	165.2	166	0	0	0	0	0	111.8	C88 G100	C88-G98 PolarHBondContact O-N 2.93Å; G98-G100 PolarHBondContact O-N 3.09Å; G98-G100 VanDerWaalsContact O-N 3.15Å
99	Q	78.7	Confident	72.6	Confident	200 Å²	200	78.8 Å²	78.8	94%	0.935	42%	0.417	S	S	*	.			trans	-66	-16.5	-178.4	-64.7	-142.6	-23.8	0	0	114.5
100	G	74.2	Confident	71.6	Confident	28 Å²	28	83.2 Å²	83.2	29%	0.289	44%	0.44	S	S	.	.			trans	82.9	152.1	179.3	0	0	0	0	0	113.5	Y86 F87 G98	Y86-G100 CarbonylContact O-C 3.59Å; Y86-G100 WeakPolarHBondContact O-CA 3.03Å; F87-G100 VanDerWaalsContact CD1-CA 3.41Å; G98-G100 PolarHBondContact O-N 3.09Å; G98-G100 VanDerWaalsContact O-N 3.15Å
101	T	79.9	Confident	70.8	Confident	58 Å²	58	84.8 Å²	84.8	36%	0.356	45%	0.453	S	S	.	.	B	Isolated β-bridge	trans	-126.8	134.6	179.6	-58.6	0	0	0	0	109.4	Y86 P103	Y86-T101 PolarHBondContact N-O 3.27Å; Y86-T101 PolarHBondContact O-N 3.33Å; T101-P103 VanDerWaalsContact O-CD 3.25Å; T101-P103 WeakPolarHBondContact O-CD 3.44Å
102	T	81.6	Confident	70.4	Confident	60 Å²	60	84 Å²	84	37%	0.368	45%	0.453	S	S	.	.			trans	-112.3	93.8	-178.9	-48.2	0	0	0	0	110.8	P1 E2 V85	P1-T102 VanDerWaalsContact CA-O 3.26Å; P1-T102 WeakPolarHBondContact CA-O 3.47Å; E2-T102 PolarHBondContact N-O 2.65Å; V85-T102 HydrophobicContact CG2-CG2 4.28Å
103	P	70.9	Confident	70.4	Confident	1 Å²	1	85.1 Å²	85.1	1%	0.006	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.4	138.3	162.9	32	-34.2	0	0	0	110.3	V4 I12 A84 Y86 T101	V4-P103 HydrophobicContact CG2-CB 4.04Å; I12-P103 HydrophobicContact CD1-CG 4.48Å; A84-P103 WeakPolarHBondContact O-CD 3.48Å; Y86-P103 HydrophobicContact CD2-CG 3.62Å; Y86-P103 HydrophobicContact CE2-CG 3.5Å; T101-P103 VanDerWaalsContact O-CD 3.25Å; T101-P103 WeakPolarHBondContact O-CD 3.44Å
104	T	70.6	Confident	71.3	Confident	50 Å²	50	83.1 Å²	83.1	31%	0.307	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	119.7	176.1	-57.4	0	0	0	0	108.7	E2 L3 V4	E2-T104 PolarHBondContact O-N 3.23Å; L3-T104 CarbonylContact C-O 3.6Å; L3-T104 WeakPolarHBondContact CA-O 3.42Å; L3-T104 HydrophobicContact CD1-CG2 4.46Å; V4-T104 PolarHBondContact N-O 2.9Å
105	V	58.8	Low	71.8	Confident	9 Å²	9	70.6 Å²	70.6	6%	0.055	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.7	108.4	178	-172.6	0	0	0	0	108.6	V4 P6 L78 S83	V4-V105 WeakPolarHBondContact O-CA 3.25Å; P6-V105 HydrophobicContact CB-CG1 4.4Å; P6-V105 HydrophobicContact CG-CG1 4.17Å; L78-V105 HydrophobicContact CB-CG2 3.96Å; L78-V105 HydrophobicContact CD1-CG2 4.24Å; S83-V105 PolarHBondContact OG-N 3.21Å
106	S	53.9	Low	71.9	Confident	45 Å²	45	75.1 Å²	75.1	32%	0.315	42%	0.422	S	S	.	.			trans	-81	137.7	177	57.8	0	0	0	0	110.2	V4 P6	V4-S106 PolarHBondContact O-N 2.62Å; P6-S106 WeakPolarHBondContact CD-O 3.32Å; P6-S106 WeakPolarHBondContact CG-O 3.39Å
107	S	50.7	Low	71.2	Confident	164 Å²	164	67.3 Å²	67.3	100%	1.147	40%	0.403	S	S	*	.			trans	-69.4	0	174.4	-53.4	0	0	0	0	112.3

Retrieved 107 of 107 residues in 21.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).