X5LQ30_CAEEL Loading...

Guanine nucleotide-binding protein subunit alpha

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

AlphaFold DB , UniProt , Accession X5LQ30, Species CAEEL (Caenorhabditis elegans), Gene egl-30, Length 112 aa.

						>X5LQ30_CAEEL|X5LQ30|egl-30
MEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	87.8	Confident	94	Very high	96 Å²	96	88.4 Å²	88.4	47%	0.473	45%	0.451	S	S	.	.				0	-55.1	0	-85.8	-67.9	-173.6	0	0	110.5	E3 S4 K5 F45 I62 M65 F66	M1-E3 PolarHBondContact O-N 2.98Å; M1-S4 WeakPolarHBondContact O-CB 3.45Å; M1-S4 PolarHBondContact O-N 3.25Å; M1-S4 VanDerWaalsContact O-N 3.13Å; M1-K5 PolarHBondContact O-N 3.32Å; M1-F45 HydrophobicContact CB-CE1 4.22Å; M1-F45 HydrophobicContact CB-CZ 3.65Å; M1-F45 HydrophobicContact CG-CE2 4.48Å; M1-F45 HydrophobicContact CG-CZ 3.77Å; M1-I62 HydrophobicContact CE-CB 4.41Å; M1-I62 HydrophobicContact CE-CD1 3.77Å; M1-I62 HydrophobicContact CE-CG1 3.93Å; M1-I62 HydrophobicContact CE-CG2 3.56Å; M1-I62 HydrophobicContact SD-CG2 4.44Å; M1-M65 HydrophobicContact SD-CE 4.41Å; M1-F66 HydrophobicContact SD-CE2 4.01Å; M1-F66 HydrophobicContact SD-CZ 4.36Å
2	E	90.3	Very high	93.9	Very high	110 Å²	110	81.5 Å²	81.5	51%	0.514	42%	0.416	S	S	.	.	H	α-helix	trans	-57.2	-45	178.6	-66.9	-50.5	124.5	0	0	114.2	S4 K5 A6	E2-S4 VanDerWaalsContact C-N 3.33Å; E2-S4 PolarHBondContact O-N 3.34Å; E2-K5 PolarHBondContact O-N 3.2Å; E2-K5 IonicContact OE1-NZ 3.22Å; E2-K5 PolarHBondContact OE1-NZ 3.07Å; E2-K5 IonicContact OE2-NZ 2.78Å; E2-K5 PolarHBondContact OE2-NZ 3.18Å; E2-A6 PolarHBondContact O-N 2.99Å
3	E	93.5	Very high	93.9	Very high	172 Å²	172	80.5 Å²	80.5	80%	0.804	42%	0.416	S	S	*	.	H	α-helix	trans	-58.7	-44.2	174.7	-66.3	178	171.3	0	0	112.4	M1 K5 A6 L7	M1-E3 PolarHBondContact O-N 2.98Å; E3-K5 PolarHBondContact O-N 3.47Å; E3-A6 PolarHBondContact O-N 3.35Å; E3-L7 WeakPolarHBondContact O-CB 3.28Å; E3-L7 PolarHBondContact O-N 3.48Å
4	S	95.4	Very high	93.9	Very high	62 Å²	62	82.8 Å²	82.8	43%	0.434	42%	0.418	S	S	.	.	H	α-helix	trans	-65.1	-38.5	178.6	-49.4	0	0	0	0	112	M1 E2 F8	M1-S4 WeakPolarHBondContact O-CB 3.45Å; M1-S4 PolarHBondContact O-N 3.25Å; M1-S4 VanDerWaalsContact O-N 3.13Å; E2-S4 VanDerWaalsContact C-N 3.33Å; E2-S4 PolarHBondContact O-N 3.34Å; S4-F8 VanDerWaalsContact O-CB 3.29Å; S4-F8 WeakPolarHBondContact O-CB 3.49Å; S4-F8 PolarHBondContact O-N 3.3Å
5	K	95.6	Very high	93.7	Very high	42 Å²	42	83.7 Å²	83.7	18%	0.183	43%	0.432	C	S	.	.	H	α-helix	trans	-64.2	-46.3	174.2	-75.8	167.5	59.2	-167.4	0	111.2	M1 E2 E3 L7 F8 R9 M65 F66 L69	M1-K5 PolarHBondContact O-N 3.32Å; E2-K5 PolarHBondContact O-N 3.2Å; E2-K5 IonicContact OE1-NZ 3.22Å; E2-K5 PolarHBondContact OE1-NZ 3.07Å; E2-K5 IonicContact OE2-NZ 2.78Å; E2-K5 PolarHBondContact OE2-NZ 3.18Å; E3-K5 PolarHBondContact O-N 3.47Å; K5-L7 PolarHBondContact O-N 2.9Å; K5-F8 PolarHBondContact O-N 2.96Å; K5-R9 WeakPolarHBondContact O-CB 3.09Å; K5-R9 PolarHBondContact O-N 3.34Å; K5-M65 HydrophobicContact CD-SD 4.45Å; K5-F66 HydrophobicContact CG-CE1 4.33Å; K5-F66 HydrophobicContact CG-CE2 4.39Å; K5-F66 HydrophobicContact CG-CZ 4.14Å; K5-L69 HydrophobicContact CB-CD1 3.9Å; K5-L69 HydrophobicContact CG-CD1 4.14Å; K5-L69 WeakPolarHBondContact O-CD1 3.49Å
6	A	95	Very high	93.5	Very high	56 Å²	56	91.3 Å²	91.3	46%	0.463	45%	0.453	S	S	.	.	H	α-helix	trans	-61.8	-43.2	178	0	0	0	0	0	111.9	E2 E3 T10	E2-A6 PolarHBondContact O-N 2.99Å; E3-A6 PolarHBondContact O-N 3.35Å; A6-T10 PolarHBondContact O-N 3.36Å; A6-T10 PolarHBondContact O-OG1 3.41Å
7	L	95.9	Very high	93.3	Very high	108 Å²	108	91.2 Å²	91.2	57%	0.565	45%	0.45	S	S	*	.	H	α-helix	trans	-63.3	-47.8	175	179.1	62.2	0	0	0	111.5	E3 K5 R9 T10 I11	E3-L7 WeakPolarHBondContact O-CB 3.28Å; E3-L7 PolarHBondContact O-N 3.48Å; K5-L7 PolarHBondContact O-N 2.9Å; L7-R9 PolarHBondContact O-N 2.78Å; L7-T10 WeakPolarHBondContact O-CB 3.5Å; L7-T10 PolarHBondContact O-N 3.16Å; L7-T10 VanDerWaalsContact O-N 3.13Å; L7-I11 HydrophobicContact CD1-CD1 4.04Å; L7-I11 HydrophobicContact CD1-CG1 4.34Å; L7-I11 HydrophobicContact CG-CD1 3.92Å; L7-I11 WeakPolarHBondContact O-CG1 3.35Å; L7-I11 PolarHBondContact O-N 3.03Å
8	F	96.3	Very high	92.8	Very high	19 Å²	19	90.2 Å²	90.2	8%	0.083	45%	0.45	C	S	.	.	H	α-helix	trans	-60.1	-45.2	179.1	-177.2	-100.2	0	0	0	111.8	S4 K5 T10 I11 I12 V22 L24 F66 L69 I77	S4-F8 VanDerWaalsContact O-CB 3.29Å; S4-F8 WeakPolarHBondContact O-CB 3.49Å; S4-F8 PolarHBondContact O-N 3.3Å; K5-F8 PolarHBondContact O-N 2.96Å; F8-T10 VanDerWaalsContact C-N 3.29Å; F8-T10 PolarHBondContact O-N 3.16Å; F8-I11 PolarHBondContact O-N 3.42Å; F8-I12 HydrophobicContact CE1-CB 4.42Å; F8-I12 HydrophobicContact CE1-CD1 3.85Å; F8-I12 HydrophobicContact CE1-CG2 4.39Å; F8-I12 HydrophobicContact CZ-CD1 3.75Å; F8-I12 WeakPolarHBondContact O-CG2 3.34Å; F8-I12 PolarHBondContact O-N 3.44Å; F8-V22 HydrophobicContact CE2-CG1 3.95Å; F8-V22 HydrophobicContact CZ-CG1 4.34Å; F8-L24 HydrophobicContact CD2-CD1 4.17Å; F8-L24 HydrophobicContact CE2-CD1 4.01Å; F8-F66 HydrophobicContact CB-CD1 3.8Å; F8-F66 HydrophobicContact CB-CE1 3.93Å; F8-F66 HydrophobicContact CD1-CB 4.41Å; F8-F66 AromaticContact CD1-CD1 3.86Å; F8-F66 HydrophobicContact CD1-CD1 3.86Å; F8-F66 HydrophobicContact CD2-CD1 4.22Å; F8-F66 HydrophobicContact CE1-CB 4.35Å; F8-F66 WeakPolarHBondContact CE1-O 3.28Å; F8-F66 AromaticContact CG-CD1 3.68Å; F8-F66 HydrophobicContact CG-CD1 3.68Å; F8-F66 HydrophobicContact CG-CE1 4.3Å; F8-L69 HydrophobicContact CD1-CB 4.19Å; F8-L69 HydrophobicContact CD1-CD1 4.09Å; F8-L69 HydrophobicContact CE1-CB 4.45Å; F8-I77 HydrophobicContact CE1-CD1 4.29Å; F8-I77 HydrophobicContact CZ-CD1 3.91Å; F8-I77 HydrophobicContact CZ-CG1 4.44Å; F8-I77 HydrophobicContact CZ-CG2 4.48Å
9	R	95.1	Very high	92.2	Very high	157 Å²	157	93.9 Å²	93.9	59%	0.592	47%	0.472	S	S	*	.	H	α-helix	trans	-56.6	-44.4	173.9	-173.1	179.1	-179.3	177.5	1	111.2	K5 L7 I11 T13 L69	K5-R9 WeakPolarHBondContact O-CB 3.09Å; K5-R9 PolarHBondContact O-N 3.34Å; L7-R9 PolarHBondContact O-N 2.78Å; R9-I11 PolarHBondContact O-N 2.83Å; R9-T13 HydrophobicContact CG-CG2 4.38Å; R9-T13 WeakPolarHBondContact O-CB 3.41Å; R9-T13 VanDerWaalsContact O-CG2 3.24Å; R9-T13 WeakPolarHBondContact O-CG2 3.43Å; R9-T13 PolarHBondContact O-N 3.31Å; R9-T13 VanDerWaalsContact O-N 3.14Å; R9-T13 PolarHBondContact O-OG1 3.34Å; R9-L69 HydrophobicContact CB-CD1 4.44Å
10	T	94.6	Very high	91.8	Very high	79 Å²	79	91.8 Å²	91.8	49%	0.485	47%	0.466	S	S	.	.	H	α-helix	trans	-61.4	-46	177.8	-55.9	0	0	0	0	111.4	A6 L7 F8 T13 Y14	A6-T10 PolarHBondContact O-N 3.36Å; A6-T10 PolarHBondContact O-OG1 3.41Å; L7-T10 WeakPolarHBondContact O-CB 3.5Å; L7-T10 PolarHBondContact O-N 3.16Å; L7-T10 VanDerWaalsContact O-N 3.13Å; F8-T10 VanDerWaalsContact C-N 3.29Å; F8-T10 PolarHBondContact O-N 3.16Å; T10-T13 PolarHBondContact O-OG1 2.78Å; T10-Y14 WeakPolarHBondContact O-CB 3.38Å; T10-Y14 PolarHBondContact O-N 3.41Å
11	I	94.1	Very high	91.4	Very high	71 Å²	71	89.9 Å²	89.9	36%	0.364	46%	0.461	S	S	.	.	H	α-helix	trans	-65.3	-47.9	179.9	-67.1	168.4	0	0	0	111.2	L7 F8 R9 T13 Y14 F17	L7-I11 HydrophobicContact CD1-CD1 4.04Å; L7-I11 HydrophobicContact CD1-CG1 4.34Å; L7-I11 HydrophobicContact CG-CD1 3.92Å; L7-I11 WeakPolarHBondContact O-CG1 3.35Å; L7-I11 PolarHBondContact O-N 3.03Å; F8-I11 PolarHBondContact O-N 3.42Å; R9-I11 PolarHBondContact O-N 2.83Å; I11-T13 VanDerWaalsContact C-N 3.3Å; I11-T13 PolarHBondContact O-N 3.45Å; I11-Y14 WeakPolarHBondContact O-CB 3.23Å; I11-Y14 PolarHBondContact O-N 3.01Å; I11-F17 HydrophobicContact CG2-CD2 4.02Å; I11-F17 HydrophobicContact CG2-CE2 4.22Å
12	I	93.8	Very high	91.6	Very high	6 Å²	6	86.2 Å²	86.2	3%	0.031	44%	0.444	C	S	.	.	H	α-helix	trans	-69.5	-30.8	-173	-161.3	160.1	0	0	0	112.7	F8 N70 K75 I77	F8-I12 HydrophobicContact CE1-CB 4.42Å; F8-I12 HydrophobicContact CE1-CD1 3.85Å; F8-I12 HydrophobicContact CE1-CG2 4.39Å; F8-I12 HydrophobicContact CZ-CD1 3.75Å; F8-I12 WeakPolarHBondContact O-CG2 3.34Å; F8-I12 PolarHBondContact O-N 3.44Å; I12-N70 HydrophobicContact CD1-CB 3.65Å; I12-N70 WeakPolarHBondContact CD1-OD1 3.32Å; I12-K75 HydrophobicContact CG1-CD 4.08Å; I12-K75 PolarHBondContact O-NZ 3.32Å; I12-I77 HydrophobicContact CD1-CD1 3.57Å; I12-I77 HydrophobicContact CD1-CG1 3.86Å
13	T	93.1	Very high	91.6	Very high	69 Å²	69	83.6 Å²	83.6	42%	0.423	43%	0.433	S	S	.	.	H	α-helix	trans	-85.6	-7.2	176.4	60.1	0	0	0	0	114	R9 T10 I11 P15 P71	R9-T13 HydrophobicContact CG-CG2 4.38Å; R9-T13 WeakPolarHBondContact O-CB 3.41Å; R9-T13 VanDerWaalsContact O-CG2 3.24Å; R9-T13 WeakPolarHBondContact O-CG2 3.43Å; R9-T13 PolarHBondContact O-N 3.31Å; R9-T13 VanDerWaalsContact O-N 3.14Å; R9-T13 PolarHBondContact O-OG1 3.34Å; T10-T13 PolarHBondContact O-OG1 2.78Å; I11-T13 VanDerWaalsContact C-N 3.3Å; I11-T13 PolarHBondContact O-N 3.45Å; T13-P15 WeakPolarHBondContact O-CD 3.41Å; T13-P71 HydrophobicContact CG2-CG 3.96Å
