X5LV29_CAEEL Loading...

Secreted protein

AlphaFold DB , UniProt , Accession X5LV29, Species CAEEL (Caenorhabditis elegans), Gene n/a, Length 123 aa.

						>X5LV29_CAEEL|X5LV29
MKISSHLNNNSTNRLHSSLAQIFMQPINVMLAVLLALASFAQGGRSVAPAGAVTEPTVTQAVPEGSGLSSDVTDRPNIDSTDVVSNATSVEDLLGSSTNANNTGTFNSRTFVIAPMMILALVQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.2	Very low	52.1	Low	226 Å²	226	145.1 Å²	145.1	100%	1.113	77%	0.773	S	S	*	*				0	102.5	0	-162.8	170.6	-152.7	0	0	107.6	I3	M1-I3 HydrophobicContact CE-CD1 4.09Å; M1-I3 HydrophobicContact CG-CD1 3.99Å; M1-I3 HydrophobicContact CG-CG1 4.38Å; M1-I3 HydrophobicContact SD-CD1 4.38Å
2	K	47.8	Very low	51.9	Low	213 Å²	213	138.3 Å²	138.3	93%	0.926	74%	0.742	S	S	*	*			trans	-108.7	101.8	175.2	-85.4	175.6	174.5	173.3	0	106.3
3	I	56.3	Low	51.9	Low	147 Å²	147	137.2 Å²	137.2	75%	0.754	74%	0.736	S	S	*	*			trans	-100.8	111.1	172.7	-68.5	157.5	0	0	0	105.9	M1	M1-I3 HydrophobicContact CE-CD1 4.09Å; M1-I3 HydrophobicContact CG-CD1 3.99Å; M1-I3 HydrophobicContact CG-CG1 4.38Å; M1-I3 HydrophobicContact SD-CD1 4.38Å
4	S	50.2	Low	51.8	Low	84 Å²	84	141 Å²	141	59%	0.587	73%	0.734	S	S	*	*			trans	-55.1	137.3	-170.5	-55.3	0	0	0	0	113.2	H6	S4-H6 VanDerWaalsContact C-N 3.34Å; S4-H6 PolarHBondContact O-N 2.92Å
5	S	54	Low	51.8	Low	117 Å²	117	139.8 Å²	139.8	82%	0.818	73%	0.728	S	S	*	*			trans	-56.3	88.8	163.4	49.2	0	0	0	0	111
6	H	55	Low	51.7	Low	179 Å²	179	139.8 Å²	139.8	83%	0.829	72%	0.723	S	S	*	*			trans	-111.3	22.5	170.7	-96.7	-72.1	0	0	0	112.8	S4	S4-H6 VanDerWaalsContact C-N 3.34Å; S4-H6 PolarHBondContact O-N 2.92Å
7	L	55.3	Low	51.7	Low	162 Å²	162	135.7 Å²	135.7	85%	0.848	71%	0.709	S	S	*	*			trans	-103.7	147.7	167.8	-67.6	154.9	0	0	0	106.9
8	N	52.3	Low	51.8	Low	120 Å²	120	131.3 Å²	131.3	64%	0.642	69%	0.692	S	S	*	*	S	Bend	trans	85.6	64.6	160.5	-165.6	26.7	0	0	0	118
9	N	53.9	Low	51.6	Low	143 Å²	143	129.8 Å²	129.8	77%	0.765	68%	0.684	S	S	*	*	S	Bend	trans	-149.9	-13.1	147.7	-95.4	-17	0	0	0	114.1
10	N	54	Low	51.5	Low	127 Å²	127	126.2 Å²	126.2	68%	0.679	67%	0.674	S	S	*	*	S	Bend	trans	-89.3	-20.4	178.1	-160	2.5	0	0	0	113.6
11	S	48.6	Very low	51.5	Low	78 Å²	78	125.9 Å²	125.9	55%	0.545	67%	0.668	S	S	.	*	H	α-helix	trans	-79	-31	-176	-53.9	0	0	0	0	113.4	R14 L15	S11-R14 PolarHBondContact O-N 3.3Å; S11-L15 WeakPolarHBondContact O-CG 3.43Å; S11-L15 PolarHBondContact O-N 3.4Å
12	T	50.7	Low	51.7	Low	64 Å²	64	119.6 Å²	119.6	39%	0.393	64%	0.638	S	S	.	*	H	α-helix	trans	-70.6	-37.1	-173.2	-23.3	0	0	0	0	112.5	H16	T12-H16 PolarHBondContact O-N 3.12Å
13	N	51.1	Low	51.9	Low	124 Å²	124	116.3 Å²	116.3	66%	0.663	62%	0.624	S	S	*	*	H	α-helix	trans	-72.2	-30.8	177.2	-80.2	-21	0	0	0	113.2	S17	N13-S17 WeakPolarHBondContact O-CB 3.48Å; N13-S17 PolarHBondContact O-N 3.4Å; N13-S17 VanDerWaalsContact O-N 3.12Å
14	R	50.9	Low	51.6	Low	190 Å²	190	114.7 Å²	114.7	72%	0.717	62%	0.615	S	S	*	*	H	α-helix	trans	-73.2	-34.9	178.9	-61.6	-173	99.4	-153.4	5.2	111.9	S11 S18	S11-R14 PolarHBondContact O-N 3.3Å; R14-S18 WeakPolarHBondContact O-CB 3.39Å; R14-S18 PolarHBondContact O-N 3.16Å; R14-S18 VanDerWaalsContact O-N 3.09Å
15	L	51.4	Low	51.5	Low	123 Å²	123	116.3 Å²	116.3	64%	0.644	61%	0.613	S	S	*	*	H	α-helix	trans	-71	-39.2	176.6	-66	173.9	0	0	0	112.1	S11 S18 L19	S11-L15 WeakPolarHBondContact O-CG 3.43Å; S11-L15 PolarHBondContact O-N 3.4Å; L15-S18 PolarHBondContact O-N 3.09Å; L15-L19 PolarHBondContact O-N 3.29Å; L15-L19 VanDerWaalsContact O-N 3.16Å
16	H	50.5	Low	51.6	Low	140 Å²	140	114.5 Å²	114.5	65%	0.648	60%	0.599	S	S	*	*	H	α-helix	trans	-69.3	-37.2	176.5	-77.6	-155.1	0	0	0	112.7	T12 S18	T12-H16 PolarHBondContact O-N 3.12Å; H16-S18 VanDerWaalsContact C-N 3.35Å
17	S	51.8	Low	51.7	Low	70 Å²	70	110.5 Å²	110.5	49%	0.49	58%	0.582	S	S	.	*	H	α-helix	trans	-68	-34.1	174.3	-172	0	0	0	0	112.7	N13	N13-S17 WeakPolarHBondContact O-CB 3.48Å; N13-S17 PolarHBondContact O-N 3.4Å; N13-S17 VanDerWaalsContact O-N 3.12Å
18	S	53	Low	51.9	Low	56 Å²	56	107.8 Å²	107.8	39%	0.392	57%	0.569	S	S	.	*	H	α-helix	trans	-71.6	-35.3	179.2	-171.4	0	0	0	0	112.1	R14 L15 H16 Q21 I22	R14-S18 WeakPolarHBondContact O-CB 3.39Å; R14-S18 PolarHBondContact O-N 3.16Å; R14-S18 VanDerWaalsContact O-N 3.09Å; L15-S18 PolarHBondContact O-N 3.09Å; H16-S18 VanDerWaalsContact C-N 3.35Å; S18-Q21 PolarHBondContact O-N 3.26Å; S18-I22 WeakPolarHBondContact O-CD1 3.45Å; S18-I22 VanDerWaalsContact O-CG1 3.26Å; S18-I22 WeakPolarHBondContact O-CG1 3.24Å; S18-I22 PolarHBondContact O-N 3.29Å
