X5MBH0_CAEEL Loading...

RING-type domain-containing protein

AlphaFold DB , UniProt , Accession X5MBH0, Species CAEEL (Caenorhabditis elegans), Gene grif-1, Length 126 aa.

						>X5MBH0_CAEEL|X5MBH0|grif-1
MQRQENQRRIVGLQDNLHKVQRDFREQLNATMERWAGWNGSHDLSMDKFRELGDTYNQKKVYDAFVHQLRGKTAKIEKLAEHVLRWNDELDREMERPPAHRLPRSSTPAPAPPFDNSVAYYFEHQF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.3	Low	76.1	Confident	193 Å²	193	133 Å²	133	95%	0.951	60%	0.599	S	S	*	*				0	-66.9	0	-67.2	-63.9	-83.7	0	0	111.9	R3 Q4 E5	M1-R3 PolarHBondContact O-N 3.31Å; M1-Q4 PolarHBondContact O-N 3.39Å; M1-Q4 VanDerWaalsContact O-N 3.16Å; M1-E5 PolarHBondContact O-N 2.96Å; M1-E5 VanDerWaalsContact O-N 3.1Å
2	Q	70.1	Confident	76.7	Confident	110 Å²	110	125.3 Å²	125.3	51%	0.514	58%	0.584	S	S	.	*	H	α-helix	trans	-61	-34.1	-172.2	-154.9	159.6	41.5	0	0	115.8	E5 N6 L102	Q2-E5 PolarHBondContact O-N 3.42Å; Q2-N6 WeakPolarHBondContact O-CB 3.39Å; Q2-N6 VanDerWaalsContact O-CG 3.31Å; Q2-N6 PolarHBondContact O-N 2.76Å; Q2-L102 VanDerWaalsContact CD-CD1 3.48Å; Q2-L102 HydrophobicContact CG-CD1 4.39Å
3	R	72.8	Confident	76.3	Confident	221 Å²	221	124.6 Å²	124.6	83%	0.834	59%	0.586	S	S	*	*	H	α-helix	trans	-67.8	-39.4	177.4	-142.8	-177.6	-166.6	-172.9	4	112.7	M1 Q7	M1-R3 PolarHBondContact O-N 3.31Å; R3-Q7 PolarHBondContact O-N 3.1Å
4	Q	75.8	Confident	75.9	Confident	119 Å²	119	123.4 Å²	123.4	56%	0.556	58%	0.58	S	S	*	*	H	α-helix	trans	-70.6	-38.4	175.7	-85.1	177.8	-14.5	0	0	111.6	M1 Q7 R8	M1-Q4 PolarHBondContact O-N 3.39Å; M1-Q4 VanDerWaalsContact O-N 3.16Å; Q4-Q7 PolarHBondContact O-N 3.41Å; Q4-R8 WeakPolarHBondContact O-CG 3.39Å; Q4-R8 PolarHBondContact O-N 3.25Å
5	E	77.7	Confident	76.1	Confident	112 Å²	112	121.9 Å²	121.9	52%	0.523	58%	0.578	S	S	.	*	H	α-helix	trans	-61.3	-46.5	174.9	-160	70.5	-161.9	0	0	111.2	M1 Q2 Q7 R8 R9	M1-E5 PolarHBondContact O-N 2.96Å; M1-E5 VanDerWaalsContact O-N 3.1Å; Q2-E5 PolarHBondContact O-N 3.42Å; E5-Q7 VanDerWaalsContact C-N 3.33Å; E5-Q7 PolarHBondContact O-N 3.13Å; E5-R8 PolarHBondContact O-N 3.05Å; E5-R9 WeakPolarHBondContact O-CB 3.44Å; E5-R9 PolarHBondContact O-N 2.99Å
6	N	78.6	Confident	76.1	Confident	81 Å²	81	118.9 Å²	118.9	43%	0.433	57%	0.566	S	S	.	*	H	α-helix	trans	-62.2	-40.4	175.8	-74.9	-11.2	0	0	0	112	Q2 R9 I10	Q2-N6 WeakPolarHBondContact O-CB 3.39Å; Q2-N6 VanDerWaalsContact O-CG 3.31Å; Q2-N6 PolarHBondContact O-N 2.76Å; N6-R9 PolarHBondContact O-N 3.32Å; N6-I10 VanDerWaalsContact O-CG1 3.29Å; N6-I10 WeakPolarHBondContact O-CG1 3.26Å; N6-I10 PolarHBondContact O-N 3.38Å
7	Q	79.3	Confident	75.6	Confident	129 Å²	129	117.6 Å²	117.6	60%	0.603	56%	0.562	S	S	*	*	H	α-helix	trans	-62.6	-46	176.5	-120.8	171.3	-20.3	0	0	111.8	R3 Q4 E5 R9 I10 V11	R3-Q7 PolarHBondContact O-N 3.1Å; Q4-Q7 PolarHBondContact O-N 3.41Å; E5-Q7 VanDerWaalsContact C-N 3.33Å; E5-Q7 PolarHBondContact O-N 3.13Å; Q7-R9 VanDerWaalsContact C-N 3.27Å; Q7-R9 PolarHBondContact O-N 2.87Å; Q7-I10 PolarHBondContact O-N 3.15Å; Q7-V11 WeakPolarHBondContact O-CG2 3.41Å; Q7-V11 PolarHBondContact O-N 2.98Å
8	R	82.1	Confident	75.1	Confident	179 Å²	179	116.8 Å²	116.8	68%	0.675	56%	0.558	S	S	*	*	H	α-helix	trans	-59.7	-39.7	175.2	-74.5	177.3	178.6	167.4	-1.7	111.9	Q4 E5 V11 G12	Q4-R8 WeakPolarHBondContact O-CG 3.39Å; Q4-R8 PolarHBondContact O-N 3.25Å; E5-R8 PolarHBondContact O-N 3.05Å; R8-V11 PolarHBondContact O-N 3.29Å; R8-G12 PolarHBondContact O-N 3.03Å