14	Y	94.3	Very high	91.6	Very high	112 Å²	112	76.1 Å²	76.1	44%	0.439	40%	0.398	S	S	.	.			trans	-69.5	125.2	-175.2	-149.8	-121.3	0	0	0	110.3	T10 I11 W16 F17	T10-Y14 WeakPolarHBondContact O-CB 3.38Å; T10-Y14 PolarHBondContact O-N 3.41Å; I11-Y14 WeakPolarHBondContact O-CB 3.23Å; I11-Y14 PolarHBondContact O-N 3.01Å; Y14-W16 HydrophobicContact CD1-CB 3.81Å; Y14-W16 AromaticContact CD1-CD1 3.4Å; Y14-W16 AromaticContact CD1-CG 3.91Å; Y14-W16 HydrophobicContact CD1-CG 3.91Å; Y14-W16 HydrophobicContact CE1-CB 4.07Å; Y14-W16 AromaticContact CE1-CD1 3.03Å; Y14-W16 AromaticContact CE1-CG 3.72Å; Y14-W16 HydrophobicContact CE1-CG 3.72Å; Y14-W16 AromaticContact CE1-NE1 3.77Å; Y14-W16 AromaticContact CZ-CD1 3.66Å; Y14-W16 PolarHBondContact O-N 3.39Å; Y14-F17 HydrophobicContact CD1-CD2 4.18Å; Y14-F17 HydrophobicContact CD1-CE2 4.19Å; Y14-F17 HydrophobicContact CG-CD2 4.5Å; Y14-F17 PolarHBondContact O-N 2.94Å
15	P	90.8	Very high	91.4	Very high	96 Å²	96	77.1 Å²	77.1	62%	0.623	40%	0.395	S	S	*	.	G	3₁₀ helix	trans	-58.4	-28.5	-174.5	-27.4	34.8	0	0	0	114.1	T13 F17 T18	T13-P15 WeakPolarHBondContact O-CD 3.41Å; P15-F17 PolarHBondContact O-N 3.48Å; P15-T18 PolarHBondContact O-N 3Å; P15-T18 PolarHBondContact O-OG1 3.06Å; P15-T18 VanDerWaalsContact O-OG1 3.05Å
16	W	91.3	Very high	91.3	Very high	205 Å²	205	76 Å²	76	78%	0.777	39%	0.391	S	S	*	.	G	3₁₀ helix	trans	-69.4	-17.7	179.2	-56.4	81.5	0	0	0	113	Y14	Y14-W16 HydrophobicContact CD1-CB 3.81Å; Y14-W16 AromaticContact CD1-CD1 3.4Å; Y14-W16 AromaticContact CD1-CG 3.91Å; Y14-W16 HydrophobicContact CD1-CG 3.91Å; Y14-W16 HydrophobicContact CE1-CB 4.07Å; Y14-W16 AromaticContact CE1-CD1 3.03Å; Y14-W16 AromaticContact CE1-CG 3.72Å; Y14-W16 HydrophobicContact CE1-CG 3.72Å; Y14-W16 AromaticContact CE1-NE1 3.77Å; Y14-W16 AromaticContact CZ-CD1 3.66Å; Y14-W16 PolarHBondContact O-N 3.39Å
17	F	89.3	Confident	91.1	Very high	90 Å²	90	77.3 Å²	77.3	40%	0.395	39%	0.39	S	S	.	.	G	3₁₀ helix	trans	-106.9	9.4	178.2	-62.9	-49.8	0	0	0	113.1	I11 Y14 P15 N19 S20 K75	I11-F17 HydrophobicContact CG2-CD2 4.02Å; I11-F17 HydrophobicContact CG2-CE2 4.22Å; Y14-F17 HydrophobicContact CD1-CD2 4.18Å; Y14-F17 HydrophobicContact CD1-CE2 4.19Å; Y14-F17 HydrophobicContact CG-CD2 4.5Å; Y14-F17 PolarHBondContact O-N 2.94Å; P15-F17 PolarHBondContact O-N 3.48Å; F17-N19 VanDerWaalsContact C-N 3.3Å; F17-N19 PolarHBondContact O-N 2.95Å; F17-S20 WeakPolarHBondContact O-CB 3.29Å; F17-S20 PolarHBondContact O-N 2.78Å; F17-K75 VanDerWaalsContact O-CE 3.24Å; F17-K75 WeakPolarHBondContact O-CE 3.02Å; F17-K75 PolarHBondContact O-NZ 3.07Å
18	T	85	Confident	90.9	Very high	73 Å²	73	78.2 Å²	78.2	45%	0.448	39%	0.389	S	S	.	.	T	Hydrogen-bonded Turn	trans	-54.2	-46.3	-179.3	-62	0	0	0	0	112	P15 S20	P15-T18 PolarHBondContact O-N 3Å; P15-T18 PolarHBondContact O-OG1 3.06Å; P15-T18 VanDerWaalsContact O-OG1 3.05Å; T18-S20 VanDerWaalsContact C-N 3.32Å; T18-S20 PolarHBondContact O-N 2.92Å
19	N	80.3	Confident	90.7	Very high	162 Å²	162	79.7 Å²	79.7	87%	0.866	40%	0.396	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.1	12.1	-179.9	-61.4	-28.9	0	0	0	113.4	F17	F17-N19 VanDerWaalsContact C-N 3.3Å; F17-N19 PolarHBondContact O-N 2.95Å
20	S	84.8	Confident	90.5	Very high	50 Å²	50	75.4 Å²	75.4	35%	0.35	39%	0.385	S	S	.	.	S	Bend	trans	-99.3	136.1	179.2	-56.5	0	0	0	0	110.9	F17 T18 K75	F17-S20 WeakPolarHBondContact O-CB 3.29Å; F17-S20 PolarHBondContact O-N 2.78Å; T18-S20 VanDerWaalsContact C-N 3.32Å; T18-S20 PolarHBondContact O-N 2.92Å; S20-K75 VanDerWaalsContact O-CE 3.27Å; S20-K75 WeakPolarHBondContact O-CE 3.09Å
21	S	83.8	Confident	90.5	Very high	52 Å²	52	75.8 Å²	75.8	36%	0.364	38%	0.383	S	S	.	.			trans	-69.4	143.9	168.9	-60.2	0	0	0	0	111.4	T100	S21-T100 VanDerWaalsContact CB-OG1 3.28Å; S21-T100 WeakPolarHBondContact CB-OG1 3.39Å; S21-T100 WeakPolarHBondContact OG-CB 3.46Å; S21-T100 WeakPolarHBondContact OG-CG2 3.27Å; S21-T100 PolarHBondContact OG-OG1 2.93Å
22	V	90.4	Very high	90.5	Very high	19 Å²	19	74.2 Å²	74.2	12%	0.115	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	124.5	-179.7	-179.6	0	0	0	0	109.1	F8 I77 Y78	F8-V22 HydrophobicContact CE2-CG1 3.95Å; F8-V22 HydrophobicContact CZ-CG1 4.34Å; V22-I77 HydrophobicContact CG1-CG2 4.37Å; V22-Y78 PolarHBondContact O-N 2.95Å
23	I	91.4	Very high	90.5	Very high	55 Å²	55	77.8 Å²	77.8	28%	0.282	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	118.7	170.6	-53.6	176.5	0	0	0	107.8	F25 Y78 V93 A96	I23-F25 HydrophobicContact CG2-CD2 4.33Å; I23-F25 HydrophobicContact CG2-CE1 4.08Å; I23-F25 HydrophobicContact CG2-CE2 3.8Å; I23-F25 HydrophobicContact CG2-CZ 3.66Å; I23-Y78 CarbonylContact C-O 3.5Å; I23-Y78 VanDerWaalsContact CA-O 3.31Å; I23-Y78 WeakPolarHBondContact CA-O 3.24Å; I23-V93 HydrophobicContact CD1-CB 4.49Å; I23-V93 HydrophobicContact CD1-CG1 4.36Å; I23-V93 HydrophobicContact CD1-CG2 4.37Å; I23-A96 HydrophobicContact CD1-CB 3.63Å; I23-A96 HydrophobicContact CG1-CB 3.86Å
24	L	92.8	Very high	90.6	Very high	16 Å²	16	80 Å²	80	8%	0.084	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	110.2	179.5	176.4	63.5	0	0	0	110.1	F8 L26 L63 F66 I77 Y78 S79 H80	F8-L24 HydrophobicContact CD2-CD1 4.17Å; F8-L24 HydrophobicContact CE2-CD1 4.01Å; L24-L26 HydrophobicContact CD1-CD2 4.41Å; L24-L26 HydrophobicContact CD2-CD2 4.33Å; L24-L26 HydrophobicContact CD2-CG 4.48Å; L24-L26 HydrophobicContact CG-CD2 4.29Å; L24-L26 HydrophobicContact CG-CG 4.34Å; L24-L63 HydrophobicContact CD2-CD1 4.14Å; L24-F66 HydrophobicContact CD1-CD1 4.23Å; L24-F66 HydrophobicContact CD2-CB 3.54Å; L24-F66 HydrophobicContact CD2-CD1 4.49Å; L24-F66 HydrophobicContact CD2-CG 4.07Å; L24-I77 HydrophobicContact CB-CG2 3.72Å; L24-I77 HydrophobicContact CD2-CG2 4.38Å; L24-Y78 PolarHBondContact N-O 3.22Å; L24-S79 CarbonylContact O-C 3.57Å; L24-S79 VanDerWaalsContact O-CA 3.32Å; L24-S79 WeakPolarHBondContact O-CA 3.38Å; L24-H80 PolarHBondContact O-N 3.42Å
25	F	92.3	Very high	90.7	Very high	83 Å²	83	79.6 Å²	79.6	36%	0.364	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	114.6	171.1	-67.7	-62.4	0	0	0	111.1	I23 N27 H80 T82 V93	I23-F25 HydrophobicContact CG2-CD2 4.33Å; I23-F25 HydrophobicContact CG2-CE1 4.08Å; I23-F25 HydrophobicContact CG2-CE2 3.8Å; I23-F25 HydrophobicContact CG2-CZ 3.66Å; F25-N27 PolarHBondContact O-N 3.21Å; F25-H80 WeakPolarHBondContact CA-O 3.46Å; F25-H80 HydrophobicContact CD1-CB 4.11Å; F25-H80 HydrophobicContact CE1-CB 4.18Å; F25-T82 HydrophobicContact CD1-CG2 3.57Å; F25-T82 HydrophobicContact CE1-CG2 4.14Å; F25-T82 HydrophobicContact CG-CG2 4.44Å; F25-V93 HydrophobicContact CE2-CG2 4.45Å; F25-V93 HydrophobicContact CZ-CG2 3.87Å
26	L	93.1	Very high	90.9	Very high	19 Å²	19	75.2 Å²	75.2	10%	0.099	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.8	84.9	169.4	-64.1	175.8	0	0	0	108.3	L24 I62 L63 F66 H80 F81 T82	L24-L26 HydrophobicContact CD1-CD2 4.41Å; L24-L26 HydrophobicContact CD2-CD2 4.33Å; L24-L26 HydrophobicContact CD2-CG 4.48Å; L24-L26 HydrophobicContact CG-CD2 4.29Å; L24-L26 HydrophobicContact CG-CG 4.34Å; L26-I62 HydrophobicContact CD1-CG2 4.41Å; L26-I62 HydrophobicContact CD2-CG2 4.05Å; L26-L63 HydrophobicContact CD1-CB 3.72Å; L26-L63 HydrophobicContact CD1-CD1 3.89Å; L26-L63 HydrophobicContact CD1-CG 4.38Å; L26-F66 HydrophobicContact CD2-CD2 4.12Å; L26-F66 HydrophobicContact CD2-CE2 4.22Å; L26-H80 PolarHBondContact N-O 2.91Å; L26-F81 HydrophobicContact CB-CD1 3.65Å; L26-F81 HydrophobicContact CB-CE1 3.97Å; L26-F81 HydrophobicContact CD1-CD1 3.88Å; L26-F81 HydrophobicContact CD1-CE1 3.31Å; L26-F81 HydrophobicContact CD1-CZ 3.86Å; L26-F81 HydrophobicContact CG-CD1 4.41Å; L26-F81 HydrophobicContact CG-CE1 4.28Å; L26-F81 WeakPolarHBondContact O-CA 3.25Å; L26-T82 PolarHBondContact O-N 2.96Å
27	N	91	Very high	91	Very high	82 Å²	82	69.9 Å²	69.9	44%	0.439	36%	0.355	S	S	.	.			trans	-77.5	165.1	-176.1	-166.7	18.6	0	0	0	112.2	F25 T82 A84	F25-N27 PolarHBondContact O-N 3.21Å; N27-T82 CarbonylContact C-O 3.44Å; N27-T82 WeakPolarHBondContact CA-O 3.43Å; N27-T82 WeakPolarHBondContact CA-OG1 3.27Å; N27-T82 PolarHBondContact OD1-O 2.72Å; N27-T82 PolarHBondContact OD1-OG1 3.05Å; N27-A84 PolarHBondContact OD1-N 3.47Å
28	K	91.3	Very high	91.3	Very high	127 Å²	127	72.6 Å²	72.6	55%	0.552	36%	0.364	S	S	*	.			trans	67.6	36.6	-179.7	-53.9	177.8	175.4	-171.9	0	113.4	D30 L31 L32 T82	K28-D30 VanDerWaalsContact CA-OD1 3.27Å; K28-D30 WeakPolarHBondContact CA-OD1 3.24Å; K28-D30 PolarHBondContact O-N 3.05Å; K28-L31 HydrophobicContact CB-CB 4.25Å; K28-L31 HydrophobicContact CB-CD1 4.13Å; K28-L31 HydrophobicContact CB-CG 4.49Å; K28-L31 HydrophobicContact CD-CD1 3.99Å; K28-L31 HydrophobicContact CG-CD1 4.19Å; K28-L31 PolarHBondContact O-N 2.95Å; K28-L32 PolarHBondContact O-N 3.31Å; K28-L32 VanDerWaalsContact O-N 3.08Å; K28-T82 PolarHBondContact N-O 3.31Å