19	L	48.6	Very low	52.4	Low	103 Å²	103	106.5 Å²	106.5	54%	0.539	57%	0.565	S	S	.	*	H	α-helix	trans	-69.2	-39.7	-178.5	-148.2	75.2	0	0	0	112.1	L15 Q21 I22 F23	L15-L19 PolarHBondContact O-N 3.29Å; L15-L19 VanDerWaalsContact O-N 3.16Å; L19-Q21 VanDerWaalsContact C-N 3.33Å; L19-Q21 PolarHBondContact O-N 3.3Å; L19-I22 PolarHBondContact O-N 3.43Å; L19-F23 HydrophobicContact CD1-CE2 4.4Å; L19-F23 HydrophobicContact CD2-CE2 4.32Å; L19-F23 HydrophobicContact CG-CD2 4.24Å; L19-F23 HydrophobicContact CG-CE2 3.91Å; L19-F23 VanDerWaalsContact O-CD2 3.24Å; L19-F23 WeakPolarHBondContact O-CD2 3.46Å; L19-F23 PolarHBondContact O-N 3.48Å
20	A	50.3	Low	52.8	Low	58 Å²	58	105.5 Å²	105.5	48%	0.479	56%	0.557	S	S	.	*	H	α-helix	trans	-66.3	-33.4	178.1	0	0	0	0	0	113.1	M24	A20-M24 WeakPolarHBondContact O-CB 3.44Å; A20-M24 WeakPolarHBondContact O-CG 3.34Å; A20-M24 PolarHBondContact O-N 3.32Å
21	Q	49.6	Very low	53.5	Low	120 Å²	120	105.1 Å²	105.1	56%	0.561	55%	0.554	S	S	*	*	H	α-helix	trans	-69	-39	175.4	-75.3	179.2	-27.4	0	0	111.8	S18 L19 F23 Q25	S18-Q21 PolarHBondContact O-N 3.26Å; L19-Q21 VanDerWaalsContact C-N 3.33Å; L19-Q21 PolarHBondContact O-N 3.3Å; Q21-F23 VanDerWaalsContact C-N 3.32Å; Q21-F23 PolarHBondContact O-N 3.35Å; Q21-Q25 WeakPolarHBondContact O-CB 3.26Å; Q21-Q25 WeakPolarHBondContact O-CG 3.48Å; Q21-Q25 PolarHBondContact O-N 3.18Å
22	I	51.3	Low	54.4	Low	94 Å²	94	104.2 Å²	104.2	48%	0.482	55%	0.551	S	S	.	*	H	α-helix	trans	-63.5	-37.8	179	-67	162.1	0	0	0	111.2	S18 L19	S18-I22 WeakPolarHBondContact O-CD1 3.45Å; S18-I22 VanDerWaalsContact O-CG1 3.26Å; S18-I22 WeakPolarHBondContact O-CG1 3.24Å; S18-I22 PolarHBondContact O-N 3.29Å; L19-I22 PolarHBondContact O-N 3.43Å
23	F	51.2	Low	55.3	Low	143 Å²	143	105 Å²	105	63%	0.627	56%	0.556	S	S	*	*	H	α-helix	trans	-85.6	-23.9	-178.2	-73.9	-69.8	0	0	0	115.3	L19 Q21 P26	L19-F23 HydrophobicContact CD1-CE2 4.4Å; L19-F23 HydrophobicContact CD2-CE2 4.32Å; L19-F23 HydrophobicContact CG-CD2 4.24Å; L19-F23 HydrophobicContact CG-CE2 3.91Å; L19-F23 VanDerWaalsContact O-CD2 3.24Å; L19-F23 WeakPolarHBondContact O-CD2 3.46Å; L19-F23 PolarHBondContact O-N 3.48Å; Q21-F23 VanDerWaalsContact C-N 3.32Å; Q21-F23 PolarHBondContact O-N 3.35Å; F23-P26 WeakPolarHBondContact O-CD 3.33Å
24	M	50.3	Low	56.3	Low	113 Å²	113	104.5 Å²	104.5	56%	0.557	55%	0.553	S	S	*	*	H	α-helix	trans	-89	-19.8	179	-73.5	-72.8	164.8	0	0	113.6	A20 I27 N28	A20-M24 WeakPolarHBondContact O-CB 3.44Å; A20-M24 WeakPolarHBondContact O-CG 3.34Å; A20-M24 PolarHBondContact O-N 3.32Å; M24-I27 PolarHBondContact O-N 3.22Å; M24-I27 HydrophobicContact SD-CD1 4.29Å; M24-N28 PolarHBondContact O-N 2.97Å
25	Q	48.2	Very low	57.3	Low	118 Å²	118	100.9 Å²	100.9	55%	0.551	55%	0.547	S	S	*	.	H	α-helix	trans	-54.2	-46.5	176.4	-85.3	171.5	-3	0	0	114.4	Q21 I27 N28 V29	Q21-Q25 WeakPolarHBondContact O-CB 3.26Å; Q21-Q25 WeakPolarHBondContact O-CG 3.48Å; Q21-Q25 PolarHBondContact O-N 3.18Å; Q25-I27 VanDerWaalsContact C-N 3.32Å; Q25-I27 PolarHBondContact O-N 2.99Å; Q25-N28 PolarHBondContact O-N 3.42Å; Q25-V29 WeakPolarHBondContact O-CG2 3.12Å; Q25-V29 PolarHBondContact O-N 3.24Å; Q25-V29 VanDerWaalsContact O-N 3.07Å
26	P	55.4	Low	57.8	Low	80 Å²	80	98 Å²	98	52%	0.519	54%	0.541	S	S	.	.	H	α-helix	trans	-66	-32.2	-178.6	21.5	-31.4	0	0	0	113.3	F23 M30	F23-P26 WeakPolarHBondContact O-CD 3.33Å; P26-M30 WeakPolarHBondContact O-CB 3.42Å; P26-M30 PolarHBondContact O-N 2.95Å
27	I	58.4	Low	58.3	Low	94 Å²	94	97.1 Å²	97.1	48%	0.482	54%	0.54	S	S	.	.	H	α-helix	trans	-68.8	-43.6	178.2	-61.4	173.7	0	0	0	110.3	M24 Q25 V29 M30 L31	M24-I27 PolarHBondContact O-N 3.22Å; M24-I27 HydrophobicContact SD-CD1 4.29Å; Q25-I27 VanDerWaalsContact C-N 3.32Å; Q25-I27 PolarHBondContact O-N 2.99Å; I27-V29 VanDerWaalsContact C-N 3.34Å; I27-V29 PolarHBondContact O-N 3.39Å; I27-M30 PolarHBondContact O-N 3.46Å; I27-L31 WeakPolarHBondContact O-CB 3.39Å; I27-L31 PolarHBondContact O-N 2.98Å
28	N	58.3	Low	58.8	Low	106 Å²	106	95.9 Å²	95.9	57%	0.567	53%	0.534	S	S	*	.	H	α-helix	trans	-64.6	-39	178.2	-70.8	-13.2	0	0	0	111.9	M24 Q25 A32	M24-N28 PolarHBondContact O-N 2.97Å; Q25-N28 PolarHBondContact O-N 3.42Å; N28-A32 WeakPolarHBondContact O-CB 3.32Å; N28-A32 PolarHBondContact O-N 2.89Å; N28-A32 VanDerWaalsContact O-N 3.09Å