9	R	76.6	Confident	74.9	Confident	148 Å²	148	117.2 Å²	117.2	56%	0.558	56%	0.557	S	S	*	*	H	α-helix	trans	-66.6	-42.4	179.1	-146.5	176	-164.5	177.9	4.5	112.4	E5 N6 Q7 G12 L13	E5-R9 WeakPolarHBondContact O-CB 3.44Å; E5-R9 PolarHBondContact O-N 2.99Å; N6-R9 PolarHBondContact O-N 3.32Å; Q7-R9 VanDerWaalsContact C-N 3.27Å; Q7-R9 PolarHBondContact O-N 2.87Å; R9-G12 PolarHBondContact O-N 3.23Å; R9-L13 WeakPolarHBondContact O-CG 3.46Å; R9-L13 PolarHBondContact O-N 3.28Å
10	I	79.3	Confident	74.4	Confident	98 Å²	98	114.3 Å²	114.3	50%	0.503	55%	0.547	S	S	.	.	H	α-helix	trans	-63.5	-45.7	176.6	-70.1	164.3	0	0	0	110.6	N6 Q7 G12 L13 Q14	N6-I10 VanDerWaalsContact O-CG1 3.29Å; N6-I10 WeakPolarHBondContact O-CG1 3.26Å; N6-I10 PolarHBondContact O-N 3.38Å; Q7-I10 PolarHBondContact O-N 3.15Å; I10-G12 PolarHBondContact O-N 2.78Å; I10-L13 PolarHBondContact O-N 3.39Å; I10-Q14 WeakPolarHBondContact O-CG 3.49Å; I10-Q14 PolarHBondContact O-N 2.99Å
11	V	83.6	Confident	73.6	Confident	73 Å²	73	113.8 Å²	113.8	44%	0.442	54%	0.544	S	S	.	.	H	α-helix	trans	-62.2	-44.9	178.2	173.6	0	0	0	0	110.9	Q7 R8 L13 Q14 D15	Q7-V11 WeakPolarHBondContact O-CG2 3.41Å; Q7-V11 PolarHBondContact O-N 2.98Å; R8-V11 PolarHBondContact O-N 3.29Å; V11-L13 VanDerWaalsContact C-N 3.33Å; V11-L13 PolarHBondContact O-N 2.71Å; V11-Q14 PolarHBondContact O-N 3.34Å; V11-D15 PolarHBondContact O-N 3.09Å
12	G	83.1	Confident	74	Confident	40 Å²	40	112.2 Å²	112.2	41%	0.412	53%	0.528	S	S	.	.	H	α-helix	trans	-62.7	-36.9	177.2	0	0	0	0	0	113.8	R8 R9 I10 N16	R8-G12 PolarHBondContact O-N 3.03Å; R9-G12 PolarHBondContact O-N 3.23Å; I10-G12 PolarHBondContact O-N 2.78Å; G12-N16 WeakPolarHBondContact O-CB 3.48Å; G12-N16 PolarHBondContact O-N 3.44Å; G12-N16 VanDerWaalsContact O-N 3.09Å
13	L	71.4	Confident	73.7	Confident	117 Å²	117	110 Å²	110	61%	0.613	52%	0.519	S	S	*	.	H	α-helix	trans	-68	-40.7	174.1	-74.1	168.2	0	0	0	111.8	R9 I10 V11 N16 L17	R9-L13 WeakPolarHBondContact O-CG 3.46Å; R9-L13 PolarHBondContact O-N 3.28Å; I10-L13 PolarHBondContact O-N 3.39Å; V11-L13 VanDerWaalsContact C-N 3.33Å; V11-L13 PolarHBondContact O-N 2.71Å; L13-N16 PolarHBondContact O-N 3.47Å; L13-L17 VanDerWaalsContact O-CB 3.3Å; L13-L17 WeakPolarHBondContact O-CB 3.45Å; L13-L17 PolarHBondContact O-N 3.04Å
14	Q	71.8	Confident	73	Confident	107 Å²	107	103.9 Å²	103.9	50%	0.5	50%	0.499	S	S	.	.	H	α-helix	trans	-63.4	-43.4	175.7	-78.1	-178	-45	0	0	112	I10 V11 N16 L17 H18	I10-Q14 WeakPolarHBondContact O-CG 3.49Å; I10-Q14 PolarHBondContact O-N 2.99Å; V11-Q14 PolarHBondContact O-N 3.34Å; Q14-N16 VanDerWaalsContact C-N 3.34Å; Q14-N16 PolarHBondContact O-N 3.29Å; Q14-L17 PolarHBondContact O-N 3.41Å; Q14-H18 WeakPolarHBondContact O-CB 3.47Å; Q14-H18 VanDerWaalsContact O-CG 3.3Å; Q14-H18 PolarHBondContact O-N 3.3Å; Q14-H18 PolarHBondContact O-ND1 3.26Å
15	D	78.5	Confident	72.3	Confident	102 Å²	102	106.9 Å²	106.9	55%	0.545	51%	0.505	S	S	.	.	H	α-helix	trans	-63.3	-41.5	177.7	-74.6	-19.2	0	0	0	111.5	V11 H18 K19	V11-D15 PolarHBondContact O-N 3.09Å; D15-H18 PolarHBondContact O-N 3.17Å; D15-K19 WeakPolarHBondContact O-CB 3.42Å; D15-K19 PolarHBondContact O-N 2.95Å