29	K	91.3	Very high	91.8	Very high	51 Å²	51	70 Å²	70	22%	0.222	35%	0.349	C	S	.	.	H	α-helix	trans	-57.2	-34.3	177.5	73.7	-177.7	172.4	-167.3	0	112.7	L32 E33 F81 T82 C83 D86	K29-L32 PolarHBondContact O-N 3.47Å; K29-E33 VanDerWaalsContact O-CG 3.31Å; K29-E33 WeakPolarHBondContact O-CG 3.49Å; K29-E33 PolarHBondContact O-N 2.99Å; K29-F81 HydrophobicContact CB-CB 4.42Å; K29-F81 HydrophobicContact CD-CB 4.24Å; K29-F81 PolarHBondContact NZ-O 3.05Å; K29-T82 PolarHBondContact N-O 3.31Å; K29-T82 VanDerWaalsContact N-O 3.07Å; K29-C83 HydrophobicContact CG-CB 4.32Å; K29-D86 IonicContact NZ-OD2 2.66Å; K29-D86 PolarHBondContact NZ-OD2 3.28Å
30	D	92.1	Very high	92.4	Very high	67 Å²	67	65.2 Å²	65.2	36%	0.358	32%	0.321	S	S	.	.	H	α-helix	trans	-62.2	-49.3	175.6	57.4	-43.8	0	0	0	111.9	K28 L32 E33 E34 C83	K28-D30 VanDerWaalsContact CA-OD1 3.27Å; K28-D30 WeakPolarHBondContact CA-OD1 3.24Å; K28-D30 PolarHBondContact O-N 3.05Å; D30-L32 VanDerWaalsContact C-N 3.29Å; D30-L32 PolarHBondContact O-N 2.6Å; D30-E33 WeakPolarHBondContact O-CB 3.4Å; D30-E33 PolarHBondContact O-N 3.45Å; D30-E34 PolarHBondContact O-N 3.38Å; D30-C83 PolarHBondContact OD1-SG 2.66Å; D30-C83 VanDerWaalsContact OD1-SG 3.42Å
31	L	93.6	Very high	92.8	Very high	87 Å²	87	63.7 Å²	63.7	46%	0.455	31%	0.309	S	S	.	.	H	α-helix	trans	-67.9	-31.9	178.1	-66	175.6	0	0	0	112	K28 K35	K28-L31 HydrophobicContact CB-CB 4.25Å; K28-L31 HydrophobicContact CB-CD1 4.13Å; K28-L31 HydrophobicContact CB-CG 4.49Å; K28-L31 HydrophobicContact CD-CD1 3.99Å; K28-L31 HydrophobicContact CG-CD1 4.19Å; K28-L31 PolarHBondContact O-N 2.95Å; L31-K35 WeakPolarHBondContact O-CB 3.28Å; L31-K35 PolarHBondContact O-N 3.32Å
32	L	94.4	Very high	93.4	Very high	38 Å²	38	63.4 Å²	63.4	20%	0.199	31%	0.31	C	S	.	.	H	α-helix	trans	-67	-45	174	177.9	62.4	0	0	0	111.4	K28 K29 D30 E34 K35 I36 R59 I62	K28-L32 PolarHBondContact O-N 3.31Å; K28-L32 VanDerWaalsContact O-N 3.08Å; K29-L32 PolarHBondContact O-N 3.47Å; D30-L32 VanDerWaalsContact C-N 3.29Å; D30-L32 PolarHBondContact O-N 2.6Å; L32-E34 VanDerWaalsContact C-N 3.29Å; L32-E34 PolarHBondContact O-N 3Å; L32-K35 PolarHBondContact O-N 3.11Å; L32-I36 WeakPolarHBondContact O-CB 3.35Å; L32-I36 WeakPolarHBondContact O-CG2 3.37Å; L32-I36 PolarHBondContact O-N 3.09Å; L32-R59 HydrophobicContact CD2-CB 4.48Å; L32-R59 HydrophobicContact CD2-CG 3.39Å; L32-I62 HydrophobicContact CD1-CD1 4.11Å; L32-I62 HydrophobicContact CD2-CD1 3.77Å
33	E	94.1	Very high	93.6	Very high	80 Å²	80	68.1 Å²	68.1	37%	0.374	33%	0.334	S	S	.	.	H	α-helix	trans	-57.9	-40.1	175.4	-78	172	-163.2	0	0	112.3	K29 D30 I36 P55 R59	K29-E33 VanDerWaalsContact O-CG 3.31Å; K29-E33 WeakPolarHBondContact O-CG 3.49Å; K29-E33 PolarHBondContact O-N 2.99Å; D30-E33 WeakPolarHBondContact O-CB 3.4Å; D30-E33 PolarHBondContact O-N 3.45Å; E33-I36 WeakPolarHBondContact O-CG2 3.47Å; E33-P55 HydrophobicContact CB-CB 4.36Å; E33-P55 HydrophobicContact CG-CB 3.71Å; E33-P55 HydrophobicContact CG-CG 4.25Å; E33-R59 VanDerWaalsContact CD-NH2 3.26Å; E33-R59 IonicContact OE1-CZ 2.91Å; E33-R59 IonicContact OE1-NH1 3.04Å; E33-R59 PolarHBondContact OE1-NH1 3.26Å; E33-R59 IonicContact OE1-NH2 3.06Å; E33-R59 PolarHBondContact OE1-NH2 3.25Å
34	E	95.3	Very high	93.7	Very high	116 Å²	116	72.3 Å²	72.3	54%	0.542	35%	0.348	S	S	.	.	H	α-helix	trans	-70.2	-48.7	176.4	-168.3	-169.2	145.4	0	0	111.4	D30 L32 I36 L37 Y38	D30-E34 PolarHBondContact O-N 3.38Å; L32-E34 VanDerWaalsContact C-N 3.29Å; L32-E34 PolarHBondContact O-N 3Å; E34-I36 PolarHBondContact O-N 2.88Å; E34-L37 PolarHBondContact O-N 3.45Å; E34-Y38 HydrophobicContact CG-CE1 4.36Å; E34-Y38 WeakPolarHBondContact O-CD1 2.99Å; E34-Y38 WeakPolarHBondContact O-CE1 3.36Å
35	K	95.4	Very high	93.8	Very high	103 Å²	103	72.8 Å²	72.8	45%	0.448	35%	0.349	S	S	.	.	H	α-helix	trans	-69.9	-34.3	-171	-173.2	172.6	179.9	-174.1	0	113.5	L31 L32 L37 Y38 S39	L31-K35 WeakPolarHBondContact O-CB 3.28Å; L31-K35 PolarHBondContact O-N 3.32Å; L32-K35 PolarHBondContact O-N 3.11Å; K35-L37 PolarHBondContact O-N 3.31Å; K35-L37 VanDerWaalsContact O-N 3.12Å; K35-Y38 HydrophobicContact CG-CE2 4.02Å; K35-Y38 PolarHBondContact O-N 2.68Å; K35-S39 WeakPolarHBondContact O-CB 3.39Å; K35-S39 PolarHBondContact O-N 3.38Å
36	I	95.8	Very high	93.9	Very high	5 Å²	5	74 Å²	74	3%	0.026	37%	0.365	C	S	.	.	T	Hydrogen-bonded Turn	trans	-63.4	-20.5	-176.9	-160.2	65.1	0	0	0	112.8	L32 E33 E34 Y38 L41 R53 P55 A58	L32-I36 WeakPolarHBondContact O-CB 3.35Å; L32-I36 WeakPolarHBondContact O-CG2 3.37Å; L32-I36 PolarHBondContact O-N 3.09Å; E33-I36 WeakPolarHBondContact O-CG2 3.47Å; E34-I36 PolarHBondContact O-N 2.88Å; I36-Y38 VanDerWaalsContact C-N 3.31Å; I36-Y38 PolarHBondContact O-N 3.14Å; I36-L41 HydrophobicContact CD1-CB 3.96Å; I36-R53 WeakPolarHBondContact O-CA 3.49Å; I36-P55 HydrophobicContact CG2-CB 4.16Å; I36-P55 HydrophobicContact CG2-CG 3.74Å; I36-A58 HydrophobicContact CD1-CB 3.79Å; I36-A58 HydrophobicContact CG1-CB 4.04Å
37	L	94.4	Very high	93.9	Very high	92 Å²	92	79.8 Å²	79.8	48%	0.482	39%	0.392	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69	-28.7	-179.9	-60.4	178.8	0	0	0	113	E34 K35 R53	E34-L37 PolarHBondContact O-N 3.45Å; K35-L37 PolarHBondContact O-N 3.31Å; K35-L37 VanDerWaalsContact O-N 3.12Å; L37-R53 HydrophobicContact CD2-CB 4.36Å; L37-R53 WeakPolarHBondContact O-CD 3.2Å; L37-R53 PolarHBondContact O-NE 3.14Å
38	Y	94.8	Very high	94.2	Very high	148 Å²	148	76.7 Å²	76.7	58%	0.58	37%	0.374	S	S	*	.	T	Hydrogen-bonded Turn	trans	-126.8	-10.8	-175.6	56.5	-99.3	0	0	0	114.1	E34 K35 I36	E34-Y38 HydrophobicContact CG-CE1 4.36Å; E34-Y38 WeakPolarHBondContact O-CD1 2.99Å; E34-Y38 WeakPolarHBondContact O-CE1 3.36Å; K35-Y38 HydrophobicContact CG-CE2 4.02Å; K35-Y38 PolarHBondContact O-N 2.68Å; I36-Y38 VanDerWaalsContact C-N 3.31Å; I36-Y38 PolarHBondContact O-N 3.14Å
39	S	95.2	Very high	94.3	Very high	17 Å²	17	78.1 Å²	78.1	12%	0.119	39%	0.388	C	S	.	.	S	Bend	trans	-125.7	113.9	178.5	-175.9	0	0	0	0	108.7	K35 Y44	K35-S39 WeakPolarHBondContact O-CB 3.39Å; K35-S39 PolarHBondContact O-N 3.38Å; S39-Y44 WeakPolarHBondContact OG-CE2 3.42Å
40	H	92.8	Very high	94.4	Very high	63 Å²	63	76.7 Å²	76.7	29%	0.292	39%	0.388	S	S	.	.			trans	-80.5	135.1	-174.5	-65	-72.7	0	0	0	111	A42 D43 Y44 P52	H40-A42 VanDerWaalsContact C-N 3.29Å; H40-A42 PolarHBondContact O-N 2.86Å; H40-D43 WeakPolarHBondContact O-CB 3.35Å; H40-D43 PolarHBondContact O-N 3.19Å; H40-Y44 WeakPolarHBondContact O-CD2 3.49Å; H40-P52 VanDerWaalsContact ND1-CB 3.28Å; H40-P52 WeakPolarHBondContact ND1-CB 3.4Å
41	L	94.5	Very high	94.6	Very high	17 Å²	17	76.6 Å²	76.6	9%	0.089	39%	0.39	C	S	.	.	G	3₁₀ helix	trans	-66.2	-33.6	-177.2	-165.1	63.4	0	0	0	112.3	I36 D43 Y44 F45 Y48 A58 F61	I36-L41 HydrophobicContact CD1-CB 3.96Å; L41-D43 PolarHBondContact O-N 2.94Å; L41-Y44 PolarHBondContact O-N 3.2Å; L41-F45 HydrophobicContact CD1-CD2 3.53Å; L41-F45 HydrophobicContact CD1-CE2 3.81Å; L41-F45 HydrophobicContact CG-CD2 3.87Å; L41-F45 PolarHBondContact O-N 3.37Å; L41-Y48 HydrophobicContact CB-CD1 3.86Å; L41-Y48 HydrophobicContact CB-CE1 4.08Å; L41-Y48 HydrophobicContact CB-CG 4.15Å; L41-Y48 HydrophobicContact CD2-CD1 4.41Å; L41-Y48 HydrophobicContact CD2-CD2 3.78Å; L41-Y48 HydrophobicContact CD2-CE2 3.94Å; L41-Y48 HydrophobicContact CD2-CG 4Å; L41-Y48 HydrophobicContact CG-CD1 4.45Å; L41-Y48 HydrophobicContact CG-CG 4.24Å; L41-A58 HydrophobicContact CD2-CB 3.97Å; L41-F61 HydrophobicContact CD2-CD1 3.64Å; L41-F61 HydrophobicContact CD2-CE1 4.24Å; L41-F61 HydrophobicContact CD2-CG 4.39Å; L41-F61 HydrophobicContact CG-CD1 4.5Å
42	A	94.8	Very high	94.6	Very high	46 Å²	46	76.7 Å²	76.7	38%	0.38	40%	0.396	S	S	.	.	G	3₁₀ helix	trans	-59.1	-26.8	177.1	0	0	0	0	0	113.7	H40 Y44 F45 Y48	H40-A42 VanDerWaalsContact C-N 3.29Å; H40-A42 PolarHBondContact O-N 2.86Å; A42-Y44 PolarHBondContact O-N 3.5Å; A42-F45 WeakPolarHBondContact CA-O 3.39Å; A42-F45 CarbonylContact O-C 3.55Å; A42-Y48 HydrophobicContact CB-CD1 4.27Å
43	D	94.4	Very high	94.6	Very high	118 Å²	118	82.1 Å²	82.1	63%	0.631	41%	0.414	S	S	*	.	G	3₁₀ helix	trans	-67.7	-22.4	177.8	-60.3	-25.8	0	0	0	112.1	H40 L41	H40-D43 WeakPolarHBondContact O-CB 3.35Å; H40-D43 PolarHBondContact O-N 3.19Å; L41-D43 PolarHBondContact O-N 2.94Å
44	Y	94.1	Very high	94.6	Very high	144 Å²	144	80.7 Å²	80.7	57%	0.565	41%	0.409	S	S	*	.	T	Hydrogen-bonded Turn	trans	-111.9	-27.5	-178.7	-55.7	-84.2	0	0	0	112.9	S39 H40 L41 A42	S39-Y44 WeakPolarHBondContact OG-CE2 3.42Å; H40-Y44 WeakPolarHBondContact O-CD2 3.49Å; L41-Y44 PolarHBondContact O-N 3.2Å; A42-Y44 PolarHBondContact O-N 3.5Å