29	V	61.9	Low	59	Low	92 Å²	92	94.8 Å²	94.8	56%	0.558	53%	0.527	S	S	*	.	H	α-helix	trans	-67.1	-46.4	176.3	174.8	0	0	0	0	110.9	Q25 I27 L31 A32 V33	Q25-V29 WeakPolarHBondContact O-CG2 3.12Å; Q25-V29 PolarHBondContact O-N 3.24Å; Q25-V29 VanDerWaalsContact O-N 3.07Å; I27-V29 VanDerWaalsContact C-N 3.34Å; I27-V29 PolarHBondContact O-N 3.39Å; V29-L31 VanDerWaalsContact C-N 3.33Å; V29-L31 PolarHBondContact O-N 3.09Å; V29-A32 PolarHBondContact O-N 3.42Å; V29-V33 HydrophobicContact CG1-CG2 4.47Å; V29-V33 WeakPolarHBondContact O-CG2 3.36Å; V29-V33 PolarHBondContact O-N 3.38Å
30	M	63.4	Low	59.5	Low	123 Å²	123	98.5 Å²	98.5	61%	0.606	54%	0.539	S	S	*	.	H	α-helix	trans	-63.5	-39.6	-179.7	-171.2	161.6	68.2	0	0	112.1	P26 I27 V33 L34	P26-M30 WeakPolarHBondContact O-CB 3.42Å; P26-M30 PolarHBondContact O-N 2.95Å; I27-M30 PolarHBondContact O-N 3.46Å; M30-V33 PolarHBondContact O-N 3.07Å; M30-L34 HydrophobicContact CG-CD1 4.42Å; M30-L34 PolarHBondContact O-N 3.33Å
31	L	69	Low	59.7	Low	118 Å²	118	99.9 Å²	99.9	62%	0.618	55%	0.55	S	S	*	.	H	α-helix	trans	-64.4	-41.6	175.1	-175.1	61.5	0	0	0	111.9	I27 V29 L34 L35	I27-L31 WeakPolarHBondContact O-CB 3.39Å; I27-L31 PolarHBondContact O-N 2.98Å; V29-L31 VanDerWaalsContact C-N 3.33Å; V29-L31 PolarHBondContact O-N 3.09Å; L31-L34 PolarHBondContact O-N 3.36Å; L31-L35 WeakPolarHBondContact O-CB 3.43Å; L31-L35 PolarHBondContact O-N 3.43Å
32	A	66.2	Low	59.8	Low	59 Å²	59	102 Å²	102	49%	0.488	56%	0.56	S	S	.	*	H	α-helix	trans	-63.7	-40.2	176.3	0	0	0	0	0	112.2	N28 V29 L35 A36	N28-A32 WeakPolarHBondContact O-CB 3.32Å; N28-A32 PolarHBondContact O-N 2.89Å; N28-A32 VanDerWaalsContact O-N 3.09Å; V29-A32 PolarHBondContact O-N 3.42Å; A32-L35 PolarHBondContact O-N 3.22Å; A32-A36 WeakPolarHBondContact O-CB 3.35Å; A32-A36 PolarHBondContact O-N 2.95Å
33	V	69.7	Low	59.3	Low	80 Å²	80	100 Å²	100	49%	0.485	56%	0.562	S	S	.	*	H	α-helix	trans	-65.1	-45.5	176.2	173.2	0	0	0	0	111.1	V29 M30 L35 A36 L37	V29-V33 HydrophobicContact CG1-CG2 4.47Å; V29-V33 WeakPolarHBondContact O-CG2 3.36Å; V29-V33 PolarHBondContact O-N 3.38Å; M30-V33 PolarHBondContact O-N 3.07Å; V33-L35 VanDerWaalsContact C-N 3.33Å; V33-L35 PolarHBondContact O-N 3.41Å; V33-A36 PolarHBondContact O-N 3.41Å; V33-L37 WeakPolarHBondContact O-CB 3.48Å; V33-L37 PolarHBondContact O-N 2.95Å
34	L	72.8	Confident	58.8	Low	114 Å²	114	96.9 Å²	96.9	60%	0.597	57%	0.571	S	S	*	*	H	α-helix	trans	-59.7	-43.4	176.3	-109.2	74.5	0	0	0	111.8	M30 L31 L37 A38	M30-L34 HydrophobicContact CG-CD1 4.42Å; M30-L34 PolarHBondContact O-N 3.33Å; L31-L34 PolarHBondContact O-N 3.36Å; L34-L37 PolarHBondContact O-N 3.44Å; L34-A38 WeakPolarHBondContact O-CB 3.37Å; L34-A38 PolarHBondContact O-N 2.97Å
35	L	71.4	Confident	58.4	Low	114 Å²	114	101.6 Å²	101.6	60%	0.597	58%	0.582	S	S	*	*	H	α-helix	trans	-68	-39.3	-179.7	-171.8	63.1	0	0	0	111.9	L31 A32 V33 A38 S39	L31-L35 WeakPolarHBondContact O-CB 3.43Å; L31-L35 PolarHBondContact O-N 3.43Å; A32-L35 PolarHBondContact O-N 3.22Å; V33-L35 VanDerWaalsContact C-N 3.33Å; V33-L35 PolarHBondContact O-N 3.41Å; L35-A38 PolarHBondContact O-N 2.89Å; L35-S39 WeakPolarHBondContact O-CB 3.37Å; L35-S39 PolarHBondContact O-N 3.39Å; L35-S39 PolarHBondContact O-OG 2.72Å
36	A	62	Low	58.2	Low	62 Å²	62	101.2 Å²	101.2	51%	0.512	59%	0.593	S	S	.	*	H	α-helix	trans	-64.8	-41.6	175	0	0	0	0	0	111.7	A32 V33 S39 F40	A32-A36 WeakPolarHBondContact O-CB 3.35Å; A32-A36 PolarHBondContact O-N 2.95Å; V33-A36 PolarHBondContact O-N 3.41Å; A36-S39 PolarHBondContact O-N 3.11Å; A36-F40 PolarHBondContact O-N 3.45Å
37	L	62.5	Low	57.9	Low	123 Å²	123	103.3 Å²	103.3	64%	0.644	60%	0.603	S	S	*	*	H	α-helix	trans	-63.7	-43.6	174.3	-121.1	71.5	0	0	0	112	V33 L34 S39 F40 A41	V33-L37 WeakPolarHBondContact O-CB 3.48Å; V33-L37 PolarHBondContact O-N 2.95Å; L34-L37 PolarHBondContact O-N 3.44Å; L37-S39 VanDerWaalsContact C-N 3.34Å; L37-F40 WeakPolarHBondContact O-CB 3.36Å; L37-F40 PolarHBondContact O-N 3.43Å; L37-A41 PolarHBondContact O-N 3.34Å
38	A	61.5	Low	57.3	Low	44 Å²	44	101.8 Å²	101.8	36%	0.364	61%	0.605	S	S	.	*	H	α-helix	trans	-63.4	-40.9	177	0	0	0	0	0	111.7	L34 L35 F40 A41 Q42	L34-A38 WeakPolarHBondContact O-CB 3.37Å; L34-A38 PolarHBondContact O-N 2.97Å; L35-A38 PolarHBondContact O-N 2.89Å; A38-F40 VanDerWaalsContact C-N 3.3Å; A38-F40 PolarHBondContact O-N 3.4Å; A38-A41 PolarHBondContact O-N 3.12Å; A38-Q42 WeakPolarHBondContact O-CG 3.49Å; A38-Q42 PolarHBondContact O-N 3.24Å; A38-Q42 VanDerWaalsContact O-N 3.09Å