16	N	75.2	Confident	71.8	Confident	74 Å²	74	107 Å²	107	40%	0.396	51%	0.506	S	S	.	.	H	α-helix	trans	-66	-41.8	176.6	-161.3	41.2	0	0	0	111.6	G12 L13 Q14 H18 K19 V20	G12-N16 WeakPolarHBondContact O-CB 3.48Å; G12-N16 PolarHBondContact O-N 3.44Å; G12-N16 VanDerWaalsContact O-N 3.09Å; L13-N16 PolarHBondContact O-N 3.47Å; Q14-N16 VanDerWaalsContact C-N 3.34Å; Q14-N16 PolarHBondContact O-N 3.29Å; N16-H18 PolarHBondContact O-N 2.8Å; N16-K19 WeakPolarHBondContact O-CB 3.26Å; N16-K19 PolarHBondContact O-N 3.33Å; N16-V20 WeakPolarHBondContact O-CG2 3.5Å; N16-V20 PolarHBondContact O-N 2.91Å
17	L	68.7	Low	70.9	Confident	96 Å²	96	108 Å²	108	50%	0.503	51%	0.507	S	S	.	.	H	α-helix	trans	-64.2	-42	178.7	-161.2	132.2	0	0	0	111.5	L13 Q14 K19 V20 Q21	L13-L17 VanDerWaalsContact O-CB 3.3Å; L13-L17 WeakPolarHBondContact O-CB 3.45Å; L13-L17 PolarHBondContact O-N 3.04Å; Q14-L17 PolarHBondContact O-N 3.41Å; L17-K19 VanDerWaalsContact C-N 3.33Å; L17-K19 PolarHBondContact O-N 2.92Å; L17-V20 PolarHBondContact O-N 3.43Å; L17-Q21 HydrophobicContact CD2-CG 4.48Å; L17-Q21 WeakPolarHBondContact O-CB 3.29Å; L17-Q21 VanDerWaalsContact O-CG 3.26Å; L17-Q21 WeakPolarHBondContact O-CG 3.29Å; L17-Q21 PolarHBondContact O-N 3.08Å
18	H	66.8	Low	69.9	Low	103 Å²	103	105.4 Å²	105.4	48%	0.477	50%	0.497	S	S	.	.	H	α-helix	trans	-64.5	-36.4	173.7	-71.2	158.3	0	0	0	112.9	Q14 D15 N16 R22	Q14-H18 WeakPolarHBondContact O-CB 3.47Å; Q14-H18 VanDerWaalsContact O-CG 3.3Å; Q14-H18 PolarHBondContact O-N 3.3Å; Q14-H18 PolarHBondContact O-ND1 3.26Å; D15-H18 PolarHBondContact O-N 3.17Å; N16-H18 PolarHBondContact O-N 2.8Å; H18-R22 WeakPolarHBondContact O-CB 3.39Å; H18-R22 PolarHBondContact O-N 3.48Å; H18-R22 VanDerWaalsContact O-N 3.08Å
19	K	71.6	Confident	68.8	Low	125 Å²	125	101 Å²	101	54%	0.543	49%	0.487	S	S	.	.	H	α-helix	trans	-64.3	-51.5	175.2	-174	-173.3	173.8	-170	0	110.9	D15 N16 L17 Q21 R22 D23	D15-K19 WeakPolarHBondContact O-CB 3.42Å; D15-K19 PolarHBondContact O-N 2.95Å; N16-K19 WeakPolarHBondContact O-CB 3.26Å; N16-K19 PolarHBondContact O-N 3.33Å; L17-K19 VanDerWaalsContact C-N 3.33Å; L17-K19 PolarHBondContact O-N 2.92Å; K19-Q21 VanDerWaalsContact C-N 3.31Å; K19-Q21 PolarHBondContact O-N 3.25Å; K19-R22 WeakPolarHBondContact O-CB 3.41Å; K19-R22 PolarHBondContact O-N 3.32Å; K19-R22 VanDerWaalsContact O-N 3.09Å; K19-D23 PolarHBondContact O-N 3.38Å
20	V	63.3	Low	68.3	Low	59 Å²	59	95.7 Å²	95.7	36%	0.358	48%	0.475	S	S	.	.	H	α-helix	trans	-60.1	-41.7	179.3	173	0	0	0	0	111.4	N16 L17 R22 D23 F24	N16-V20 WeakPolarHBondContact O-CG2 3.5Å; N16-V20 PolarHBondContact O-N 2.91Å; L17-V20 PolarHBondContact O-N 3.43Å; V20-R22 VanDerWaalsContact C-N 3.32Å; V20-R22 PolarHBondContact O-N 2.89Å; V20-D23 PolarHBondContact O-N 3.1Å; V20-F24 WeakPolarHBondContact O-CB 3.34Å; V20-F24 PolarHBondContact O-N 3.35Å
21	Q	57.6	Low	67.3	Low	104 Å²	104	93.5 Å²	93.5	49%	0.486	47%	0.466	S	S	.	.	H	α-helix	trans	-63.6	-35.7	175.9	-76.8	177.8	-14.4	0	0	113.3	L17 K19 R25	L17-Q21 HydrophobicContact CD2-CG 4.48Å; L17-Q21 WeakPolarHBondContact O-CB 3.29Å; L17-Q21 VanDerWaalsContact O-CG 3.26Å; L17-Q21 WeakPolarHBondContact O-CG 3.29Å; L17-Q21 PolarHBondContact O-N 3.08Å; K19-Q21 VanDerWaalsContact C-N 3.31Å; K19-Q21 PolarHBondContact O-N 3.25Å; Q21-R25 PolarHBondContact O-N 3.26Å; Q21-R25 VanDerWaalsContact O-N 3.11Å
22	R	71.1	Confident	66	Low	160 Å²	160	94.6 Å²	94.6	60%	0.604	47%	0.468	S	S	*	.	H	α-helix	trans	-68.3	-49.3	176.4	-172.6	-175.6	-55.1	-167.6	2	110.9	H18 K19 V20 F24 R25 E26	H18-R22 WeakPolarHBondContact O-CB 3.39Å; H18-R22 PolarHBondContact O-N 3.48Å; H18-R22 VanDerWaalsContact O-N 3.08Å; K19-R22 WeakPolarHBondContact O-CB 3.41Å; K19-R22 PolarHBondContact O-N 3.32Å; K19-R22 VanDerWaalsContact O-N 3.09Å; V20-R22 VanDerWaalsContact C-N 3.32Å; V20-R22 PolarHBondContact O-N 2.89Å; R22-F24 PolarHBondContact O-N 3.01Å; R22-R25 PolarHBondContact O-N 3.18Å; R22-E26 PolarHBondContact O-N 3.4Å