45	F	94.5	Very high	94.6	Very high	25 Å²	25	76.6 Å²	76.6	11%	0.11	39%	0.393	C	S	.	.			trans	-128.6	90.1	179.7	-59.4	-78.9	0	0	0	108.7	M1 L41 A42 E47 Y48 F61 M65	M1-F45 HydrophobicContact CB-CE1 4.22Å; M1-F45 HydrophobicContact CB-CZ 3.65Å; M1-F45 HydrophobicContact CG-CE2 4.48Å; M1-F45 HydrophobicContact CG-CZ 3.77Å; L41-F45 HydrophobicContact CD1-CD2 3.53Å; L41-F45 HydrophobicContact CD1-CE2 3.81Å; L41-F45 HydrophobicContact CG-CD2 3.87Å; L41-F45 PolarHBondContact O-N 3.37Å; A42-F45 WeakPolarHBondContact CA-O 3.39Å; A42-F45 CarbonylContact O-C 3.55Å; F45-E47 PolarHBondContact O-N 3.24Å; F45-Y48 VanDerWaalsContact O-CB 3.3Å; F45-Y48 WeakPolarHBondContact O-CB 3.43Å; F45-Y48 PolarHBondContact O-N 3.13Å; F45-F61 HydrophobicContact CB-CE1 3.71Å; F45-F61 HydrophobicContact CB-CZ 3.88Å; F45-F61 HydrophobicContact CD1-CE1 4.42Å; F45-F61 HydrophobicContact CD2-CE1 4.43Å; F45-F61 AromaticContact CG-CE1 3.94Å; F45-F61 HydrophobicContact CG-CE1 3.94Å; F45-F61 HydrophobicContact CG-CZ 4.48Å; F45-M65 HydrophobicContact CD1-CE 4.33Å; F45-M65 HydrophobicContact CD1-SD 3.78Å; F45-M65 HydrophobicContact CE1-CE 4.08Å; F45-M65 HydrophobicContact CE1-SD 3.88Å; F45-M65 HydrophobicContact CG-SD 4.43Å; F45-M65 HydrophobicContact CZ-CE 4.23Å
46	P	94.3	Very high	94.6	Very high	109 Å²	109	76.8 Å²	76.8	71%	0.708	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.8	-20.2	-178.1	-25.2	35.5	0	0	0	114	Y48	P46-Y48 VanDerWaalsContact C-N 3.26Å; P46-Y48 PolarHBondContact O-N 3.19Å
47	E	94.4	Very high	94.6	Very high	140 Å²	140	77.4 Å²	77.4	65%	0.654	40%	0.403	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.6	-7.6	176.2	-52	80.1	-173.8	0	0	113.4	F45 D49 F61	F45-E47 PolarHBondContact O-N 3.24Å; E47-D49 PolarHBondContact O-N 2.96Å; E47-F61 HydrophobicContact CB-CE2 4.49Å; E47-F61 HydrophobicContact CB-CZ 4.45Å
48	Y	96	Very high	94.7	Very high	18 Å²	18	73 Å²	73	7%	0.071	38%	0.38	C	S	.	.			trans	-76.2	110.7	175.4	-180	-106.9	0	0	0	110.8	L41 A42 F45 P46 G50 P51 A57 F61	L41-Y48 HydrophobicContact CB-CD1 3.86Å; L41-Y48 HydrophobicContact CB-CE1 4.08Å; L41-Y48 HydrophobicContact CB-CG 4.15Å; L41-Y48 HydrophobicContact CD2-CD1 4.41Å; L41-Y48 HydrophobicContact CD2-CD2 3.78Å; L41-Y48 HydrophobicContact CD2-CE2 3.94Å; L41-Y48 HydrophobicContact CD2-CG 4Å; L41-Y48 HydrophobicContact CG-CD1 4.45Å; L41-Y48 HydrophobicContact CG-CG 4.24Å; A42-Y48 HydrophobicContact CB-CD1 4.27Å; F45-Y48 VanDerWaalsContact O-CB 3.3Å; F45-Y48 WeakPolarHBondContact O-CB 3.43Å; F45-Y48 PolarHBondContact O-N 3.13Å; P46-Y48 VanDerWaalsContact C-N 3.26Å; P46-Y48 PolarHBondContact O-N 3.19Å; Y48-G50 WeakPolarHBondContact CE1-O 3.37Å; Y48-G50 VanDerWaalsContact CZ-CA 3.46Å; Y48-P51 PolarHBondContact OH-O 3.36Å; Y48-A57 WeakPolarHBondContact OH-CB 3.39Å; Y48-F61 HydrophobicContact CD2-CB 3.63Å; Y48-F61 AromaticContact CD2-CD1 3.84Å; Y48-F61 HydrophobicContact CD2-CD1 3.84Å; Y48-F61 AromaticContact CD2-CD2 3.68Å; Y48-F61 HydrophobicContact CD2-CD2 3.68Å; Y48-F61 HydrophobicContact CD2-CE1 4.38Å; Y48-F61 HydrophobicContact CD2-CE2 4.24Å; Y48-F61 AromaticContact CD2-CG 3.44Å; Y48-F61 HydrophobicContact CD2-CG 3.44Å; Y48-F61 VanDerWaalsContact CD2-CG 3.44Å; Y48-F61 HydrophobicContact CE2-CB 3.79Å; Y48-F61 HydrophobicContact CE2-CG 4.13Å; Y48-F61 HydrophobicContact CG-CD2 4.5Å; Y48-F61 HydrophobicContact CG-CG 4.4Å
49	D	94.9	Very high	94.7	Very high	157 Å²	157	67.8 Å²	67.8	84%	0.84	36%	0.359	S	S	*	.			trans	-101.4	0.1	177.4	64	-11.8	0	0	0	113.5	E47	E47-D49 PolarHBondContact O-N 2.96Å
50	G	93.6	Very high	94.8	Very high	21 Å²	21	72.8 Å²	72.8	22%	0.216	38%	0.381	C	S	.	.	S	Bend	trans	-72	166.3	-179.1	0	0	0	0	0	113.9	Y48	Y48-G50 WeakPolarHBondContact CE1-O 3.37Å; Y48-G50 VanDerWaalsContact CZ-CA 3.46Å
51	P	95.2	Very high	95	Very high	64 Å²	64	71.2 Å²	71.2	42%	0.416	37%	0.373	S	S	.	.	P	Polyproline II helix	trans	-61.7	145.3	-179.7	22.3	-31.4	0	0	0	112.5	Y48 D54 A57	Y48-P51 PolarHBondContact OH-O 3.36Å; P51-D54 HydrophobicContact CB-CB 4.2Å; P51-D54 HydrophobicContact CG-CB 3.7Å; P51-D54 WeakPolarHBondContact CG-OD2 3.46Å; P51-A57 HydrophobicContact CG-CB 3.97Å
52	P	92.9	Very high	95.1	Very high	89 Å²	89	71 Å²	71	58%	0.578	37%	0.372	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.8	150	172	29	-33.9	0	0	0	110.7	H40 D54	H40-P52 VanDerWaalsContact ND1-CB 3.28Å; H40-P52 WeakPolarHBondContact ND1-CB 3.4Å; P52-D54 PolarHBondContact O-N 3.26Å
53	R	94.3	Very high	95.1	Very high	152 Å²	152	70.3 Å²	70.3	57%	0.574	36%	0.362	S	S	*	.	T	Hydrogen-bonded Turn	trans	60	21.5	177.2	-51.8	-178.2	171.4	162.1	1.5	114.8	I36 L37 P55	I36-R53 WeakPolarHBondContact O-CA 3.49Å; L37-R53 HydrophobicContact CD2-CB 4.36Å; L37-R53 WeakPolarHBondContact O-CD 3.2Å; L37-R53 PolarHBondContact O-NE 3.14Å; R53-P55 WeakPolarHBondContact O-CD 3.26Å
54	D	96.1	Very high	95.2	Very high	51 Å²	51	70.2 Å²	70.2	27%	0.273	36%	0.356	S	S	.	.			trans	-103.7	107	175.2	-171.5	-30.1	0	0	0	110.1	P51 P52 I56 A57 A58	P51-D54 HydrophobicContact CB-CB 4.2Å; P51-D54 HydrophobicContact CG-CB 3.7Å; P51-D54 WeakPolarHBondContact CG-OD2 3.46Å; P52-D54 PolarHBondContact O-N 3.26Å; D54-I56 VanDerWaalsContact C-N 3.26Å; D54-I56 PolarHBondContact O-N 3.43Å; D54-I56 WeakPolarHBondContact OD1-CA 3.48Å; D54-I56 WeakPolarHBondContact OD1-CB 3.46Å; D54-I56 PolarHBondContact OD1-N 2.88Å; D54-A57 HydrophobicContact CB-CB 3.96Å; D54-A57 PolarHBondContact OD1-N 3.22Å; D54-A57 VanDerWaalsContact OD1-N 3.07Å; D54-A58 VanDerWaalsContact O-CB 3.29Å; D54-A58 WeakPolarHBondContact O-CB 3.3Å; D54-A58 PolarHBondContact O-N 3.04Å; D54-A58 VanDerWaalsContact O-N 3.1Å
55	P	94.4	Very high	95.3	Very high	30 Å²	30	64.5 Å²	64.5	20%	0.195	34%	0.335	C	S	.	.	H	α-helix	trans	-67.3	-24.2	178.9	-18.2	30.3	0	0	0	114.3	E33 I36 R53 R59	E33-P55 HydrophobicContact CB-CB 4.36Å; E33-P55 HydrophobicContact CG-CB 3.71Å; E33-P55 HydrophobicContact CG-CG 4.25Å; I36-P55 HydrophobicContact CG2-CB 4.16Å; I36-P55 HydrophobicContact CG2-CG 3.74Å; R53-P55 WeakPolarHBondContact O-CD 3.26Å; P55-R59 WeakPolarHBondContact O-CB 3.43Å; P55-R59 VanDerWaalsContact O-CG 3.3Å; P55-R59 WeakPolarHBondContact O-CG 3.31Å; P55-R59 PolarHBondContact O-N 3.35Å; P55-R59 PolarHBondContact O-NE 2.97Å
56	I	95.1	Very high	95.4	Very high	106 Å²	106	63.9 Å²	63.9	54%	0.544	33%	0.332	S	S	.	.	H	α-helix	trans	-77.1	-53.6	-178.9	-60.7	175.5	0	0	0	108.2	D54 A58 R59 E60	D54-I56 VanDerWaalsContact C-N 3.26Å; D54-I56 PolarHBondContact O-N 3.43Å; D54-I56 WeakPolarHBondContact OD1-CA 3.48Å; D54-I56 WeakPolarHBondContact OD1-CB 3.46Å; D54-I56 PolarHBondContact OD1-N 2.88Å; I56-A58 VanDerWaalsContact C-N 3.28Å; I56-A58 PolarHBondContact O-N 3.44Å; I56-R59 WeakPolarHBondContact O-CB 3.43Å; I56-R59 PolarHBondContact O-N 3.46Å; I56-E60 WeakPolarHBondContact O-CG 3.29Å; I56-E60 PolarHBondContact O-N 2.93Å
57	A	96.4	Very high	95.4	Very high	18 Å²	18	61.4 Å²	61.4	15%	0.149	32%	0.315	C	S	.	.	H	α-helix	trans	-58.1	-41.2	177.5	0	0	0	0	0	111.9	Y48 P51 D54 R59 E60 F61	Y48-A57 WeakPolarHBondContact OH-CB 3.39Å; P51-A57 HydrophobicContact CG-CB 3.97Å; D54-A57 HydrophobicContact CB-CB 3.96Å; D54-A57 PolarHBondContact OD1-N 3.22Å; D54-A57 VanDerWaalsContact OD1-N 3.07Å; A57-R59 PolarHBondContact O-N 3.31Å; A57-E60 PolarHBondContact O-N 2.97Å; A57-F61 WeakPolarHBondContact O-CB 3.41Å; A57-F61 PolarHBondContact O-N 2.95Å
58	A	96.3	Very high	95.4	Very high	0 Å²	0	59.6 Å²	59.6	0%	0	31%	0.309	C	S	.	.	H	α-helix	trans	-61.6	-41.6	175.8	0	0	0	0	0	112.8	I36 L41 D54 I56 I62	I36-A58 HydrophobicContact CD1-CB 3.79Å; I36-A58 HydrophobicContact CG1-CB 4.04Å; L41-A58 HydrophobicContact CD2-CB 3.97Å; D54-A58 VanDerWaalsContact O-CB 3.29Å; D54-A58 WeakPolarHBondContact O-CB 3.3Å; D54-A58 PolarHBondContact O-N 3.04Å; D54-A58 VanDerWaalsContact O-N 3.1Å; I56-A58 VanDerWaalsContact C-N 3.28Å; I56-A58 PolarHBondContact O-N 3.44Å; A58-I62 VanDerWaalsContact O-CG1 3.28Å; A58-I62 WeakPolarHBondContact O-CG1 3.45Å; A58-I62 PolarHBondContact O-N 2.88Å
59	R	95.4	Very high	95.4	Very high	38 Å²	38	60.7 Å²	60.7	14%	0.143	32%	0.316	C	S	.	.	H	α-helix	trans	-67	-44.2	178.3	-88.6	-177.4	-86.3	-161.4	-6.6	112.4	L32 E33 P55 I56 A57 I62 L63 F81	L32-R59 HydrophobicContact CD2-CB 4.48Å; L32-R59 HydrophobicContact CD2-CG 3.39Å; E33-R59 VanDerWaalsContact CD-NH2 3.26Å; E33-R59 IonicContact OE1-CZ 2.91Å; E33-R59 IonicContact OE1-NH1 3.04Å; E33-R59 PolarHBondContact OE1-NH1 3.26Å; E33-R59 IonicContact OE1-NH2 3.06Å; E33-R59 PolarHBondContact OE1-NH2 3.25Å; P55-R59 WeakPolarHBondContact O-CB 3.43Å; P55-R59 VanDerWaalsContact O-CG 3.3Å; P55-R59 WeakPolarHBondContact O-CG 3.31Å; P55-R59 PolarHBondContact O-N 3.35Å; P55-R59 PolarHBondContact O-NE 2.97Å; I56-R59 WeakPolarHBondContact O-CB 3.43Å; I56-R59 PolarHBondContact O-N 3.46Å; A57-R59 PolarHBondContact O-N 3.31Å; R59-I62 PolarHBondContact O-N 3.43Å; R59-L63 WeakPolarHBondContact O-CB 3.44Å; R59-L63 PolarHBondContact O-N 3.35Å; R59-F81 HydrophobicContact CB-CD1 4.11Å; R59-F81 HydrophobicContact CB-CE1 3.46Å; R59-F81 VanDerWaalsContact CB-CE1 3.46Å; R59-F81 HydrophobicContact CB-CE2 4.5Å; R59-F81 HydrophobicContact CB-CZ 3.7Å; R59-F81 HydrophobicContact CG-CD1 3.84Å; R59-F81 HydrophobicContact CG-CE1 3.67Å; R59-F81 HydrophobicContact CG-CZ 4.36Å; R59-F81 WeakPolarHBondContact O-CE1 3.29Å; R59-F81 WeakPolarHBondContact O-CZ 3.28Å