39	S	57.3	Low	56.7	Low	33 Å²	33	102.1 Å²	102.1	23%	0.231	61%	0.613	C	S	.	*	H	α-helix	trans	-64.9	-34.1	175.7	-55.1	0	0	0	0	112.1	L35 A36 L37	L35-S39 WeakPolarHBondContact O-CB 3.37Å; L35-S39 PolarHBondContact O-N 3.39Å; L35-S39 PolarHBondContact O-OG 2.72Å; A36-S39 PolarHBondContact O-N 3.11Å; L37-S39 VanDerWaalsContact C-N 3.34Å
40	F	57.9	Low	55.7	Low	181 Å²	181	103.1 Å²	103.1	79%	0.794	63%	0.631	S	S	*	*	H	α-helix	trans	-69.3	-42.7	174.5	-172.5	-97.9	0	0	0	111.8	A36 L37 A38 Q42 G43	A36-F40 PolarHBondContact O-N 3.45Å; L37-F40 WeakPolarHBondContact O-CB 3.36Å; L37-F40 PolarHBondContact O-N 3.43Å; A38-F40 VanDerWaalsContact C-N 3.3Å; A38-F40 PolarHBondContact O-N 3.4Å; F40-Q42 VanDerWaalsContact C-N 3.33Å; F40-Q42 PolarHBondContact O-N 3.32Å; F40-G43 PolarHBondContact O-N 3.38Å
41	A	55.2	Low	54.6	Low	86 Å²	86	101.2 Å²	101.2	71%	0.711	64%	0.643	S	S	*	*	H	α-helix	trans	-69.4	-25.1	179.8	0	0	0	0	0	113.9	L37 A38 G43	L37-A41 PolarHBondContact O-N 3.34Å; A38-A41 PolarHBondContact O-N 3.12Å; A41-G43 VanDerWaalsContact C-N 3.27Å; A41-G43 PolarHBondContact O-N 3Å
42	Q	51.1	Low	53	Low	166 Å²	166	98.9 Å²	98.9	78%	0.776	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.8	9.7	179.5	-72.6	-177.9	-4.3	0	0	114.5	A38 F40	A38-Q42 WeakPolarHBondContact O-CG 3.49Å; A38-Q42 PolarHBondContact O-N 3.24Å; A38-Q42 VanDerWaalsContact O-N 3.09Å; F40-Q42 VanDerWaalsContact C-N 3.33Å; F40-Q42 PolarHBondContact O-N 3.32Å
43	G	40.6	Very low	51.6	Low	51 Å²	51	102.3 Å²	102.3	53%	0.526	66%	0.655	S	S	.	*	T	Hydrogen-bonded Turn	trans	81	85.8	174.4	0	0	0	0	0	112.3	F40 A41 R45	F40-G43 PolarHBondContact O-N 3.38Å; A41-G43 VanDerWaalsContact C-N 3.27Å; A41-G43 PolarHBondContact O-N 3Å; G43-R45 PolarHBondContact O-N 3.09Å
44	G	42.2	Very low	50	Low	78 Å²	78	104.6 Å²	104.6	80%	0.804	67%	0.67	S	S	*	*	S	Bend	trans	59.2	-0.3	152.9	0	0	0	0	0	119.1	S46	G44-S46 PolarHBondContact O-N 3.43Å
45	R	41.2	Very low	48.9	Very low	212 Å²	212	106.6 Å²	106.6	80%	0.8	68%	0.676	S	S	*	*			trans	-82.6	87.9	178.7	-65.9	-173.3	80.9	147.6	4	108.8	G43 V47	G43-R45 PolarHBondContact O-N 3.09Å; R45-V47 PolarHBondContact O-N 3.41Å
46	S	44.5	Very low	47.7	Very low	110 Å²	110	107 Å²	107	77%	0.769	69%	0.685	S	S	*	*			trans	-60.1	97.8	169.7	-176.6	0	0	0	0	110	G44 A48	G44-S46 PolarHBondContact O-N 3.43Å; S46-A48 PolarHBondContact O-N 3.3Å
47	V	47.9	Very low	47	Very low	123 Å²	123	108.3 Å²	108.3	75%	0.745	69%	0.687	S	S	*	*			trans	-85.1	87.5	160.9	-95.2	0	0	0	0	107	R45	R45-V47 PolarHBondContact O-N 3.41Å
48	A	46.1	Very low	46.2	Very low	62 Å²	62	108.8 Å²	108.8	51%	0.512	70%	0.695	S	S	.	*			trans	-61.8	137.1	175.1	0	0	0	0	0	110	S46 A50	S46-A48 PolarHBondContact O-N 3.3Å; A48-A50 PolarHBondContact O-N 3Å
49	P	46.8	Very low	45.2	Very low	114 Å²	114	111.7 Å²	111.7	74%	0.74	71%	0.708	S	S	*	*			trans	-60.8	136.1	175.6	15.6	-17.8	0	0	0	109.7	G51	P49-G51 PolarHBondContact O-N 3.45Å; P49-G51 VanDerWaalsContact O-N 3.11Å
50	A	41.1	Very low	44.4	Very low	113 Å²	113	117.8 Å²	117.8	93%	0.934	73%	0.733	S	S	*	*	T	Hydrogen-bonded Turn	trans	-40	114	-175.1	0	0	0	0	0	112.8	A48	A48-A50 PolarHBondContact O-N 3Å
51	G	38.5	Very low	43.6	Very low	83 Å²	83	113.4 Å²	113.4	86%	0.856	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	125.6	2.3	165.4	0	0	0	0	0	118.1	P49	P49-G51 PolarHBondContact O-N 3.45Å; P49-G51 VanDerWaalsContact O-N 3.11Å
52	A	37	Very low	42.9	Very low	69 Å²	69	114.2 Å²	114.2	57%	0.57	73%	0.726	S	S	*	*			trans	-133	101.8	-179.3	0	0	0	0	0	114.1
53	V	35.9	Very low	42.5	Very low	130 Å²	130	111.9 Å²	111.9	79%	0.788	73%	0.725	S	S	*	*			trans	58.2	89.7	139.7	-150.5	0	0	0	0	117.8
54	T	37.3	Very low	42.3	Very low	129 Å²	129	118.6 Å²	118.6	79%	0.791	74%	0.743	S	S	*	*			trans	64.3	111.7	132.7	-27.1	0	0	0	0	118.6
55	E	48	Very low	42	Very low	155 Å²	155	117.2 Å²	117.2	72%	0.724	73%	0.729	S	S	*	*			trans	-53.5	137.6	171.8	-58.6	175.8	168.3	0	0	112.5	T57	E55-T57 PolarHBondContact O-N 3.41Å
56	P	47.7	Very low	41.7	Very low	123 Å²	123	112.6 Å²	112.6	80%	0.799	73%	0.729	S	S	*	*			trans	-74.7	89.4	145.9	30.8	-25.8	0	0	0	106.4	V58	P56-V58 PolarHBondContact O-N 2.97Å
57	T	47.1	Very low	41.1	Very low	90 Å²	90	110.6 Å²	110.6	55%	0.552	73%	0.725	S	S	*	*			trans	-48	98.3	166.8	-56.4	0	0	0	0	110	E55 T59	E55-T57 PolarHBondContact O-N 3.41Å; T57-T59 WeakPolarHBondContact CG2-OG1 3.42Å; T57-T59 PolarHBondContact O-N 3.48Å
58	V	44.5	Very low	40.4	Very low	132 Å²	132	113.2 Å²	113.2	80%	0.8	73%	0.734	S	S	*	*			trans	-91.2	67.4	149.9	-171.1	0	0	0	0	105.9	P56 Q60	P56-V58 PolarHBondContact O-N 2.97Å; V58-Q60 PolarHBondContact O-N 3.26Å