23	D	63	Low	65.3	Low	63 Å²	63	99.7 Å²	99.7	34%	0.337	48%	0.481	S	S	.	.	H	α-helix	trans	-58.9	-39.4	178.8	-65.7	-9.2	0	0	0	110.6	K19 V20 E26 Q27	K19-D23 PolarHBondContact O-N 3.38Å; V20-D23 PolarHBondContact O-N 3.1Å; D23-E26 PolarHBondContact O-N 3.38Å; D23-Q27 WeakPolarHBondContact O-CG 3.36Å; D23-Q27 PolarHBondContact O-N 2.81Å
24	F	58	Low	65	Low	92 Å²	92	102.4 Å²	102.4	40%	0.404	48%	0.483	S	S	.	.	H	α-helix	trans	-60.9	-48.2	173.1	173.9	-102.7	0	0	0	112.6	V20 R22 E26 Q27 L28 W86	V20-F24 WeakPolarHBondContact O-CB 3.34Å; V20-F24 PolarHBondContact O-N 3.35Å; R22-F24 PolarHBondContact O-N 3.01Å; F24-E26 VanDerWaalsContact C-N 3.31Å; F24-E26 PolarHBondContact O-N 3.42Å; F24-Q27 PolarHBondContact O-N 3.27Å; F24-L28 HydrophobicContact CE1-CD2 4.11Å; F24-L28 HydrophobicContact CZ-CD2 4.23Å; F24-L28 WeakPolarHBondContact O-CB 3.4Å; F24-L28 PolarHBondContact O-N 2.82Å; F24-W86 HydrophobicContact CD2-CZ3 4.21Å
25	R	61.3	Low	64.3	Low	182 Å²	182	104.4 Å²	104.4	69%	0.687	49%	0.486	S	S	*	.	H	α-helix	trans	-61	-40.8	178.9	-82	-177.5	175.8	-165.5	-0.4	112	Q21 R22 L28 N29	Q21-R25 PolarHBondContact O-N 3.26Å; Q21-R25 VanDerWaalsContact O-N 3.11Å; R22-R25 PolarHBondContact O-N 3.18Å; R25-L28 PolarHBondContact O-N 2.85Å; R25-N29 WeakPolarHBondContact O-CB 3.34Å; R25-N29 VanDerWaalsContact O-CG 3.29Å; R25-N29 PolarHBondContact O-N 3.22Å
26	E	66.9	Low	63.4	Low	116 Å²	116	102.8 Å²	102.8	54%	0.542	49%	0.487	S	S	.	.	H	α-helix	trans	-64.7	-44.5	178.2	-71.5	177.3	-171.3	0	0	111.6	R22 D23 F24 N29 A30	R22-E26 PolarHBondContact O-N 3.4Å; D23-E26 PolarHBondContact O-N 3.38Å; F24-E26 VanDerWaalsContact C-N 3.31Å; F24-E26 PolarHBondContact O-N 3.42Å; E26-N29 PolarHBondContact O-N 2.93Å; E26-A30 WeakPolarHBondContact O-CB 3.43Å; E26-A30 PolarHBondContact O-N 3.41Å
27	Q	60.3	Low	62.9	Low	100 Å²	100	101.9 Å²	101.9	47%	0.467	50%	0.495	S	S	.	.	H	α-helix	trans	-67.7	-37.2	177.5	-70.4	-178.1	26	0	0	112.9	D23 F24 T31 W86	D23-Q27 WeakPolarHBondContact O-CG 3.36Å; D23-Q27 PolarHBondContact O-N 2.81Å; F24-Q27 PolarHBondContact O-N 3.27Å; Q27-T31 VanDerWaalsContact O-CB 3.32Å; Q27-T31 WeakPolarHBondContact O-CB 3.5Å; Q27-T31 PolarHBondContact O-N 3.26Å; Q27-T31 PolarHBondContact O-OG1 3.18Å; Q27-W86 VanDerWaalsContact OE1-CH2 3.3Å
28	L	57.3	Low	62.4	Low	75 Å²	75	101.4 Å²	101.4	39%	0.393	49%	0.486	S	S	.	.	H	α-helix	trans	-65	-47.3	175.2	-179.6	63	0	0	0	110.7	F24 R25 T31 M32	F24-L28 HydrophobicContact CE1-CD2 4.11Å; F24-L28 HydrophobicContact CZ-CD2 4.23Å; F24-L28 WeakPolarHBondContact O-CB 3.4Å; F24-L28 PolarHBondContact O-N 2.82Å; R25-L28 PolarHBondContact O-N 2.85Å; L28-T31 WeakPolarHBondContact O-CB 3.35Å; L28-T31 PolarHBondContact O-N 3.1Å; L28-T31 VanDerWaalsContact O-N 3.16Å; L28-M32 HydrophobicContact CD1-CG 4.29Å; L28-M32 HydrophobicContact CG-CG 4.45Å; L28-M32 WeakPolarHBondContact O-CG 3.47Å; L28-M32 PolarHBondContact O-N 3.26Å