60	E	95.9	Very high	95.3	Very high	122 Å²	122	54.8 Å²	54.8	57%	0.57	28%	0.284	S	S	*	.	H	α-helix	trans	-64.2	-41.6	177.8	-70.5	-179.5	164.8	0	0	111.5	I56 A57 L63 K64	I56-E60 WeakPolarHBondContact O-CG 3.29Å; I56-E60 PolarHBondContact O-N 2.93Å; A57-E60 PolarHBondContact O-N 2.97Å; E60-L63 PolarHBondContact O-N 3.43Å; E60-K64 WeakPolarHBondContact O-CB 3.49Å; E60-K64 PolarHBondContact O-N 3.02Å
61	F	96.8	Very high	95.3	Very high	31 Å²	31	58.5 Å²	58.5	14%	0.136	31%	0.305	C	S	.	.	H	α-helix	trans	-59.9	-47.6	173.2	175.8	-99.1	0	0	0	112	L41 F45 E47 Y48 A57 L63 K64 M65	L41-F61 HydrophobicContact CD2-CD1 3.64Å; L41-F61 HydrophobicContact CD2-CE1 4.24Å; L41-F61 HydrophobicContact CD2-CG 4.39Å; L41-F61 HydrophobicContact CG-CD1 4.5Å; F45-F61 HydrophobicContact CB-CE1 3.71Å; F45-F61 HydrophobicContact CB-CZ 3.88Å; F45-F61 HydrophobicContact CD1-CE1 4.42Å; F45-F61 HydrophobicContact CD2-CE1 4.43Å; F45-F61 AromaticContact CG-CE1 3.94Å; F45-F61 HydrophobicContact CG-CE1 3.94Å; F45-F61 HydrophobicContact CG-CZ 4.48Å; E47-F61 HydrophobicContact CB-CE2 4.49Å; E47-F61 HydrophobicContact CB-CZ 4.45Å; Y48-F61 HydrophobicContact CD2-CB 3.63Å; Y48-F61 AromaticContact CD2-CD1 3.84Å; Y48-F61 HydrophobicContact CD2-CD1 3.84Å; Y48-F61 AromaticContact CD2-CD2 3.68Å; Y48-F61 HydrophobicContact CD2-CD2 3.68Å; Y48-F61 HydrophobicContact CD2-CE1 4.38Å; Y48-F61 HydrophobicContact CD2-CE2 4.24Å; Y48-F61 AromaticContact CD2-CG 3.44Å; Y48-F61 HydrophobicContact CD2-CG 3.44Å; Y48-F61 VanDerWaalsContact CD2-CG 3.44Å; Y48-F61 HydrophobicContact CE2-CB 3.79Å; Y48-F61 HydrophobicContact CE2-CG 4.13Å; Y48-F61 HydrophobicContact CG-CD2 4.5Å; Y48-F61 HydrophobicContact CG-CG 4.4Å; A57-F61 WeakPolarHBondContact O-CB 3.41Å; A57-F61 PolarHBondContact O-N 2.95Å; F61-L63 VanDerWaalsContact C-N 3.32Å; F61-L63 PolarHBondContact O-N 3.44Å; F61-K64 WeakPolarHBondContact O-CB 3.12Å; F61-K64 PolarHBondContact O-N 3.49Å; F61-M65 HydrophobicContact CD1-CE 4.08Å; F61-M65 HydrophobicContact CD1-CG 4.27Å; F61-M65 HydrophobicContact CD1-SD 4.26Å; F61-M65 HydrophobicContact CE1-CE 3.85Å; F61-M65 HydrophobicContact CE1-CG 3.9Å; F61-M65 HydrophobicContact CE1-SD 3.56Å; F61-M65 VanDerWaalsContact CE1-SD 3.56Å; F61-M65 HydrophobicContact CZ-CG 4.08Å; F61-M65 HydrophobicContact CZ-SD 4.01Å; F61-M65 WeakPolarHBondContact O-CG 3.4Å; F61-M65 PolarHBondContact O-N 2.86Å
62	I	96.4	Very high	95	Very high	11 Å²	11	58.1 Å²	58.1	6%	0.056	30%	0.299	C	S	.	.	H	α-helix	trans	-60	-45.4	177.1	-70.8	165.1	0	0	0	110.6	M1 L26 L32 A58 R59 K64 M65 F66	M1-I62 HydrophobicContact CE-CB 4.41Å; M1-I62 HydrophobicContact CE-CD1 3.77Å; M1-I62 HydrophobicContact CE-CG1 3.93Å; M1-I62 HydrophobicContact CE-CG2 3.56Å; M1-I62 HydrophobicContact SD-CG2 4.44Å; L26-I62 HydrophobicContact CD1-CG2 4.41Å; L26-I62 HydrophobicContact CD2-CG2 4.05Å; L32-I62 HydrophobicContact CD1-CD1 4.11Å; L32-I62 HydrophobicContact CD2-CD1 3.77Å; A58-I62 VanDerWaalsContact O-CG1 3.28Å; A58-I62 WeakPolarHBondContact O-CG1 3.45Å; A58-I62 PolarHBondContact O-N 2.88Å; R59-I62 PolarHBondContact O-N 3.43Å; I62-K64 VanDerWaalsContact C-N 3.32Å; I62-K64 PolarHBondContact O-N 3.05Å; I62-M65 HydrophobicContact CB-CE 4.15Å; I62-M65 HydrophobicContact CG1-CE 3.78Å; I62-M65 HydrophobicContact CG2-CE 4.39Å; I62-M65 WeakPolarHBondContact O-CB 3.39Å; I62-M65 PolarHBondContact O-N 2.92Å; I62-F66 HydrophobicContact CG2-CD2 4.39Å; I62-F66 HydrophobicContact CG2-CE2 4.23Å; I62-F66 WeakPolarHBondContact O-CD2 3.4Å; I62-F66 PolarHBondContact O-N 3.39Å
63	L	96.4	Very high	94.6	Very high	33 Å²	33	58.7 Å²	58.7	17%	0.173	31%	0.312	C	S	.	.	H	α-helix	trans	-57.4	-47.8	176.3	173.7	58.4	0	0	0	111.6	L24 L26 R59 E60 F61 M65 F66 V67 F81	L24-L63 HydrophobicContact CD2-CD1 4.14Å; L26-L63 HydrophobicContact CD1-CB 3.72Å; L26-L63 HydrophobicContact CD1-CD1 3.89Å; L26-L63 HydrophobicContact CD1-CG 4.38Å; R59-L63 WeakPolarHBondContact O-CB 3.44Å; R59-L63 PolarHBondContact O-N 3.35Å; E60-L63 PolarHBondContact O-N 3.43Å; F61-L63 VanDerWaalsContact C-N 3.32Å; F61-L63 PolarHBondContact O-N 3.44Å; L63-M65 VanDerWaalsContact C-N 3.3Å; L63-M65 PolarHBondContact O-N 3.34Å; L63-F66 PolarHBondContact O-N 3.24Å; L63-V67 HydrophobicContact CD1-CG2 3.75Å; L63-V67 HydrophobicContact CG-CG2 4.19Å; L63-V67 WeakPolarHBondContact O-CG2 3.4Å; L63-V67 PolarHBondContact O-N 2.84Å; L63-F81 HydrophobicContact CB-CZ 3.98Å; L63-F81 HydrophobicContact CD2-CE2 4.36Å; L63-F81 HydrophobicContact CD2-CZ 4.17Å
64	K	95.9	Very high	94.2	Very high	116 Å²	116	57.6 Å²	57.6	50%	0.504	32%	0.317	S	S	.	.	H	α-helix	trans	-56.8	-43	177.6	179.8	167.3	174.7	49.8	0	112	E60 F61 I62 F66 V67 D68	E60-K64 WeakPolarHBondContact O-CB 3.49Å; E60-K64 PolarHBondContact O-N 3.02Å; F61-K64 WeakPolarHBondContact O-CB 3.12Å; F61-K64 PolarHBondContact O-N 3.49Å; I62-K64 VanDerWaalsContact C-N 3.32Å; I62-K64 PolarHBondContact O-N 3.05Å; K64-F66 PolarHBondContact O-N 2.93Å; K64-F66 VanDerWaalsContact O-N 3.14Å; K64-V67 PolarHBondContact O-N 3.26Å; K64-D68 WeakPolarHBondContact CE-OD2 3.34Å; K64-D68 VanDerWaalsContact CG-OD2 3.23Å; K64-D68 WeakPolarHBondContact CG-OD2 3.46Å; K64-D68 IonicContact NZ-OD1 2.91Å; K64-D68 PolarHBondContact NZ-OD1 2.89Å; K64-D68 IonicContact NZ-OD2 2.68Å; K64-D68 PolarHBondContact NZ-OD2 3.47Å; K64-D68 VanDerWaalsContact O-CB 3.29Å; K64-D68 WeakPolarHBondContact O-CB 3.44Å; K64-D68 PolarHBondContact O-N 3.02Å
65	M	95.9	Very high	93.7	Very high	24 Å²	24	56 Å²	56	12%	0.118	31%	0.308	C	S	.	.	H	α-helix	trans	-56.6	-30.4	176.2	-69.9	-164.8	-69.7	0	0	113.9	M1 K5 F45 F61 I62 L63 L69	M1-M65 HydrophobicContact SD-CE 4.41Å; K5-M65 HydrophobicContact CD-SD 4.45Å; F45-M65 HydrophobicContact CD1-CE 4.33Å; F45-M65 HydrophobicContact CD1-SD 3.78Å; F45-M65 HydrophobicContact CE1-CE 4.08Å; F45-M65 HydrophobicContact CE1-SD 3.88Å; F45-M65 HydrophobicContact CG-SD 4.43Å; F45-M65 HydrophobicContact CZ-CE 4.23Å; F61-M65 HydrophobicContact CD1-CE 4.08Å; F61-M65 HydrophobicContact CD1-CG 4.27Å; F61-M65 HydrophobicContact CD1-SD 4.26Å; F61-M65 HydrophobicContact CE1-CE 3.85Å; F61-M65 HydrophobicContact CE1-CG 3.9Å; F61-M65 HydrophobicContact CE1-SD 3.56Å; F61-M65 VanDerWaalsContact CE1-SD 3.56Å; F61-M65 HydrophobicContact CZ-CG 4.08Å; F61-M65 HydrophobicContact CZ-SD 4.01Å; F61-M65 WeakPolarHBondContact O-CG 3.4Å; F61-M65 PolarHBondContact O-N 2.86Å; I62-M65 HydrophobicContact CB-CE 4.15Å; I62-M65 HydrophobicContact CG1-CE 3.78Å; I62-M65 HydrophobicContact CG2-CE 4.39Å; I62-M65 WeakPolarHBondContact O-CB 3.39Å; I62-M65 PolarHBondContact O-N 2.92Å; L63-M65 VanDerWaalsContact C-N 3.3Å; L63-M65 PolarHBondContact O-N 3.34Å; M65-L69 WeakPolarHBondContact O-CG 3.47Å
66	F	96.3	Very high	93.3	Very high	12 Å²	12	57.9 Å²	57.9	5%	0.053	32%	0.316	C	S	.	.	H	α-helix	trans	-87.3	-43.2	177	-78.4	-93.6	0	0	0	112	M1 K5 F8 L24 L26 I62 L63 K64 D68 L69	M1-F66 HydrophobicContact SD-CE2 4.01Å; M1-F66 HydrophobicContact SD-CZ 4.36Å; K5-F66 HydrophobicContact CG-CE1 4.33Å; K5-F66 HydrophobicContact CG-CE2 4.39Å; K5-F66 HydrophobicContact CG-CZ 4.14Å; F8-F66 HydrophobicContact CB-CD1 3.8Å; F8-F66 HydrophobicContact CB-CE1 3.93Å; F8-F66 HydrophobicContact CD1-CB 4.41Å; F8-F66 AromaticContact CD1-CD1 3.86Å; F8-F66 HydrophobicContact CD1-CD1 3.86Å; F8-F66 HydrophobicContact CD2-CD1 4.22Å; F8-F66 HydrophobicContact CE1-CB 4.35Å; F8-F66 WeakPolarHBondContact CE1-O 3.28Å; F8-F66 AromaticContact CG-CD1 3.68Å; F8-F66 HydrophobicContact CG-CD1 3.68Å; F8-F66 HydrophobicContact CG-CE1 4.3Å; L24-F66 HydrophobicContact CD1-CD1 4.23Å; L24-F66 HydrophobicContact CD2-CB 3.54Å; L24-F66 HydrophobicContact CD2-CD1 4.49Å; L24-F66 HydrophobicContact CD2-CG 4.07Å; L26-F66 HydrophobicContact CD2-CD2 4.12Å; L26-F66 HydrophobicContact CD2-CE2 4.22Å; I62-F66 HydrophobicContact CG2-CD2 4.39Å; I62-F66 HydrophobicContact CG2-CE2 4.23Å; I62-F66 WeakPolarHBondContact O-CD2 3.4Å; I62-F66 PolarHBondContact O-N 3.39Å; L63-F66 PolarHBondContact O-N 3.24Å; K64-F66 PolarHBondContact O-N 2.93Å; K64-F66 VanDerWaalsContact O-N 3.14Å; F66-D68 VanDerWaalsContact C-N 3.3Å; F66-D68 PolarHBondContact O-N 3.32Å; F66-L69 WeakPolarHBondContact O-CB 3.43Å; F66-L69 PolarHBondContact O-N 2.94Å; F66-L69 VanDerWaalsContact O-N 3.11Å
67	V	94.6	Very high	93.1	Very high	57 Å²	57	54 Å²	54	35%	0.345	30%	0.295	S	S	.	.	H	α-helix	trans	-62.7	-39.1	180	173.8	0	0	0	0	111.2	L63 K64 L69 N70 I77	L63-V67 HydrophobicContact CD1-CG2 3.75Å; L63-V67 HydrophobicContact CG-CG2 4.19Å; L63-V67 WeakPolarHBondContact O-CG2 3.4Å; L63-V67 PolarHBondContact O-N 2.84Å; K64-V67 PolarHBondContact O-N 3.26Å; V67-L69 PolarHBondContact O-N 3.49Å; V67-L69 VanDerWaalsContact O-N 3.09Å; V67-N70 VanDerWaalsContact O-CB 3.25Å; V67-N70 WeakPolarHBondContact O-CB 3.34Å; V67-N70 PolarHBondContact O-N 2.92Å; V67-I77 HydrophobicContact CG2-CD1 4.46Å