59	T	41.7	Very low	39.8	Very low	105 Å²	105	115.9 Å²	115.9	64%	0.644	75%	0.749	S	S	*	*			trans	-65.8	92.4	156.8	-67.3	0	0	0	0	104.8	T57 A61	T57-T59 WeakPolarHBondContact CG2-OG1 3.42Å; T57-T59 PolarHBondContact O-N 3.48Å; T59-A61 VanDerWaalsContact C-N 3.32Å; T59-A61 PolarHBondContact O-N 3.44Å
60	Q	40.6	Very low	39.1	Very low	162 Å²	162	116.1 Å²	116.1	76%	0.757	75%	0.754	S	S	*	*			trans	-51.6	114.7	143.2	-83.9	-175.3	-12	0	0	104.6	V58 V62	V58-Q60 PolarHBondContact O-N 3.26Å; Q60-V62 PolarHBondContact O-N 3.15Å
61	A	39.6	Very low	39	Very low	88 Å²	88	117.4 Å²	117.4	73%	0.727	75%	0.745	S	S	*	*			trans	-59	84.5	174.6	0	0	0	0	0	108.2	T59 P63	T59-A61 VanDerWaalsContact C-N 3.32Å; T59-A61 PolarHBondContact O-N 3.44Å; A61-P63 VanDerWaalsContact O-CD 3.28Å; A61-P63 WeakPolarHBondContact O-CD 3.32Å
62	V	41.8	Very low	39	Very low	103 Å²	103	118.8 Å²	118.8	62%	0.624	74%	0.737	S	S	*	*			trans	-77.3	108.4	159.3	-178.7	0	0	0	0	103.3	Q60 E64	Q60-V62 PolarHBondContact O-N 3.15Å; V62-E64 HydrophobicContact CG1-CG 4.27Å; V62-E64 PolarHBondContact O-N 3.38Å
63	P	41.3	Very low	39	Very low	117 Å²	117	121 Å²	121	76%	0.76	74%	0.743	S	S	*	*			trans	-71.4	89.5	176.5	3.9	13.1	0	0	0	106.5	A61 G65	A61-P63 VanDerWaalsContact O-CD 3.28Å; A61-P63 WeakPolarHBondContact O-CD 3.32Å; P63-G65 PolarHBondContact O-N 3.46Å
64	E	38.4	Very low	39.2	Very low	192 Å²	192	122.4 Å²	122.4	90%	0.897	75%	0.746	S	S	*	*			trans	-73.8	74.1	159.9	-66.2	-168.9	-175.6	0	0	107.1	V62	V62-E64 HydrophobicContact CG1-CG 4.27Å; V62-E64 PolarHBondContact O-N 3.38Å
65	G	34.8	Very low	39.3	Very low	50 Å²	50	125 Å²	125	52%	0.515	74%	0.741	S	S	.	*			trans	-141.2	114.5	-179.6	0	0	0	0	0	109.4	P63	P63-G65 PolarHBondContact O-N 3.46Å
66	S	36.1	Very low	39.1	Very low	115 Å²	115	123.5 Å²	123.5	80%	0.804	75%	0.745	S	S	*	*			trans	48.5	105.9	155.3	57.2	0	0	0	0	115.6
67	G	30.6	Very low	38.8	Very low	67 Å²	67	121.8 Å²	121.8	69%	0.691	73%	0.729	S	S	*	*	S	Bend		52.6	101	79.7	0	0	0	0	0	111.1
68	L	33.8	Very low	38.8	Very low	179 Å²	179	125 Å²	125	94%	0.937	74%	0.741	S	S	*	*			trans	75.3	88.5	168.6	-48.5	164.9	0	0	0	116.3
69	S	33.5	Very low	38.5	Very low	118 Å²	118	123.7 Å²	123.7	83%	0.825	73%	0.73	S	S	*	*				-164.8	117.8	126.7	-159.9	0	0	0	0	111
70	S	32.9	Very low	38.5	Very low	119 Å²	119	123.6 Å²	123.6	83%	0.832	73%	0.734	S	S	*	*			trans	-74.6	114.8	167.9	159.6	0	0	0	0	108.4
71	D	38.5	Very low	38.5	Very low	139 Å²	139	120.2 Å²	120.2	74%	0.743	72%	0.724	S	S	*	*			trans	-156.5	113.5	160.7	-132.9	-7	0	0	0	111.1
72	V	38.1	Very low	38.5	Very low	113 Å²	113	123.1 Å²	123.1	69%	0.685	73%	0.727	S	S	*	*			trans	58.1	99	133.5	174.2	0	0	0	0	116.7
73	T	37	Very low	38.5	Very low	115 Å²	115	124 Å²	124	71%	0.706	73%	0.733	S	S	*	*				63	91.5	92.6	-48.3	0	0	0	0	112.8
74	D	39.9	Very low	38.4	Very low	159 Å²	159	123.1 Å²	123.1	85%	0.85	73%	0.725	S	S	*	*				175	141.6	124.6	-88.1	-32.7	0	0	0	112.7
75	R	40.5	Very low	38.4	Very low	183 Å²	183	119.5 Å²	119.5	69%	0.691	72%	0.721	S	S	*	*			trans	-67	159	-173	-167.8	157.8	-176	-171.9	1.1	112.1	N77	R75-N77 HydrophobicContact CG-CB 4.1Å; R75-N77 VanDerWaalsContact NE-CB 3.27Å; R75-N77 PolarHBondContact NE-OD1 2.92Å; R75-N77 PolarHBondContact NH2-ND2 3.32Å; R75-N77 PolarHBondContact NH2-OD1 3.44Å
76	P	42.5	Very low	38.7	Very low	124 Å²	124	123.1 Å²	123.1	81%	0.805	73%	0.728	S	S	*	*				-125.5	138.5	97.3	12.2	6.1	0	0	0	111.9	I78	P76-I78 PolarHBondContact O-N 2.71Å
77	N	40.9	Very low	38.9	Very low	88 Å²	88	122.1 Å²	122.1	47%	0.471	73%	0.727	S	S	.	*			trans	-65.8	116.8	-176.3	-167.1	35.2	0	0	0	108	R75 D79	R75-N77 HydrophobicContact CG-CB 4.1Å; R75-N77 VanDerWaalsContact NE-CB 3.27Å; R75-N77 PolarHBondContact NE-OD1 2.92Å; R75-N77 PolarHBondContact NH2-ND2 3.32Å; R75-N77 PolarHBondContact NH2-OD1 3.44Å; N77-D79 PolarHBondContact O-N 3.05Å
78	I	47.1	Very low	39.6	Very low	157 Å²	157	122.5 Å²	122.5	81%	0.805	72%	0.716	S	S	*	*			trans	-77.4	83.8	164.6	-50.1	179.9	0	0	0	105.4	P76 S80	P76-I78 PolarHBondContact O-N 2.71Å; I78-S80 PolarHBondContact O-N 2.91Å
79	D	39.1	Very low	39.8	Very low	104 Å²	104	117 Å²	117	56%	0.556	69%	0.693	S	S	*	*			trans	-61.2	119	174.2	-154.5	-1.5	0	0	0	107.9	N77 T81	N77-D79 PolarHBondContact O-N 3.05Å; D79-T81 PolarHBondContact O-N 2.89Å