29	N	59.3	Low	62	Low	87 Å²	87	100.9 Å²	100.9	47%	0.465	49%	0.487	S	S	.	.	H	α-helix	trans	-61.1	-46.6	177.5	-77.3	-13.9	0	0	0	111.7	R25 E26 T31 M32 E33	R25-N29 WeakPolarHBondContact O-CB 3.34Å; R25-N29 VanDerWaalsContact O-CG 3.29Å; R25-N29 PolarHBondContact O-N 3.22Å; E26-N29 PolarHBondContact O-N 2.93Å; N29-T31 PolarHBondContact O-N 3.15Å; N29-M32 PolarHBondContact O-N 3.41Å; N29-E33 WeakPolarHBondContact O-CB 3.4Å; N29-E33 WeakPolarHBondContact O-CG 3.41Å; N29-E33 PolarHBondContact O-N 3.01Å
30	A	66.1	Low	61.4	Low	36 Å²	36	97.2 Å²	97.2	30%	0.298	49%	0.485	S	S	.	.	H	α-helix	trans	-60.7	-34	176.2	0	0	0	0	0	112.5	E26 R34	E26-A30 WeakPolarHBondContact O-CB 3.43Å; E26-A30 PolarHBondContact O-N 3.41Å; A30-R34 VanDerWaalsContact O-CG 3.29Å; A30-R34 WeakPolarHBondContact O-CG 3.44Å; A30-R34 PolarHBondContact O-N 2.97Å
31	T	59.3	Low	61.5	Low	52 Å²	52	97 Å²	97	32%	0.319	49%	0.486	S	S	.	.	H	α-helix	trans	-72	-43.3	176.2	-60.3	0	0	0	0	111.4	Q27 L28 N29 R34 W35 L79	Q27-T31 VanDerWaalsContact O-CB 3.32Å; Q27-T31 WeakPolarHBondContact O-CB 3.5Å; Q27-T31 PolarHBondContact O-N 3.26Å; Q27-T31 PolarHBondContact O-OG1 3.18Å; L28-T31 WeakPolarHBondContact O-CB 3.35Å; L28-T31 PolarHBondContact O-N 3.1Å; L28-T31 VanDerWaalsContact O-N 3.16Å; N29-T31 PolarHBondContact O-N 3.15Å; T31-R34 PolarHBondContact O-N 2.78Å; T31-W35 WeakPolarHBondContact O-CB 3.47Å; T31-W35 PolarHBondContact O-N 2.85Å; T31-L79 HydrophobicContact CG2-CD2 4.02Å
32	M	55.8	Low	61.7	Low	97 Å²	97	95.4 Å²	95.4	48%	0.478	48%	0.478	S	S	.	.	H	α-helix	trans	-66.8	-39.8	177.6	-70.9	-137.1	-63.1	0	0	112.5	L28 N29 W35 A36	L28-M32 HydrophobicContact CD1-CG 4.29Å; L28-M32 HydrophobicContact CG-CG 4.45Å; L28-M32 WeakPolarHBondContact O-CG 3.47Å; L28-M32 PolarHBondContact O-N 3.26Å; N29-M32 PolarHBondContact O-N 3.41Å; M32-W35 CarbonylContact O-C 3.59Å; M32-W35 PolarHBondContact O-N 3.4Å; M32-A36 WeakPolarHBondContact O-CB 3.32Å; M32-A36 PolarHBondContact O-N 3.4Å
33	E	68.6	Low	61.5	Low	147 Å²	147	92.2 Å²	92.2	69%	0.687	47%	0.473	S	S	*	.	H	α-helix	trans	-62.5	-43.9	174.3	-76.6	179.2	173.5	0	0	111.7	N29 W35 A36 G37	N29-E33 WeakPolarHBondContact O-CB 3.4Å; N29-E33 WeakPolarHBondContact O-CG 3.41Å; N29-E33 PolarHBondContact O-N 3.01Å; E33-W35 VanDerWaalsContact C-N 3.28Å; E33-W35 PolarHBondContact O-N 3.49Å; E33-A36 PolarHBondContact O-N 2.82Å; E33-G37 PolarHBondContact O-N 2.98Å
34	R	64.8	Low	61.6	Low	173 Å²	173	94 Å²	94	65%	0.653	48%	0.482	S	S	*	.	H	α-helix	trans	-61.1	-40.4	173.2	-75	175.1	-170.4	167.9	4.9	111.1	A30 T31 G37 W38	A30-R34 VanDerWaalsContact O-CG 3.29Å; A30-R34 WeakPolarHBondContact O-CG 3.44Å; A30-R34 PolarHBondContact O-N 2.97Å; T31-R34 PolarHBondContact O-N 2.78Å; R34-G37 PolarHBondContact O-N 2.93Å; R34-W38 PolarHBondContact O-N 2.95Å; R34-W38 VanDerWaalsContact O-N 3.09Å; R34-W38 PolarHBondContact O-NE1 2.75Å
35	W	56.8	Low	61.8	Low	150 Å²	150	91.2 Å²	91.2	57%	0.568	47%	0.474	S	S	*	.	H	α-helix	trans	-68.4	-39.7	178.5	-173.9	54.8	0	0	0	113	T31 M32 E33 G37 W38 N39	T31-W35 WeakPolarHBondContact O-CB 3.47Å; T31-W35 PolarHBondContact O-N 2.85Å; M32-W35 CarbonylContact O-C 3.59Å; M32-W35 PolarHBondContact O-N 3.4Å; E33-W35 VanDerWaalsContact C-N 3.28Å; E33-W35 PolarHBondContact O-N 3.49Å; W35-G37 VanDerWaalsContact C-N 3.34Å; W35-G37 PolarHBondContact O-N 3.47Å; W35-W38 AromaticContact CD1-CE3 3.92Å; W35-W38 WeakPolarHBondContact O-CA 3.39Å; W35-W38 VanDerWaalsContact O-CB 3.26Å; W35-W38 WeakPolarHBondContact O-CB 3.33Å; W35-W38 PolarHBondContact O-N 3.43Å; W35-N39 PolarHBondContact O-N 3Å