68	D	94.9	Very high	92.8	Very high	102 Å²	102	55.3 Å²	55.3	55%	0.545	30%	0.297	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.6	-10.4	178.4	-69.3	-7.9	0	0	0	112.9	K64 F66 N70	K64-D68 WeakPolarHBondContact CE-OD2 3.34Å; K64-D68 VanDerWaalsContact CG-OD2 3.23Å; K64-D68 WeakPolarHBondContact CG-OD2 3.46Å; K64-D68 IonicContact NZ-OD1 2.91Å; K64-D68 PolarHBondContact NZ-OD1 2.89Å; K64-D68 IonicContact NZ-OD2 2.68Å; K64-D68 PolarHBondContact NZ-OD2 3.47Å; K64-D68 VanDerWaalsContact O-CB 3.29Å; K64-D68 WeakPolarHBondContact O-CB 3.44Å; K64-D68 PolarHBondContact O-N 3.02Å; F66-D68 VanDerWaalsContact C-N 3.3Å; F66-D68 PolarHBondContact O-N 3.32Å; D68-N70 VanDerWaalsContact C-N 3.32Å
69	L	95.1	Very high	92.6	Very high	40 Å²	40	57.6 Å²	57.6	21%	0.209	31%	0.313	C	S	.	.	T	Hydrogen-bonded Turn	trans	-82.2	-9	172.6	-63	171.8	0	0	0	113.2	K5 F8 R9 M65 F66 V67 P71	K5-L69 HydrophobicContact CB-CD1 3.9Å; K5-L69 HydrophobicContact CG-CD1 4.14Å; K5-L69 WeakPolarHBondContact O-CD1 3.49Å; F8-L69 HydrophobicContact CD1-CB 4.19Å; F8-L69 HydrophobicContact CD1-CD1 4.09Å; F8-L69 HydrophobicContact CE1-CB 4.45Å; R9-L69 HydrophobicContact CB-CD1 4.44Å; M65-L69 WeakPolarHBondContact O-CG 3.47Å; F66-L69 WeakPolarHBondContact O-CB 3.43Å; F66-L69 PolarHBondContact O-N 2.94Å; F66-L69 VanDerWaalsContact O-N 3.11Å; V67-L69 PolarHBondContact O-N 3.49Å; V67-L69 VanDerWaalsContact O-N 3.09Å; L69-P71 VanDerWaalsContact O-CD 3.27Å; L69-P71 WeakPolarHBondContact O-CD 3.44Å
70	N	94.2	Very high	92.4	Very high	33 Å²	33	57.5 Å²	57.5	18%	0.176	31%	0.314	C	S	.	.			trans	-78.6	113.9	178.3	-174	19.5	0	0	0	110.9	I12 V67 D68 D72 K75 I77	I12-N70 HydrophobicContact CD1-CB 3.65Å; I12-N70 WeakPolarHBondContact CD1-OD1 3.32Å; V67-N70 VanDerWaalsContact O-CB 3.25Å; V67-N70 WeakPolarHBondContact O-CB 3.34Å; V67-N70 PolarHBondContact O-N 2.92Å; D68-N70 VanDerWaalsContact C-N 3.32Å; N70-D72 VanDerWaalsContact C-N 3.3Å; N70-D72 PolarHBondContact ND2-O 3.04Å; N70-D72 PolarHBondContact OD1-N 2.96Å; N70-D72 VanDerWaalsContact OD1-N 3.16Å; N70-D72 PolarHBondContact OD1-O 3.3Å; N70-K75 PolarHBondContact ND2-O 2.8Å; N70-I77 HydrophobicContact CB-CD1 3.77Å
71	P	92.1	Very high	92.1	Very high	100 Å²	100	54.1 Å²	54.1	65%	0.649	30%	0.297	S	S	*	.			trans	-80.4	-12.6	176.3	35.2	-37.2	0	0	0	113.2	T13 L69	T13-P71 HydrophobicContact CG2-CG 3.96Å; L69-P71 VanDerWaalsContact O-CD 3.27Å; L69-P71 WeakPolarHBondContact O-CD 3.44Å
72	D	90.1	Very high	91.8	Very high	55 Å²	55	52.8 Å²	52.8	29%	0.294	29%	0.292	S	S	.	.			trans	-106	105.3	-173.4	-176.9	-6.5	0	0	0	110.5	N70 D74 K75	N70-D72 VanDerWaalsContact C-N 3.3Å; N70-D72 PolarHBondContact ND2-O 3.04Å; N70-D72 PolarHBondContact OD1-N 2.96Å; N70-D72 VanDerWaalsContact OD1-N 3.16Å; N70-D72 PolarHBondContact OD1-O 3.3Å; D72-D74 PolarHBondContact O-N 3.45Å; D72-D74 WeakPolarHBondContact OD1-CB 3.41Å; D72-D74 PolarHBondContact OD1-N 3.43Å; D72-K75 HydrophobicContact CB-CB 3.84Å; D72-K75 PolarHBondContact O-N 3.1Å; D72-K75 VanDerWaalsContact O-N 3.16Å; D72-K75 PolarHBondContact OD1-N 3.44Å
73	A	84.9	Confident	91.3	Very high	101 Å²	101	53 Å²	53	84%	0.835	29%	0.294	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.4	-23.8	-179.2	0	0	0	0	0	113.4	K75	A73-K75 VanDerWaalsContact C-N 3.32Å
74	D	83.9	Confident	90.1	Very high	130 Å²	130	55.5 Å²	55.5	70%	0.695	32%	0.32	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.8	-14.9	178.9	-65	-33.1	0	0	0	111.9	D72 I76	D72-D74 PolarHBondContact O-N 3.45Å; D72-D74 WeakPolarHBondContact OD1-CB 3.41Å; D72-D74 PolarHBondContact OD1-N 3.43Å; D74-I76 PolarHBondContact O-N 2.89Å
75	K	86.9	Confident	89.1	Confident	17 Å²	17	55.7 Å²	55.7	7%	0.074	33%	0.331	C	S	.	.	S	Bend	trans	-84.8	109	178.4	-164.2	176.2	-148.8	174.4	0	111	I12 F17 S20 N70 D72 A73	I12-K75 HydrophobicContact CG1-CD 4.08Å; I12-K75 PolarHBondContact O-NZ 3.32Å; F17-K75 VanDerWaalsContact O-CE 3.24Å; F17-K75 WeakPolarHBondContact O-CE 3.02Å; F17-K75 PolarHBondContact O-NZ 3.07Å; S20-K75 VanDerWaalsContact O-CE 3.27Å; S20-K75 WeakPolarHBondContact O-CE 3.09Å; N70-K75 PolarHBondContact ND2-O 2.8Å; D72-K75 HydrophobicContact CB-CB 3.84Å; D72-K75 PolarHBondContact O-N 3.1Å; D72-K75 VanDerWaalsContact O-N 3.16Å; D72-K75 PolarHBondContact OD1-N 3.44Å; A73-K75 VanDerWaalsContact C-N 3.32Å
76	I	85.4	Confident	87.9	Confident	70 Å²	70	56.4 Å²	56.4	36%	0.359	34%	0.335	S	S	.	.			trans	-79.2	128.1	178.7	-60.8	175.2	0	0	0	110.3	D74 Y78	D74-I76 PolarHBondContact O-N 2.89Å; I76-Y78 HydrophobicContact CB-CE2 4.28Å; I76-Y78 HydrophobicContact CG2-CD1 4.46Å; I76-Y78 HydrophobicContact CG2-CD2 4.21Å; I76-Y78 HydrophobicContact CG2-CE1 4.11Å; I76-Y78 HydrophobicContact CG2-CE2 3.83Å
77	I	90.9	Very high	86.5	Confident	23 Å²	23	62 Å²	62	12%	0.118	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.3	115.2	169.8	-59	162.4	0	0	0	108.6	F8 I12 V22 L24 V67 N70 S79	F8-I77 HydrophobicContact CE1-CD1 4.29Å; F8-I77 HydrophobicContact CZ-CD1 3.91Å; F8-I77 HydrophobicContact CZ-CG1 4.44Å; F8-I77 HydrophobicContact CZ-CG2 4.48Å; I12-I77 HydrophobicContact CD1-CD1 3.57Å; I12-I77 HydrophobicContact CD1-CG1 3.86Å; V22-I77 HydrophobicContact CG1-CG2 4.37Å; L24-I77 HydrophobicContact CB-CG2 3.72Å; L24-I77 HydrophobicContact CD2-CG2 4.38Å; V67-I77 HydrophobicContact CG2-CD1 4.46Å; N70-I77 HydrophobicContact CB-CD1 3.77Å; I77-S79 PolarHBondContact O-N 2.82Å
78	Y	91	Very high	85.4	Confident	47 Å²	47	63.9 Å²	63.9	18%	0.184	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.5	102.6	173.5	-61.3	-89.8	0	0	0	109.3	V22 I23 L24 I76 A96 D99	V22-Y78 PolarHBondContact O-N 2.95Å; I23-Y78 CarbonylContact C-O 3.5Å; I23-Y78 VanDerWaalsContact CA-O 3.31Å; I23-Y78 WeakPolarHBondContact CA-O 3.24Å; L24-Y78 PolarHBondContact N-O 3.22Å; I76-Y78 HydrophobicContact CB-CE2 4.28Å; I76-Y78 HydrophobicContact CG2-CD1 4.46Å; I76-Y78 HydrophobicContact CG2-CD2 4.21Å; I76-Y78 HydrophobicContact CG2-CE1 4.11Å; I76-Y78 HydrophobicContact CG2-CE2 3.83Å; Y78-A96 HydrophobicContact CD1-CB 4.01Å; Y78-A96 HydrophobicContact CD2-CB 3.91Å; Y78-A96 HydrophobicContact CE1-CB 4.42Å; Y78-A96 HydrophobicContact CE2-CB 4.34Å; Y78-A96 HydrophobicContact CG-CB 3.74Å; Y78-D99 HydrophobicContact CE1-CB 4.25Å; Y78-D99 WeakPolarHBondContact OH-CB 3.29Å
79	S	91.8	Very high	84.3	Confident	48 Å²	48	61.2 Å²	61.2	34%	0.336	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.2	140.3	-178.6	58.3	0	0	0	0	113.2	L24 I77	L24-S79 CarbonylContact O-C 3.57Å; L24-S79 VanDerWaalsContact O-CA 3.32Å; L24-S79 WeakPolarHBondContact O-CA 3.38Å; I77-S79 PolarHBondContact O-N 2.82Å
80	H	90.1	Very high	83.3	Confident	35 Å²	35	64.4 Å²	64.4	16%	0.162	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.7	138.6	173.6	-164.9	53.7	0	0	0	112.7	L24 F25 L26 F92	L24-H80 PolarHBondContact O-N 3.42Å; F25-H80 WeakPolarHBondContact CA-O 3.46Å; F25-H80 HydrophobicContact CD1-CB 4.11Å; F25-H80 HydrophobicContact CE1-CB 4.18Å; L26-H80 PolarHBondContact N-O 2.91Å; H80-F92 AromaticContact CD2-CD2 3.56Å; H80-F92 AromaticContact CD2-CE2 3.72Å; H80-F92 AromaticContact CD2-CG 3.87Å; H80-F92 AromaticContact CE1-CD1 3.99Å; H80-F92 AromaticContact CE1-CD2 3.88Å; H80-F92 AromaticContact CE1-CE1 3.41Å; H80-F92 VanDerWaalsContact CE1-CE1 3.41Å; H80-F92 WeakPolarHBondContact CE1-CE1 3.29Å; H80-F92 AromaticContact CE1-CE2 3.29Å; H80-F92 WeakPolarHBondContact CE1-CE2 3.4Å; H80-F92 AromaticContact CE1-CZ 3.02Å; H80-F92 WeakPolarHBondContact CE1-CZ 3.35Å; H80-F92 AromaticContact CG-CD1 3.93Å; H80-F92 AromaticContact CG-CG 3.91Å; H80-F92 AromaticContact ND1-CD1 3.72Å; H80-F92 AromaticContact ND1-CE1 3.44Å; H80-F92 WeakPolarHBondContact ND1-CE1 3.41Å; H80-F92 AromaticContact ND1-CE2 3.97Å; H80-F92 AromaticContact ND1-CZ 3.59Å; H80-F92 AromaticContact NE2-CD2 3.47Å; H80-F92 WeakPolarHBondContact NE2-CD2 3.47Å; H80-F92 AromaticContact NE2-CE2 3.09Å; H80-F92 WeakPolarHBondContact NE2-CE2 3.3Å; H80-F92 AromaticContact NE2-CZ 3.41Å; H80-F92 WeakPolarHBondContact NE2-CZ 3.4Å
81	F	91.1	Very high	82.7	Confident	51 Å²	51	69.4 Å²	69.4	22%	0.224	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	116.8	176.5	-62.9	-80.5	0	0	0	110.4	L26 K29 R59 L63	L26-F81 HydrophobicContact CB-CD1 3.65Å; L26-F81 HydrophobicContact CB-CE1 3.97Å; L26-F81 HydrophobicContact CD1-CD1 3.88Å; L26-F81 HydrophobicContact CD1-CE1 3.31Å; L26-F81 HydrophobicContact CD1-CZ 3.86Å; L26-F81 HydrophobicContact CG-CD1 4.41Å; L26-F81 HydrophobicContact CG-CE1 4.28Å; L26-F81 WeakPolarHBondContact O-CA 3.25Å; K29-F81 HydrophobicContact CB-CB 4.42Å; K29-F81 HydrophobicContact CD-CB 4.24Å; K29-F81 PolarHBondContact NZ-O 3.05Å; R59-F81 HydrophobicContact CB-CD1 4.11Å; R59-F81 HydrophobicContact CB-CE1 3.46Å; R59-F81 VanDerWaalsContact CB-CE1 3.46Å; R59-F81 HydrophobicContact CB-CE2 4.5Å; R59-F81 HydrophobicContact CB-CZ 3.7Å; R59-F81 HydrophobicContact CG-CD1 3.84Å; R59-F81 HydrophobicContact CG-CE1 3.67Å; R59-F81 HydrophobicContact CG-CZ 4.36Å; R59-F81 WeakPolarHBondContact O-CE1 3.29Å; R59-F81 WeakPolarHBondContact O-CZ 3.28Å; L63-F81 HydrophobicContact CB-CZ 3.98Å; L63-F81 HydrophobicContact CD2-CE2 4.36Å; L63-F81 HydrophobicContact CD2-CZ 4.17Å