80	S	42	Very low	40.6	Very low	104 Å²	104	116.2 Å²	116.2	73%	0.727	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.6	36.6	-172.3	-63.2	0	0	0	0	111.9	I78	I78-S80 PolarHBondContact O-N 2.91Å
81	T	40.7	Very low	41.4	Very low	91 Å²	91	116.4 Å²	116.4	56%	0.558	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.7	-6	-168	48	0	0	0	0	115.2	D79	D79-T81 PolarHBondContact O-N 2.89Å
82	D	39.3	Very low	41.8	Very low	148 Å²	148	115.1 Å²	115.1	79%	0.791	66%	0.664	S	S	*	*			trans	-105.5	41.6	172.2	-83.1	-31.5	0	0	0	113	V84	D82-V84 PolarHBondContact O-N 3.42Å
83	V	41.4	Very low	42.5	Very low	122 Å²	122	116.8 Å²	116.8	74%	0.739	67%	0.668	S	S	*	*			trans	-74.1	43.7	151.1	-152.5	0	0	0	0	109	S85	V83-S85 PolarHBondContact O-N 2.7Å; V83-S85 PolarHBondContact O-OG 2.94Å
84	V	38.7	Very low	43.4	Very low	99 Å²	99	118 Å²	118	60%	0.6	67%	0.67	S	S	*	*			trans	-82.6	82.4	172.3	179.7	0	0	0	0	106	D82 N86	D82-V84 PolarHBondContact O-N 3.42Å; V84-N86 PolarHBondContact O-N 2.82Å
85	S	38.7	Very low	43.1	Very low	116 Å²	116	112.9 Å²	112.9	81%	0.811	65%	0.654	S	S	*	*				31.7	32.9	116.7	-58.5	0	0	0	0	118	V83 A87	V83-S85 PolarHBondContact O-N 2.7Å; V83-S85 PolarHBondContact O-OG 2.94Å; S85-A87 VanDerWaalsContact C-N 3.26Å; S85-A87 PolarHBondContact O-N 3.06Å
86	N	41.1	Very low	43.2	Very low	125 Å²	125	109.1 Å²	109.1	67%	0.668	66%	0.655	S	S	*	*			trans	-90.5	80.3	166.5	-157.8	53.2	0	0	0	106.8	V84 T88	V84-N86 PolarHBondContact O-N 2.82Å; N86-T88 PolarHBondContact O-N 2.5Å; N86-T88 PolarHBondContact O-OG1 2.88Å
87	A	41.6	Very low	43	Very low	94 Å²	94	107.6 Å²	107.6	78%	0.777	65%	0.648	S	S	*	*			trans	-54.2	83.7	159.9	0	0	0	0	0	108.4	S85 S89	S85-A87 VanDerWaalsContact C-N 3.26Å; S85-A87 PolarHBondContact O-N 3.06Å; A87-S89 PolarHBondContact O-N 3.39Å
88	T	45.4	Very low	42.9	Very low	75 Å²	75	109.6 Å²	109.6	46%	0.46	66%	0.664	S	S	.	*			trans	-76.9	82.4	164.3	16.4	0	0	0	0	106.7	N86 D92	N86-T88 PolarHBondContact O-N 2.5Å; N86-T88 PolarHBondContact O-OG1 2.88Å; T88-D92 HydrophobicContact CG2-CB 4.15Å; T88-D92 WeakPolarHBondContact CG2-OD2 3.42Å
89	S	38.2	Very low	42.5	Very low	65 Å²	65	110.2 Å²	110.2	46%	0.455	67%	0.669	S	S	.	*			trans	0.5	127.7	149.7	-129	0	0	0	0	112.4	A87 E91 D92	A87-S89 PolarHBondContact O-N 3.39Å; S89-E91 WeakPolarHBondContact CA-OE2 3.43Å; S89-E91 WeakPolarHBondContact CB-OE2 3.29Å; S89-E91 PolarHBondContact O-N 3.41Å; S89-E91 PolarHBondContact OG-OE2 3.47Å; S89-D92 WeakPolarHBondContact O-CB 2.92Å; S89-D92 PolarHBondContact O-N 3.01Å
90	V	48.4	Very low	42.5	Very low	100 Å²	100	109.9 Å²	109.9	61%	0.606	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.4	-21.2	175.5	-172.6	0	0	0	0	111.1	L93 L94	V90-L93 PolarHBondContact O-N 3.43Å; V90-L94 HydrophobicContact CG1-CD1 3.81Å; V90-L94 WeakPolarHBondContact O-CD1 3.44Å; V90-L94 PolarHBondContact O-N 3.4Å
91	E	50.6	Low	42.3	Very low	124 Å²	124	111.9 Å²	111.9	58%	0.579	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.8	-32.2	171.5	-61.8	72.8	-157.2	0	0	114.4	S89 L93 L94 G95	S89-E91 WeakPolarHBondContact CA-OE2 3.43Å; S89-E91 WeakPolarHBondContact CB-OE2 3.29Å; S89-E91 PolarHBondContact O-N 3.41Å; S89-E91 PolarHBondContact OG-OE2 3.47Å; E91-L93 VanDerWaalsContact C-N 3.31Å; E91-L94 PolarHBondContact O-N 3.13Å; E91-G95 PolarHBondContact O-N 2.99Å
92	D	47.4	Very low	42.5	Very low	112 Å²	112	114.2 Å²	114.2	60%	0.599	69%	0.691	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.2	-21.7	176.9	-154.1	35.2	0	0	0	112.2	T88 S89	T88-D92 HydrophobicContact CG2-CB 4.15Å; T88-D92 WeakPolarHBondContact CG2-OD2 3.42Å; S89-D92 WeakPolarHBondContact O-CB 2.92Å; S89-D92 PolarHBondContact O-N 3.01Å
93	L	51.9	Low	42.4	Very low	148 Å²	148	113.6 Å²	113.6	78%	0.775	69%	0.694	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83	-14.9	170.3	-84	132.4	0	0	0	113.2	V90 E91	V90-L93 PolarHBondContact O-N 3.43Å; E91-L93 VanDerWaalsContact C-N 3.31Å
94	L	55.5	Low	42.5	Very low	141 Å²	141	110.3 Å²	110.3	74%	0.738	68%	0.684	S	S	*	*	T	Hydrogen-bonded Turn	trans	-123.6	-6	-167.9	-85.6	145.2	0	0	0	115.4	V90 E91	V90-L94 HydrophobicContact CG1-CD1 3.81Å; V90-L94 WeakPolarHBondContact O-CD1 3.44Å; V90-L94 PolarHBondContact O-N 3.4Å; E91-L94 PolarHBondContact O-N 3.13Å
95	G	34.5	Very low	42.5	Very low	50 Å²	50	112 Å²	112	52%	0.515	70%	0.695	S	S	.	*			trans	162.4	163.8	160.2	0	0	0	0	0	117.6	E91	E91-G95 PolarHBondContact O-N 2.99Å
96	S	41.8	Very low	42.8	Very low	104 Å²	104	115.2 Å²	115.2	73%	0.727	69%	0.694	S	S	*	*			trans	93.2	90.3	169	-165.7	0	0	0	0	114.4