36	A	60.4	Low	61.9	Low	68 Å²	68	85.6 Å²	85.6	56%	0.562	46%	0.456	S	S	*	.	H	α-helix	trans	-61.9	-42.1	173.7	0	0	0	0	0	111.6	M32 E33 W38 N39	M32-A36 WeakPolarHBondContact O-CB 3.32Å; M32-A36 PolarHBondContact O-N 3.4Å; E33-A36 PolarHBondContact O-N 2.82Å; A36-W38 PolarHBondContact O-N 2.88Å; A36-N39 PolarHBondContact O-N 3.45Å
37	G	64	Low	61.9	Low	54 Å²	54	83.9 Å²	83.9	56%	0.557	45%	0.451	S	S	*	.	H	α-helix	trans	-63.8	-21.9	170.5	0	0	0	0	0	114	E33 R34 W35	E33-G37 PolarHBondContact O-N 2.98Å; R34-G37 PolarHBondContact O-N 2.93Å; W35-G37 VanDerWaalsContact C-N 3.34Å; W35-G37 PolarHBondContact O-N 3.47Å
38	W	59	Low	62	Low	86 Å²	86	84.8 Å²	84.8	33%	0.326	45%	0.454	S	S	.	.	H	α-helix	trans	-77.4	-34.9	177.2	-67.4	-0.4	0	0	0	113.8	R34 W35 A36 S41 H42 K72	R34-W38 PolarHBondContact O-N 2.95Å; R34-W38 VanDerWaalsContact O-N 3.09Å; R34-W38 PolarHBondContact O-NE1 2.75Å; W35-W38 AromaticContact CD1-CE3 3.92Å; W35-W38 WeakPolarHBondContact O-CA 3.39Å; W35-W38 VanDerWaalsContact O-CB 3.26Å; W35-W38 WeakPolarHBondContact O-CB 3.33Å; W35-W38 PolarHBondContact O-N 3.43Å; A36-W38 PolarHBondContact O-N 2.88Å; W38-S41 PolarHBondContact O-N 3.33Å; W38-H42 PolarHBondContact O-N 2.97Å; W38-K72 HydrophobicContact CD2-CD 4.49Å; W38-K72 HydrophobicContact CE3-CD 4.16Å; W38-K72 HydrophobicContact CH2-CG 4.49Å; W38-K72 HydrophobicContact CZ3-CD 4.34Å; W38-K72 HydrophobicContact CZ3-CG 4.33Å
39	N	56.4	Low	61.8	Low	92 Å²	92	84.2 Å²	84.2	49%	0.492	45%	0.448	S	S	.	.	H	α-helix	trans	-65.2	-40	177.6	-91.7	2.6	0	0	0	111.8	W35 A36 S41 H42 D43	W35-N39 PolarHBondContact O-N 3Å; A36-N39 PolarHBondContact O-N 3.45Å; N39-S41 PolarHBondContact O-N 3.04Å; N39-H42 WeakPolarHBondContact O-CB 3.29Å; N39-H42 PolarHBondContact O-N 3.16Å; N39-H42 VanDerWaalsContact O-N 3.13Å; N39-D43 PolarHBondContact O-N 3.41Å
40	G	60.7	Low	62	Low	48 Å²	48	89.5 Å²	89.5	50%	0.495	46%	0.461	S	S	.	.	H	α-helix	trans	-61.9	-25	176.7	0	0	0	0	0	114.4
41	S	64.1	Low	62	Low	55 Å²	55	95.5 Å²	95.5	39%	0.385	48%	0.483	S	S	.	.	H	α-helix	trans	-86.4	-22.5	177.2	177.9	0	0	0	0	113.7	W38 N39 S45	W38-S41 PolarHBondContact O-N 3.33Å; N39-S41 PolarHBondContact O-N 3.04Å; S41-S45 PolarHBondContact O-N 3.46Å; S41-S45 PolarHBondContact O-OG 3.37Å
42	H	62.9	Low	62	Low	71 Å²	71	95.5 Å²	95.5	33%	0.329	48%	0.481	S	S	.	.	H	α-helix	trans	-70.1	-49.8	177.2	169.9	-86.1	0	0	0	110.2	W38 N39 L44 S45 M46 F65	W38-H42 PolarHBondContact O-N 2.97Å; N39-H42 WeakPolarHBondContact O-CB 3.29Å; N39-H42 PolarHBondContact O-N 3.16Å; N39-H42 VanDerWaalsContact O-N 3.13Å; H42-L44 VanDerWaalsContact C-N 3.31Å; H42-L44 PolarHBondContact O-N 3.2Å; H42-S45 PolarHBondContact O-N 3.49Å; H42-M46 PolarHBondContact O-N 2.82Å; H42-F65 AromaticContact CD2-CE2 3.54Å; H42-F65 AromaticContact CD2-CZ 3.57Å; H42-F65 AromaticContact NE2-CZ 3.69Å
43	D	65.4	Low	61.8	Low	92 Å²	92	95.1 Å²	95.1	49%	0.492	50%	0.502	S	S	.	.	H	α-helix	trans	-62.9	-42.1	-177.6	-62.4	-18	0	0	0	110.9	N39 S45 M46 D47	N39-D43 PolarHBondContact O-N 3.41Å; D43-S45 VanDerWaalsContact C-N 3.26Å; D43-S45 PolarHBondContact O-N 3.08Å; D43-M46 PolarHBondContact O-N 3.04Å; D43-M46 VanDerWaalsContact O-N 3.15Å; D43-D47 VanDerWaalsContact O-CG 3.27Å; D43-D47 PolarHBondContact O-N 3.4Å
44	L	66.7	Low	61.4	Low	101 Å²	101	91.5 Å²	91.5	53%	0.529	49%	0.487	S	S	.	.	H	α-helix	trans	-62.6	-29	175.3	-131.1	145.9	0	0	0	113.8	H42 K48	H42-L44 VanDerWaalsContact C-N 3.31Å; H42-L44 PolarHBondContact O-N 3.2Å; L44-K48 WeakPolarHBondContact O-CG 3.42Å; L44-K48 PolarHBondContact O-N 3.05Å