82	T	89.7	Confident	82	Confident	4 Å²	4	67.7 Å²	67.7	3%	0.025	38%	0.376	C	S	.	.			trans	-118.5	155.7	-173.2	58.7	0	0	0	0	111.9	F25 L26 N27 K28 K29 N89	F25-T82 HydrophobicContact CD1-CG2 3.57Å; F25-T82 HydrophobicContact CE1-CG2 4.14Å; F25-T82 HydrophobicContact CG-CG2 4.44Å; L26-T82 PolarHBondContact O-N 2.96Å; N27-T82 CarbonylContact C-O 3.44Å; N27-T82 WeakPolarHBondContact CA-O 3.43Å; N27-T82 WeakPolarHBondContact CA-OG1 3.27Å; N27-T82 PolarHBondContact OD1-O 2.72Å; N27-T82 PolarHBondContact OD1-OG1 3.05Å; K28-T82 PolarHBondContact N-O 3.31Å; K29-T82 PolarHBondContact N-O 3.31Å; K29-T82 VanDerWaalsContact N-O 3.07Å; T82-N89 WeakPolarHBondContact CG2-OD1 3.44Å
83	C	86.8	Confident	81.5	Confident	15 Å²	15	67.3 Å²	67.3	10%	0.101	38%	0.376	C	S	.	.			trans	-110.6	150.8	157.4	177.3	0	0	0	0	107.5	K29 D30 T85 D86	K29-C83 HydrophobicContact CG-CB 4.32Å; D30-C83 PolarHBondContact OD1-SG 2.66Å; D30-C83 VanDerWaalsContact OD1-SG 3.42Å; C83-T85 PolarHBondContact O-N 3.25Å; C83-T85 VanDerWaalsContact O-N 3.09Å; C83-T85 PolarHBondContact SG-OG1 2.8Å; C83-D86 HydrophobicContact CB-CB 4.3Å; C83-D86 WeakPolarHBondContact O-CB 3.49Å; C83-D86 PolarHBondContact O-N 2.88Å
84	A	70.6	Confident	81.4	Confident	86 Å²	86	69.2 Å²	69.2	71%	0.711	37%	0.365	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.9	-21	-179.5	0	0	0	0	0	113.2	N27	N27-A84 PolarHBondContact OD1-N 3.47Å
85	T	74.6	Confident	81.3	Confident	120 Å²	120	65.1 Å²	65.1	74%	0.736	35%	0.35	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.6	-3	174.7	56.5	0	0	0	0	113.5	C83 T87	C83-T85 PolarHBondContact O-N 3.25Å; C83-T85 VanDerWaalsContact O-N 3.09Å; C83-T85 PolarHBondContact SG-OG1 2.8Å; T85-T87 PolarHBondContact O-N 3.25Å
86	D	70.6	Confident	81.1	Confident	39 Å²	39	64.5 Å²	64.5	21%	0.209	35%	0.348	C	S	.	.			trans	-76.9	105.4	179.7	-157.5	-27.8	0	0	0	109.4	K29 C83 E88 N89	K29-D86 IonicContact NZ-OD2 2.66Å; K29-D86 PolarHBondContact NZ-OD2 3.28Å; C83-D86 HydrophobicContact CB-CB 4.3Å; C83-D86 WeakPolarHBondContact O-CB 3.49Å; C83-D86 PolarHBondContact O-N 2.88Å; D86-E88 VanDerWaalsContact C-N 3.29Å; D86-E88 PolarHBondContact OD1-N 3.31Å; D86-N89 PolarHBondContact O-ND2 2.98Å
87	T	67.8	Low	80.9	Confident	130 Å²	130	64.4 Å²	64.4	80%	0.798	35%	0.35	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.2	-4.4	-177.8	52.5	0	0	0	0	112.9	T85 N89	T85-T87 PolarHBondContact O-N 3.25Å; T87-N89 PolarHBondContact O-N 3.4Å
88	E	71.4	Confident	80.7	Confident	95 Å²	95	69.7 Å²	69.7	44%	0.444	37%	0.373	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.2	-0.1	-179.9	-68.7	-132.5	126.2	0	0	114.2	D86 I90 R91	D86-E88 VanDerWaalsContact C-N 3.29Å; D86-E88 PolarHBondContact OD1-N 3.31Å; E88-I90 PolarHBondContact O-N 3.49Å; E88-R91 VanDerWaalsContact CD-NH1 3.34Å; E88-R91 PolarHBondContact O-N 3.28Å; E88-R91 VanDerWaalsContact O-N 3.11Å; E88-R91 IonicContact OE1-CZ 2.86Å; E88-R91 IonicContact OE1-NH1 2.8Å; E88-R91 PolarHBondContact OE1-NH1 2.8Å; E88-R91 IonicContact OE2-CZ 3.26Å; E88-R91 IonicContact OE2-NH1 3.94Å; E88-R91 PolarHBondContact OE2-NH1 2.91Å; E88-R91 IonicContact OE2-NH2 3.18Å; E88-R91 PolarHBondContact OE2-NH2 3.06Å
89	N	70.4	Confident	80.3	Confident	47 Å²	47	70.1 Å²	70.1	25%	0.251	38%	0.378	S	S	.	.	H	α-helix	trans	-52.8	-34.7	-177.8	-65.9	-28.1	0	0	0	113.6	T82 D86 T87 R91 F92 V93	T82-N89 WeakPolarHBondContact CG2-OD1 3.44Å; D86-N89 PolarHBondContact O-ND2 2.98Å; T87-N89 PolarHBondContact O-N 3.4Å; N89-R91 VanDerWaalsContact C-N 3.29Å; N89-R91 PolarHBondContact O-N 3.33Å; N89-F92 PolarHBondContact O-N 3.27Å; N89-V93 PolarHBondContact O-N 3.39Å
90	I	75.4	Confident	79.7	Confident	106 Å²	106	69.7 Å²	69.7	54%	0.544	37%	0.374	S	S	.	.	H	α-helix	trans	-65.1	-32.5	-175.8	-158.2	63.5	0	0	0	112.4	E88 F92 V93 F94	E88-I90 PolarHBondContact O-N 3.49Å; I90-F92 VanDerWaalsContact C-N 3.3Å; I90-F92 PolarHBondContact O-N 3.21Å; I90-V93 PolarHBondContact O-N 3.39Å; I90-F94 HydrophobicContact CD1-CD2 4.43Å; I90-F94 HydrophobicContact CD1-CE2 4.16Å; I90-F94 HydrophobicContact CG1-CD2 3.83Å; I90-F94 HydrophobicContact CG1-CE2 3.68Å; I90-F94 VanDerWaalsContact O-CD2 3.29Å; I90-F94 WeakPolarHBondContact O-CD2 3.37Å; I90-F94 PolarHBondContact O-N 3.13Å
91	R	80.2	Confident	79.3	Confident	138 Å²	138	72.6 Å²	72.6	52%	0.521	39%	0.389	S	S	.	.	H	α-helix	trans	-63.4	-39.4	179.6	-170.5	175.8	71.5	-142.7	-8.7	111.2	E88 N89 F94 A95	E88-R91 VanDerWaalsContact CD-NH1 3.34Å; E88-R91 PolarHBondContact O-N 3.28Å; E88-R91 VanDerWaalsContact O-N 3.11Å; E88-R91 IonicContact OE1-CZ 2.86Å; E88-R91 IonicContact OE1-NH1 2.8Å; E88-R91 PolarHBondContact OE1-NH1 2.8Å; E88-R91 IonicContact OE2-CZ 3.26Å; E88-R91 IonicContact OE2-NH1 3.94Å; E88-R91 PolarHBondContact OE2-NH1 2.91Å; E88-R91 IonicContact OE2-NH2 3.18Å; E88-R91 PolarHBondContact OE2-NH2 3.06Å; N89-R91 VanDerWaalsContact C-N 3.29Å; N89-R91 PolarHBondContact O-N 3.33Å; R91-F94 PolarHBondContact O-N 3.19Å; R91-A95 PolarHBondContact O-N 3.37Å
92	F	78.3	Confident	79	Confident	64 Å²	64	74.7 Å²	74.7	28%	0.281	40%	0.402	S	S	.	.	H	α-helix	trans	-70.2	-41.1	178.1	-66.5	-82.4	0	0	0	112.1	H80 N89 I90 F94 A95 A96	H80-F92 AromaticContact CD2-CD2 3.56Å; H80-F92 AromaticContact CD2-CE2 3.72Å; H80-F92 AromaticContact CD2-CG 3.87Å; H80-F92 AromaticContact CE1-CD1 3.99Å; H80-F92 AromaticContact CE1-CD2 3.88Å; H80-F92 AromaticContact CE1-CE1 3.41Å; H80-F92 VanDerWaalsContact CE1-CE1 3.41Å; H80-F92 WeakPolarHBondContact CE1-CE1 3.29Å; H80-F92 AromaticContact CE1-CE2 3.29Å; H80-F92 WeakPolarHBondContact CE1-CE2 3.4Å; H80-F92 AromaticContact CE1-CZ 3.02Å; H80-F92 WeakPolarHBondContact CE1-CZ 3.35Å; H80-F92 AromaticContact CG-CD1 3.93Å; H80-F92 AromaticContact CG-CG 3.91Å; H80-F92 AromaticContact ND1-CD1 3.72Å; H80-F92 AromaticContact ND1-CE1 3.44Å; H80-F92 WeakPolarHBondContact ND1-CE1 3.41Å; H80-F92 AromaticContact ND1-CE2 3.97Å; H80-F92 AromaticContact ND1-CZ 3.59Å; H80-F92 AromaticContact NE2-CD2 3.47Å; H80-F92 WeakPolarHBondContact NE2-CD2 3.47Å; H80-F92 AromaticContact NE2-CE2 3.09Å; H80-F92 WeakPolarHBondContact NE2-CE2 3.3Å; H80-F92 AromaticContact NE2-CZ 3.41Å; H80-F92 WeakPolarHBondContact NE2-CZ 3.4Å; N89-F92 PolarHBondContact O-N 3.27Å; I90-F92 VanDerWaalsContact C-N 3.3Å; I90-F92 PolarHBondContact O-N 3.21Å; F92-F94 VanDerWaalsContact C-N 3.33Å; F92-F94 PolarHBondContact O-N 3.29Å; F92-A95 PolarHBondContact O-N 2.9Å; F92-A96 PolarHBondContact O-N 3.05Å
93	V	80.1	Confident	78.5	Confident	47 Å²	47	78.2 Å²	78.2	29%	0.285	42%	0.418	S	S	.	.	H	α-helix	trans	-58.5	-47.6	174.1	177.4	0	0	0	0	110.4	I23 F25 N89 I90 A95 A96 V97	I23-V93 HydrophobicContact CD1-CB 4.49Å; I23-V93 HydrophobicContact CD1-CG1 4.36Å; I23-V93 HydrophobicContact CD1-CG2 4.37Å; F25-V93 HydrophobicContact CE2-CG2 4.45Å; F25-V93 HydrophobicContact CZ-CG2 3.87Å; N89-V93 PolarHBondContact O-N 3.39Å; I90-V93 PolarHBondContact O-N 3.39Å; V93-A95 PolarHBondContact O-N 2.91Å; V93-A96 PolarHBondContact O-N 3.32Å; V93-V97 HydrophobicContact CG1-CG2 4.39Å; V93-V97 VanDerWaalsContact O-CG2 3.26Å; V93-V97 WeakPolarHBondContact O-CG2 3.43Å; V93-V97 PolarHBondContact O-N 2.97Å
94	F	82.4	Confident	78.1	Confident	141 Å²	141	83.1 Å²	83.1	62%	0.618	44%	0.44	S	S	*	.	H	α-helix	trans	-62.3	-40.2	177.4	-88.4	-72.1	0	0	0	113.1	I90 R91 F92 V97 K98	I90-F94 HydrophobicContact CD1-CD2 4.43Å; I90-F94 HydrophobicContact CD1-CE2 4.16Å; I90-F94 HydrophobicContact CG1-CD2 3.83Å; I90-F94 HydrophobicContact CG1-CE2 3.68Å; I90-F94 VanDerWaalsContact O-CD2 3.29Å; I90-F94 WeakPolarHBondContact O-CD2 3.37Å; I90-F94 PolarHBondContact O-N 3.13Å; R91-F94 PolarHBondContact O-N 3.19Å; F92-F94 VanDerWaalsContact C-N 3.33Å; F92-F94 PolarHBondContact O-N 3.29Å; F94-V97 PolarHBondContact O-N 2.87Å; F94-K98 WeakPolarHBondContact O-CB 3.05Å; F94-K98 PolarHBondContact O-N 2.68Å
95	A	81.3	Confident	78.6	Confident	45 Å²	45	82.1 Å²	82.1	37%	0.372	42%	0.422	S	S	.	.	H	α-helix	trans	-61.5	-48.3	176.2	0	0	0	0	0	111.7	R91 F92 V93 V97 K98 D99	R91-A95 PolarHBondContact O-N 3.37Å; F92-A95 PolarHBondContact O-N 2.9Å; V93-A95 PolarHBondContact O-N 2.91Å; A95-V97 VanDerWaalsContact C-N 3.34Å; A95-V97 PolarHBondContact O-N 2.66Å; A95-K98 PolarHBondContact O-N 3.42Å; A95-D99 PolarHBondContact O-N 2.91Å
96	A	83.4	Confident	78.9	Confident	3 Å²	3	79 Å²	79	3%	0.025	40%	0.401	C	S	.	.	H	α-helix	trans	-62.4	-40.5	178.1	0	0	0	0	0	112.1	I23 Y78 F92 V93 D99 T100	I23-A96 HydrophobicContact CD1-CB 3.63Å; I23-A96 HydrophobicContact CG1-CB 3.86Å; Y78-A96 HydrophobicContact CD1-CB 4.01Å; Y78-A96 HydrophobicContact CD2-CB 3.91Å; Y78-A96 HydrophobicContact CE1-CB 4.42Å; Y78-A96 HydrophobicContact CE2-CB 4.34Å; Y78-A96 HydrophobicContact CG-CB 3.74Å; F92-A96 PolarHBondContact O-N 3.05Å; V93-A96 PolarHBondContact O-N 3.32Å; A96-D99 PolarHBondContact O-N 3.32Å; A96-T100 WeakPolarHBondContact O-CB 3.41Å; A96-T100 PolarHBondContact O-N 3.11Å; A96-T100 PolarHBondContact O-OG1 3.45Å