97	S	38.6	Very low	42.8	Very low	92 Å²	92	113.1 Å²	113.1	64%	0.643	68%	0.683	S	S	*	*				67.7	107.7	106.4	128.6	0	0	0	0	111.2
98	T	38.1	Very low	43.1	Very low	131 Å²	131	113 Å²	113	80%	0.804	68%	0.677	S	S	*	*				175.5	107.1	65.5	10.8	0	0	0	0	105.7
99	N	40.2	Very low	42.9	Very low	170 Å²	170	118.2 Å²	118.2	91%	0.909	69%	0.688	S	S	*	*			trans	-150.9	103	147.3	-135.1	-12.7	0	0	0	109.6
100	A	38.2	Very low	43.4	Very low	96 Å²	96	119.1 Å²	119.1	79%	0.793	69%	0.691	S	S	*	*			trans	-67.7	131.6	176.6	0	0	0	0	0	109.2
101	N	38	Very low	43.4	Very low	147 Å²	147	122.4 Å²	122.4	79%	0.786	70%	0.697	S	S	*	*			trans	160.6	78.2	130.5	-162.5	21.5	0	0	0	110.8
102	N	44.8	Very low	43.4	Very low	139 Å²	139	120.9 Å²	120.9	74%	0.743	70%	0.697	S	S	*	*	S	Bend	trans	166.6	85.5	143	-96.2	1.7	0	0	0	109.6	G104	N102-G104 PolarHBondContact O-N 3.4Å
103	T	38.1	Very low	43.6	Very low	136 Å²	136	120 Å²	120	83%	0.834	69%	0.691	S	S	*	*			trans	35.8	37.7	135.7	42.7	0	0	0	0	119.9	T105	T103-T105 VanDerWaalsContact C-N 3.32Å; T103-T105 PolarHBondContact O-N 3.06Å
104	G	41.8	Very low	43.5	Very low	53 Å²	53	115.6 Å²	115.6	55%	0.546	68%	0.676	S	S	.	*			trans	-74.8	84.8	158.9	0	0	0	0	0	109.6	N102 F106	N102-G104 PolarHBondContact O-N 3.4Å; G104-F106 PolarHBondContact O-N 3.2Å
105	T	39.9	Very low	43.3	Very low	133 Å²	133	112.7 Å²	112.7	82%	0.816	67%	0.666	S	S	*	*			trans	-68.6	73.4	166.1	-43.9	0	0	0	0	108	T103 N107	T103-T105 VanDerWaalsContact C-N 3.32Å; T103-T105 PolarHBondContact O-N 3.06Å; T105-N107 VanDerWaalsContact C-N 3.27Å; T105-N107 PolarHBondContact O-N 3Å
106	F	45	Very low	44.2	Very low	184 Å²	184	116.5 Å²	116.5	81%	0.807	67%	0.671	S	S	*	*			trans	-65	98.2	164.7	-75.2	-79.3	0	0	0	106.3	G104 S108	G104-F106 PolarHBondContact O-N 3.2Å; F106-S108 PolarHBondContact O-N 3.18Å
107	N	41.9	Very low	44.8	Very low	82 Å²	82	117 Å²	117	44%	0.439	66%	0.664	S	S	.	*			trans	-63.6	91.4	173	-172.3	-3.5	0	0	0	107.7	T105 R109 T110	T105-N107 VanDerWaalsContact C-N 3.27Å; T105-N107 PolarHBondContact O-N 3Å; N107-R109 PolarHBondContact O-N 2.89Å; N107-R109 WeakPolarHBondContact OD1-CB 3.1Å; N107-R109 VanDerWaalsContact OD1-CG 3.3Å; N107-R109 WeakPolarHBondContact OD1-CG 3.44Å; N107-R109 PolarHBondContact OD1-N 3.42Å; N107-R109 VanDerWaalsContact OD1-N 3.15Å; N107-T110 WeakPolarHBondContact O-CB 3.49Å; N107-T110 PolarHBondContact O-N 2.65Å; N107-T110 PolarHBondContact O-OG1 2.97Å
108	S	46.7	Very low	45.6	Very low	92 Å²	92	118 Å²	118	64%	0.643	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.5	-10.7	174.8	53.8	0	0	0	0	112.8	F106	F106-S108 PolarHBondContact O-N 3.18Å
109	R	41.8	Very low	46.3	Very low	183 Å²	183	117 Å²	117	69%	0.691	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.8	-28.6	171.3	-50.7	-178.4	170.3	-144.3	-2.9	112.5	N107 F111 V112 I113	N107-R109 PolarHBondContact O-N 2.89Å; N107-R109 WeakPolarHBondContact OD1-CB 3.1Å; N107-R109 VanDerWaalsContact OD1-CG 3.3Å; N107-R109 WeakPolarHBondContact OD1-CG 3.44Å; N107-R109 PolarHBondContact OD1-N 3.42Å; N107-R109 VanDerWaalsContact OD1-N 3.15Å; R109-F111 VanDerWaalsContact C-N 3.27Å; R109-F111 PolarHBondContact O-N 2.78Å; R109-V112 PolarHBondContact O-N 3.15Å; R109-V112 VanDerWaalsContact O-N 3.13Å; R109-I113 HydrophobicContact CB-CD1 4.03Å; R109-I113 VanDerWaalsContact O-CD1 3.28Å; R109-I113 WeakPolarHBondContact O-CD1 3.39Å; R109-I113 WeakPolarHBondContact O-CG1 3.47Å; R109-I113 PolarHBondContact O-N 2.99Å
110	T	48.5	Very low	47	Very low	84 Å²	84	112.1 Å²	112.1	52%	0.515	63%	0.633	S	S	.	*	H	α-helix	trans	-61.3	-37.2	179.9	-54.1	0	0	0	0	111.8	N107 V112 I113 A114	N107-T110 WeakPolarHBondContact O-CB 3.49Å; N107-T110 PolarHBondContact O-N 2.65Å; N107-T110 PolarHBondContact O-OG1 2.97Å; T110-V112 VanDerWaalsContact C-N 3.31Å; T110-V112 PolarHBondContact O-N 3.31Å; T110-I113 PolarHBondContact O-N 3.29Å; T110-A114 PolarHBondContact O-N 2.76Å
111	F	48.1	Very low	47.9	Very low	169 Å²	169	114.2 Å²	114.2	74%	0.741	63%	0.63	S	S	*	*	H	α-helix	trans	-69.9	-24.4	178.7	-80.9	-84	0	0	0	113.7	R109 P115	R109-F111 VanDerWaalsContact C-N 3.27Å; R109-F111 PolarHBondContact O-N 2.78Å; F111-P115 VanDerWaalsContact O-CD 3.29Å; F111-P115 WeakPolarHBondContact O-CD 3.04Å
112	V	51.5	Low	48.7	Very low	93 Å²	93	112.8 Å²	112.8	56%	0.564	63%	0.627	S	S	*	*	H	α-helix	trans	-93.5	-25	178.1	-171	0	0	0	0	111.9	R109 T110 P115 M116	R109-V112 PolarHBondContact O-N 3.15Å; R109-V112 VanDerWaalsContact O-N 3.13Å; T110-V112 VanDerWaalsContact C-N 3.31Å; T110-V112 PolarHBondContact O-N 3.31Å; V112-P115 WeakPolarHBondContact O-CD 3.39Å; V112-M116 WeakPolarHBondContact O-CG 3.28Å