45	S	61.8	Low	61	Low	34 Å²	34	88.4 Å²	88.4	24%	0.238	49%	0.488	C	S	.	.	H	α-helix	trans	-81.2	-35.3	175.9	-61.7	0	0	0	0	111.8	S41 H42 D43 F49	S41-S45 PolarHBondContact O-N 3.46Å; S41-S45 PolarHBondContact O-OG 3.37Å; H42-S45 PolarHBondContact O-N 3.49Å; D43-S45 VanDerWaalsContact C-N 3.26Å; D43-S45 PolarHBondContact O-N 3.08Å; S45-F49 WeakPolarHBondContact O-CB 3.46Å; S45-F49 PolarHBondContact O-N 2.9Å
46	M	63.3	Low	61.4	Low	63 Å²	63	89.4 Å²	89.4	31%	0.31	49%	0.493	S	S	.	.	H	α-helix	trans	-70.2	-36.3	175.1	-74.5	-64.6	-167	0	0	112.1	H42 D43 F49 R50 F65	H42-M46 PolarHBondContact O-N 2.82Å; D43-M46 PolarHBondContact O-N 3.04Å; D43-M46 VanDerWaalsContact O-N 3.15Å; M46-F49 WeakPolarHBondContact O-CB 3.47Å; M46-F49 PolarHBondContact O-N 3.27Å; M46-R50 WeakPolarHBondContact O-CG 3.5Å; M46-R50 PolarHBondContact O-N 3.43Å; M46-F65 HydrophobicContact CE-CE1 3.94Å; M46-F65 HydrophobicContact CE-CZ 3.94Å
47	D	67.3	Low	61.4	Low	81 Å²	81	89.3 Å²	89.3	43%	0.433	48%	0.483	S	S	.	.	H	α-helix	trans	-64.2	-47.4	174.1	-69.4	-22.3	0	0	0	110.9	D43 F49 R50 E51	D43-D47 VanDerWaalsContact O-CG 3.27Å; D43-D47 PolarHBondContact O-N 3.4Å; D47-F49 VanDerWaalsContact C-N 3.28Å; D47-F49 PolarHBondContact O-N 3.02Å; D47-R50 PolarHBondContact O-N 3.43Å; D47-R50 VanDerWaalsContact O-N 3.1Å; D47-E51 WeakPolarHBondContact O-CG 3.42Å; D47-E51 PolarHBondContact O-N 3.08Å
48	K	61.2	Low	60.9	Low	119 Å²	119	89.3 Å²	89.3	52%	0.517	47%	0.468	S	S	.	.	H	α-helix	trans	-59.6	-36.7	172.9	-76.6	177.8	-179.9	177.4	0	113	L44 L52	L44-K48 WeakPolarHBondContact O-CG 3.42Å; L44-K48 PolarHBondContact O-N 3.05Å; K48-L52 WeakPolarHBondContact O-CD1 3.44Å; K48-L52 VanDerWaalsContact O-CG 3.26Å; K48-L52 WeakPolarHBondContact O-CG 3.2Å; K48-L52 PolarHBondContact O-N 3.42Å
49	F	54.3	Low	61.2	Low	63 Å²	63	91.1 Å²	91.1	28%	0.276	48%	0.478	S	S	.	.	H	α-helix	trans	-65.4	-39.4	175.9	178.9	-91.5	0	0	0	111.9	S45 M46 D47 Q58 V61	S45-F49 WeakPolarHBondContact O-CB 3.46Å; S45-F49 PolarHBondContact O-N 2.9Å; M46-F49 WeakPolarHBondContact O-CB 3.47Å; M46-F49 PolarHBondContact O-N 3.27Å; D47-F49 VanDerWaalsContact C-N 3.28Å; D47-F49 PolarHBondContact O-N 3.02Å; F49-Q58 HydrophobicContact CD2-CB 4.19Å; F49-Q58 HydrophobicContact CD2-CG 4.49Å; F49-Q58 HydrophobicContact CE2-CB 3.69Å; F49-Q58 HydrophobicContact CE2-CG 4.25Å; F49-Q58 VanDerWaalsContact CE2-O 3.29Å; F49-Q58 WeakPolarHBondContact CE2-O 3.4Å; F49-Q58 HydrophobicContact CZ-CB 4.19Å; F49-V61 HydrophobicContact CB-CG1 4.2Å; F49-V61 HydrophobicContact CD2-CB 4.41Å; F49-V61 HydrophobicContact CD2-CG1 4.34Å
50	R	62.9	Low	62	Low	198 Å²	198	93.3 Å²	93.3	75%	0.747	48%	0.483	S	S	*	.	H	α-helix	trans	-72.6	-31.7	177.8	-73	174.5	179.6	172.9	0.8	113.5	M46 D47 L52	M46-R50 WeakPolarHBondContact O-CG 3.5Å; M46-R50 PolarHBondContact O-N 3.43Å; D47-R50 PolarHBondContact O-N 3.43Å; D47-R50 VanDerWaalsContact O-N 3.1Å; R50-L52 VanDerWaalsContact C-N 3.33Å
51	E	66.3	Low	62.2	Low	162 Å²	162	93.2 Å²	93.2	76%	0.757	47%	0.473	S	S	*	.	H	α-helix	trans	-75.2	-19.6	178.4	-73.7	-179.9	167.9	0	0	113.6	D47 G53	D47-E51 WeakPolarHBondContact O-CG 3.42Å; D47-E51 PolarHBondContact O-N 3.08Å; E51-G53 PolarHBondContact O-N 3.09Å