97	V	81.9	Confident	79.3	Confident	68 Å²	68	83.1 Å²	83.1	41%	0.412	42%	0.417	S	S	.	.	H	α-helix	trans	-62.8	-46.2	175.6	170.4	0	0	0	0	111	V93 F94 A95 D99 T100 I101	V93-V97 HydrophobicContact CG1-CG2 4.39Å; V93-V97 VanDerWaalsContact O-CG2 3.26Å; V93-V97 WeakPolarHBondContact O-CG2 3.43Å; V93-V97 PolarHBondContact O-N 2.97Å; F94-V97 PolarHBondContact O-N 2.87Å; A95-V97 VanDerWaalsContact C-N 3.34Å; A95-V97 PolarHBondContact O-N 2.66Å; V97-D99 VanDerWaalsContact C-N 3.35Å; V97-D99 PolarHBondContact O-N 3.06Å; V97-T100 WeakPolarHBondContact O-CB 3.36Å; V97-T100 PolarHBondContact O-N 2.86Å; V97-I101 HydrophobicContact CG1-CD1 3.83Å; V97-I101 WeakPolarHBondContact O-CG1 3.39Å; V97-I101 PolarHBondContact O-N 3.22Å
98	K	85.8	Confident	80	Confident	135 Å²	135	82.8 Å²	82.8	59%	0.587	41%	0.406	S	S	*	.	H	α-helix	trans	-58.6	-47.3	178.4	-172.1	-161.9	72.4	176.7	0	111.2	F94 A95 T100 I101 L102	F94-K98 WeakPolarHBondContact O-CB 3.05Å; F94-K98 PolarHBondContact O-N 2.68Å; A95-K98 PolarHBondContact O-N 3.42Å; K98-T100 VanDerWaalsContact C-N 3.34Å; K98-I101 PolarHBondContact O-N 2.93Å; K98-L102 WeakPolarHBondContact O-CB 3.18Å; K98-L102 PolarHBondContact O-N 3.12Å
99	D	82.2	Confident	80.5	Confident	55 Å²	55	86.1 Å²	86.1	29%	0.294	42%	0.416	S	S	.	.	H	α-helix	trans	-67.8	-36.6	-178.9	-69.6	-3.3	0	0	0	111.6	Y78 A95 A96 V97 L102 Q103	Y78-D99 HydrophobicContact CE1-CB 4.25Å; Y78-D99 WeakPolarHBondContact OH-CB 3.29Å; A95-D99 PolarHBondContact O-N 2.91Å; A96-D99 PolarHBondContact O-N 3.32Å; V97-D99 VanDerWaalsContact C-N 3.35Å; V97-D99 PolarHBondContact O-N 3.06Å; D99-L102 PolarHBondContact O-N 3.32Å; D99-Q103 WeakPolarHBondContact O-CB 3.5Å; D99-Q103 WeakPolarHBondContact O-CG 3.5Å; D99-Q103 PolarHBondContact O-N 3.33Å
100	T	79.3	Confident	80.7	Confident	40 Å²	40	91 Å²	91	25%	0.245	44%	0.442	C	S	.	.	H	α-helix	trans	-60.4	-48.9	173.7	-57.1	0	0	0	0	111.9	S21 A96 V97 K98 L102 Q103 H104	S21-T100 VanDerWaalsContact CB-OG1 3.28Å; S21-T100 WeakPolarHBondContact CB-OG1 3.39Å; S21-T100 WeakPolarHBondContact OG-CB 3.46Å; S21-T100 WeakPolarHBondContact OG-CG2 3.27Å; S21-T100 PolarHBondContact OG-OG1 2.93Å; A96-T100 WeakPolarHBondContact O-CB 3.41Å; A96-T100 PolarHBondContact O-N 3.11Å; A96-T100 PolarHBondContact O-OG1 3.45Å; V97-T100 WeakPolarHBondContact O-CB 3.36Å; V97-T100 PolarHBondContact O-N 2.86Å; K98-T100 VanDerWaalsContact C-N 3.34Å; T100-L102 VanDerWaalsContact C-N 3.32Å; T100-L102 PolarHBondContact O-N 3.45Å; T100-Q103 PolarHBondContact O-N 2.97Å; T100-H104 WeakPolarHBondContact O-CB 3.48Å; T100-H104 PolarHBondContact O-N 3.28Å
101	I	82.7	Confident	80.4	Confident	96 Å²	96	91.8 Å²	91.8	49%	0.492	45%	0.447	S	S	.	.	H	α-helix	trans	-62.5	-43.8	178.4	-67.5	167.9	0	0	0	109.7	V97 K98 H104 N105	V97-I101 HydrophobicContact CG1-CD1 3.83Å; V97-I101 WeakPolarHBondContact O-CG1 3.39Å; V97-I101 PolarHBondContact O-N 3.22Å; K98-I101 PolarHBondContact O-N 2.93Å; I101-H104 PolarHBondContact O-N 2.97Å; I101-N105 WeakPolarHBondContact CG2-ND2 3.27Å; I101-N105 PolarHBondContact O-N 3.4Å; I101-N105 PolarHBondContact O-ND2 3.43Å
102	L	84	Confident	79.3	Confident	95 Å²	95	92.4 Å²	92.4	50%	0.497	47%	0.465	S	S	.	.	H	α-helix	trans	-62.6	-47.7	179.1	-177.7	63.2	0	0	0	111.7	K98 D99 T100 H104 N105 L106	K98-L102 WeakPolarHBondContact O-CB 3.18Å; K98-L102 PolarHBondContact O-N 3.12Å; D99-L102 PolarHBondContact O-N 3.32Å; T100-L102 VanDerWaalsContact C-N 3.32Å; T100-L102 PolarHBondContact O-N 3.45Å; L102-H104 VanDerWaalsContact C-N 3.32Å; L102-H104 PolarHBondContact O-N 3Å; L102-N105 PolarHBondContact O-N 3.46Å; L102-L106 HydrophobicContact CD1-CD1 4.31Å; L102-L106 HydrophobicContact CD1-CG 4.33Å; L102-L106 HydrophobicContact CG-CD1 4Å; L102-L106 HydrophobicContact CG-CG 4.44Å; L102-L106 WeakPolarHBondContact O-CB 3.11Å; L102-L106 VanDerWaalsContact O-CG 3.28Å; L102-L106 WeakPolarHBondContact O-CG 3.18Å; L102-L106 PolarHBondContact O-N 3.08Å
103	Q	78.7	Confident	79.3	Confident	78 Å²	78	93.8 Å²	93.8	36%	0.364	48%	0.475	S	S	.	.	H	α-helix	trans	-62.6	-39.1	177.5	-76.2	-170.4	-19.7	0	0	112.5	D99 T100 L106 K107	D99-Q103 WeakPolarHBondContact O-CB 3.5Å; D99-Q103 WeakPolarHBondContact O-CG 3.5Å; D99-Q103 PolarHBondContact O-N 3.33Å; T100-Q103 PolarHBondContact O-N 2.97Å; Q103-L106 PolarHBondContact O-N 3.41Å; Q103-K107 WeakPolarHBondContact O-CG 3.49Å; Q103-K107 PolarHBondContact O-N 3.07Å
104	H	79.1	Confident	79.3	Confident	118 Å²	118	96.3 Å²	96.3	55%	0.546	49%	0.485	S	S	.	.	H	α-helix	trans	-60.9	-49.1	175.5	-170.3	74.4	0	0	0	111.4	T100 I101 L102 L106 K107 E108	T100-H104 WeakPolarHBondContact O-CB 3.48Å; T100-H104 PolarHBondContact O-N 3.28Å; I101-H104 PolarHBondContact O-N 2.97Å; L102-H104 VanDerWaalsContact C-N 3.32Å; L102-H104 PolarHBondContact O-N 3Å; H104-L106 PolarHBondContact O-N 3.2Å; H104-K107 PolarHBondContact O-N 3.07Å; H104-E108 IonicContact CD2-OE2 3.87Å; H104-E108 IonicContact NE2-OE2 3.98Å; H104-E108 PolarHBondContact O-N 3.47Å
105	N	80.4	Confident	79.1	Confident	64 Å²	64	93.8 Å²	93.8	34%	0.342	48%	0.477	S	S	.	.	H	α-helix	trans	-60.7	-46.4	176.8	-78	-73.8	0	0	0	111.4	I101 L102 K107 E108 Y109	I101-N105 WeakPolarHBondContact CG2-ND2 3.27Å; I101-N105 PolarHBondContact O-N 3.4Å; I101-N105 PolarHBondContact O-ND2 3.43Å; L102-N105 PolarHBondContact O-N 3.46Å; N105-K107 VanDerWaalsContact C-N 3.31Å; N105-K107 PolarHBondContact O-N 3.27Å; N105-E108 PolarHBondContact O-N 3.42Å; N105-Y109 WeakPolarHBondContact O-CD2 3.31Å; N105-Y109 PolarHBondContact O-N 3.42Å
106	L	81.6	Confident	79	Confident	55 Å²	55	96.6 Å²	96.6	29%	0.288	48%	0.483	S	S	.	.	H	α-helix	trans	-61.1	-39.4	-178.8	-71.4	171.1	0	0	0	112.5	L102 Q103 H104 Y109 N110 L111 V112	L102-L106 HydrophobicContact CD1-CD1 4.31Å; L102-L106 HydrophobicContact CD1-CG 4.33Å; L102-L106 HydrophobicContact CG-CD1 4Å; L102-L106 HydrophobicContact CG-CG 4.44Å; L102-L106 WeakPolarHBondContact O-CB 3.11Å; L102-L106 VanDerWaalsContact O-CG 3.28Å; L102-L106 WeakPolarHBondContact O-CG 3.18Å; L102-L106 PolarHBondContact O-N 3.08Å; Q103-L106 PolarHBondContact O-N 3.41Å; H104-L106 PolarHBondContact O-N 3.2Å; L106-Y109 PolarHBondContact O-N 3.28Å; L106-N110 PolarHBondContact O-N 3.09Å; L106-L111 HydrophobicContact CD2-CB 3.9Å; L106-L111 HydrophobicContact CD2-CD1 3.97Å; L106-L111 PolarHBondContact O-N 2.88Å; L106-V112 HydrophobicContact CB-CG2 3.51Å; L106-V112 HydrophobicContact CD1-CG2 4.13Å; L106-V112 HydrophobicContact CG-CG2 4.33Å
107	K	79.2	Confident	78.7	Confident	125 Å²	125	102.5 Å²	102.5	54%	0.543	51%	0.512	S	S	.	.	H	α-helix	trans	-66.6	-41.8	173.9	-75.2	-175.5	177.7	-174.9	0	112.2	Q103 H104 N105 Y109 N110	Q103-K107 WeakPolarHBondContact O-CG 3.49Å; Q103-K107 PolarHBondContact O-N 3.07Å; H104-K107 PolarHBondContact O-N 3.07Å; N105-K107 VanDerWaalsContact C-N 3.31Å; N105-K107 PolarHBondContact O-N 3.27Å; K107-Y109 VanDerWaalsContact C-N 3.26Å; K107-Y109 PolarHBondContact O-N 3.03Å; K107-N110 PolarHBondContact O-N 3.24Å
108	E	82.3	Confident	78.5	Confident	124 Å²	124	104.8 Å²	104.8	58%	0.579	52%	0.519	S	S	*	.	H	α-helix	trans	-60.3	-35.5	176.4	-87.6	-167.2	123.3	0	0	112.8	H104 N105	H104-E108 IonicContact CD2-OE2 3.87Å; H104-E108 IonicContact NE2-OE2 3.98Å; H104-E108 PolarHBondContact O-N 3.47Å; N105-E108 PolarHBondContact O-N 3.42Å
109	Y	82.3	Confident	78	Confident	164 Å²	164	102.6 Å²	102.6	64%	0.643	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.7	10	-179.2	-66.5	-71.3	0	0	0	114.2	N105 L106 K107 L111	N105-Y109 WeakPolarHBondContact O-CD2 3.31Å; N105-Y109 PolarHBondContact O-N 3.42Å; L106-Y109 PolarHBondContact O-N 3.28Å; K107-Y109 VanDerWaalsContact C-N 3.26Å; K107-Y109 PolarHBondContact O-N 3.03Å; Y109-L111 PolarHBondContact O-N 3.24Å
110	N	73.3	Confident	77.6	Confident	149 Å²	149	106.3 Å²	106.3	80%	0.797	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.9	33.6	-176.9	-63.2	-51.6	0	0	0	113.8	L106 K107 V112	L106-N110 PolarHBondContact O-N 3.09Å; K107-N110 PolarHBondContact O-N 3.24Å; N110-V112 VanDerWaalsContact C-N 3.34Å
111	L	70.5	Confident	77.5	Confident	123 Å²	123	111.8 Å²	111.8	64%	0.644	55%	0.554	S	S	*	*			trans	-87.4	-10.7	177.3	-68.6	168.5	0	0	0	112.1	L106 Y109	L106-L111 HydrophobicContact CD2-CB 3.9Å; L106-L111 HydrophobicContact CD2-CD1 3.97Å; L106-L111 PolarHBondContact O-N 2.88Å; Y109-L111 PolarHBondContact O-N 3.24Å
112	V	56	Low	77	Confident	151 Å²	151	113.3 Å²	113.3	92%	0.915	56%	0.56	S	S	*	*			trans	-158.8	0	169	-101.9	0	0	0	0	109.8	L106 N110	L106-V112 HydrophobicContact CB-CG2 3.51Å; L106-V112 HydrophobicContact CD1-CG2 4.13Å; L106-V112 HydrophobicContact CG-CG2 4.33Å; N110-V112 VanDerWaalsContact C-N 3.34Å

Retrieved 112 of 112 residues in 37.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).