113	I	50.5	Low	48.8	Very low	92 Å²	92	116.8 Å²	116.8	47%	0.472	64%	0.641	S	S	.	*	H	α-helix	trans	-73.5	-34.7	179.5	-66.7	160.3	0	0	0	111.5	R109 T110 M116 M117	R109-I113 HydrophobicContact CB-CD1 4.03Å; R109-I113 VanDerWaalsContact O-CD1 3.28Å; R109-I113 WeakPolarHBondContact O-CD1 3.39Å; R109-I113 WeakPolarHBondContact O-CG1 3.47Å; R109-I113 PolarHBondContact O-N 2.99Å; T110-I113 PolarHBondContact O-N 3.29Å; I113-M116 PolarHBondContact O-N 3.32Å; I113-M117 HydrophobicContact CG2-CG 3.93Å; I113-M117 WeakPolarHBondContact O-CG 3.28Å; I113-M117 PolarHBondContact O-N 2.93Å
114	A	50.6	Low	49.4	Very low	56 Å²	56	115.8 Å²	115.8	46%	0.463	63%	0.631	S	S	.	*	H	α-helix	trans	-62.1	-45.9	-177.5	0	0	0	0	0	113.5	T110 M116 I118	T110-A114 PolarHBondContact O-N 2.76Å; A114-M116 PolarHBondContact O-N 3.22Å; A114-I118 WeakPolarHBondContact O-CD1 3.11Å; A114-I118 VanDerWaalsContact O-CG1 3.32Å; A114-I118 WeakPolarHBondContact O-CG1 3.13Å; A114-I118 PolarHBondContact O-N 2.91Å
115	P	50.6	Low	49.8	Very low	81 Å²	81	119.1 Å²	119.1	53%	0.526	64%	0.636	S	S	.	*	H	α-helix	trans	-65.4	-36.3	173.9	-20.3	31	0	0	0	113.4	F111 V112 I118 L119	F111-P115 VanDerWaalsContact O-CD 3.29Å; F111-P115 WeakPolarHBondContact O-CD 3.04Å; V112-P115 WeakPolarHBondContact O-CD 3.39Å; P115-I118 PolarHBondContact O-N 2.94Å; P115-L119 PolarHBondContact O-N 2.74Å; P115-L119 VanDerWaalsContact O-N 3.12Å
116	M	54	Low	50.3	Low	129 Å²	129	118.3 Å²	118.3	64%	0.635	63%	0.626	S	S	*	*	H	α-helix	trans	-69.4	-38.2	-179.4	-75.3	-83.5	176.3	0	0	112.4	V112 I113 A114 L119 A120	V112-M116 WeakPolarHBondContact O-CG 3.28Å; I113-M116 PolarHBondContact O-N 3.32Å; A114-M116 PolarHBondContact O-N 3.22Å; M116-L119 PolarHBondContact O-N 3.39Å; M116-A120 PolarHBondContact O-N 2.77Å; M116-A120 VanDerWaalsContact O-N 3.15Å
117	M	54.1	Low	50.7	Low	116 Å²	116	114.5 Å²	114.5	57%	0.571	62%	0.615	S	S	*	*	H	α-helix	trans	-66.1	-38.2	175.2	-79.5	-69.8	-69.7	0	0	112.1	I113 A120 L121	I113-M117 HydrophobicContact CG2-CG 3.93Å; I113-M117 WeakPolarHBondContact O-CG 3.28Å; I113-M117 PolarHBondContact O-N 2.93Å; M117-A120 PolarHBondContact O-N 2.81Å; M117-L121 WeakPolarHBondContact O-CD1 3.42Å; M117-L121 PolarHBondContact O-N 2.74Å
118	I	55.4	Low	51.2	Low	113 Å²	113	116.5 Å²	116.5	58%	0.579	63%	0.626	S	S	*	*	H	α-helix	trans	-67.2	-38.6	177.1	-64.9	165	0	0	0	110.7	A114 P115 A120 L121 V122	A114-I118 WeakPolarHBondContact O-CD1 3.11Å; A114-I118 VanDerWaalsContact O-CG1 3.32Å; A114-I118 WeakPolarHBondContact O-CG1 3.13Å; A114-I118 PolarHBondContact O-N 2.91Å; P115-I118 PolarHBondContact O-N 2.94Å; I118-A120 VanDerWaalsContact C-N 3.33Å; I118-A120 PolarHBondContact O-N 2.9Å; I118-L121 PolarHBondContact O-N 3.06Å; I118-V122 WeakPolarHBondContact O-CG2 3.3Å
119	L	52.7	Low	51.5	Low	108 Å²	108	118.1 Å²	118.1	57%	0.565	63%	0.625	S	S	*	*	H	α-helix	trans	-67.9	-31.5	177.5	-167.7	62.4	0	0	0	112.8	P115 M116 L121 V122	P115-L119 PolarHBondContact O-N 2.74Å; P115-L119 VanDerWaalsContact O-N 3.12Å; M116-L119 PolarHBondContact O-N 3.39Å; L119-L121 VanDerWaalsContact C-N 3.32Å; L119-V122 PolarHBondContact O-N 3.26Å
120	A	55.1	Low	52.2	Low	68 Å²	68	113.5 Å²	113.5	56%	0.562	62%	0.62	S	S	*	*	H	α-helix	trans	-75.4	-16.4	176.7	0	0	0	0	0	114.3	M116 M117 I118	M116-A120 PolarHBondContact O-N 2.77Å; M116-A120 VanDerWaalsContact O-N 3.15Å; M117-A120 PolarHBondContact O-N 2.81Å; I118-A120 VanDerWaalsContact C-N 3.33Å; I118-A120 PolarHBondContact O-N 2.9Å
121	L	56.3	Low	52.5	Low	140 Å²	140	115.8 Å²	115.8	73%	0.733	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.1	-9	175.4	-82.6	149	0	0	0	113.1	M117 I118 L119	M117-L121 WeakPolarHBondContact O-CD1 3.42Å; M117-L121 PolarHBondContact O-N 2.74Å; I118-L121 PolarHBondContact O-N 3.06Å; L119-L121 VanDerWaalsContact C-N 3.32Å
122	V	55.5	Low	52.8	Low	118 Å²	118	111.3 Å²	111.3	72%	0.715	62%	0.619	S	S	*	*			trans	-107.6	-1.2	-174.1	177.9	0	0	0	0	112.4	I118 L119	I118-V122 WeakPolarHBondContact O-CG2 3.3Å; L119-V122 PolarHBondContact O-N 3.26Å
123	Q	47.7	Very low	53	Low	222 Å²	222	113 Å²	113	100%	1.037	62%	0.624	S	S	*	*			trans	-97.4	0	170	-65.5	-171.9	-15.8	0	0	111.2

Retrieved 123 of 123 residues in 24.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).