52	L	58.6	Low	62.3	Low	52 Å²	52	96.6 Å²	96.6	27%	0.272	48%	0.478	S	S	.	.			trans	-75.9	120.6	178.2	-72.7	167.2	0	0	0	110.9	K48 R50 N57 Q58 V61	K48-L52 WeakPolarHBondContact O-CD1 3.44Å; K48-L52 VanDerWaalsContact O-CG 3.26Å; K48-L52 WeakPolarHBondContact O-CG 3.2Å; K48-L52 PolarHBondContact O-N 3.42Å; R50-L52 VanDerWaalsContact C-N 3.33Å; L52-N57 HydrophobicContact CD1-CB 4.18Å; L52-N57 HydrophobicContact CD2-CB 4.04Å; L52-Q58 HydrophobicContact CB-CG 3.83Å; L52-Q58 PolarHBondContact O-NE2 3.43Å; L52-V61 HydrophobicContact CD1-CB 4.38Å; L52-V61 HydrophobicContact CD1-CG2 3.6Å
53	G	52	Low	62.7	Low	88 Å²	88	96.8 Å²	96.8	91%	0.907	48%	0.482	S	S	*	.			trans	-86.4	-4.5	179	0	0	0	0	0	115.7	E51	E51-G53 PolarHBondContact O-N 3.09Å
54	D	60.3	Low	63.1	Low	71 Å²	71	95 Å²	95	38%	0.38	48%	0.48	S	S	.	.			trans	-117.1	127.4	-177.8	147.3	43.9	0	0	0	111.3	Y56 N57 Q58	D54-Y56 VanDerWaalsContact C-N 3.28Å; D54-Y56 PolarHBondContact O-N 3.36Å; D54-Y56 VanDerWaalsContact OD1-CB 3.29Å; D54-Y56 WeakPolarHBondContact OD1-CB 3.49Å; D54-Y56 PolarHBondContact OD1-N 2.95Å; D54-N57 PolarHBondContact O-N 3.06Å; D54-N57 PolarHBondContact OD2-N 3.11Å; D54-N57 PolarHBondContact OD2-ND2 2.96Å; D54-Q58 WeakPolarHBondContact O-CG 3.43Å; D54-Q58 PolarHBondContact O-N 3.05Å
55	T	57.3	Low	63.3	Low	109 Å²	109	92 Å²	92	67%	0.669	46%	0.462	S	S	*	.	H	α-helix	trans	-59.2	-31.1	-177.4	-31.8	0	0	0	0	113.8	K59	T55-K59 WeakPolarHBondContact O-CB 3.42Å; T55-K59 PolarHBondContact O-N 2.97Å
56	Y	64.3	Low	63.9	Low	171 Å²	171	92.1 Å²	92.1	67%	0.671	46%	0.462	S	S	*	.	H	α-helix	trans	-67.9	-47.4	177.2	177.1	-96.6	0	0	0	111.4	D54 K59 K60	D54-Y56 VanDerWaalsContact C-N 3.28Å; D54-Y56 PolarHBondContact O-N 3.36Å; D54-Y56 VanDerWaalsContact OD1-CB 3.29Å; D54-Y56 WeakPolarHBondContact OD1-CB 3.49Å; D54-Y56 PolarHBondContact OD1-N 2.95Å; Y56-K59 PolarHBondContact O-N 3.03Å; Y56-K60 PolarHBondContact O-N 3.16Å; Y56-K60 VanDerWaalsContact O-N 3.1Å
57	N	61.6	Low	64.7	Low	66 Å²	66	96.1 Å²	96.1	35%	0.353	48%	0.479	S	S	.	.	H	α-helix	trans	-69.8	-36.3	177.4	-77.9	-50.9	0	0	0	112.4	L52 D54 K59 K60 V61	L52-N57 HydrophobicContact CD1-CB 4.18Å; L52-N57 HydrophobicContact CD2-CB 4.04Å; D54-N57 PolarHBondContact O-N 3.06Å; D54-N57 PolarHBondContact OD2-N 3.11Å; D54-N57 PolarHBondContact OD2-ND2 2.96Å; N57-K59 VanDerWaalsContact C-N 3.35Å; N57-K59 PolarHBondContact O-N 3.32Å; N57-K60 PolarHBondContact O-N 3.3Å; N57-V61 WeakPolarHBondContact O-CG2 3.43Å; N57-V61 PolarHBondContact O-N 2.96Å; N57-V61 VanDerWaalsContact O-N 3.08Å
58	Q	52	Low	65.2	Low	54 Å²	54	97 Å²	97	25%	0.252	48%	0.481	S	S	.	.	H	α-helix	trans	-57.2	-47.7	170.6	-75.1	178.7	-11.6	0	0	111.5	F49 L52 D54 K60 V61 Y62	F49-Q58 HydrophobicContact CD2-CB 4.19Å; F49-Q58 HydrophobicContact CD2-CG 4.49Å; F49-Q58 HydrophobicContact CE2-CB 3.69Å; F49-Q58 HydrophobicContact CE2-CG 4.25Å; F49-Q58 VanDerWaalsContact CE2-O 3.29Å; F49-Q58 WeakPolarHBondContact CE2-O 3.4Å; F49-Q58 HydrophobicContact CZ-CB 4.19Å; L52-Q58 HydrophobicContact CB-CG 3.83Å; L52-Q58 PolarHBondContact O-NE2 3.43Å; D54-Q58 WeakPolarHBondContact O-CG 3.43Å; D54-Q58 PolarHBondContact O-N 3.05Å; Q58-K60 VanDerWaalsContact C-N 3.32Å; Q58-K60 PolarHBondContact O-N 2.9Å; Q58-V61 PolarHBondContact O-N 3.2Å; Q58-Y62 WeakPolarHBondContact O-CB 3.43Å; Q58-Y62 PolarHBondContact O-N 3.36Å
59	K	66.8	Low	65.9	Low	123 Å²	123	95.1 Å²	95.1	54%	0.535	48%	0.476	S	S	.	.	H	α-helix	trans	-59.7	-41	177.3	-179.5	172.7	-178.1	-63.2	0	112.1	T55 Y56 N57 Y62 D63	T55-K59 WeakPolarHBondContact O-CB 3.42Å; T55-K59 PolarHBondContact O-N 2.97Å; Y56-K59 PolarHBondContact O-N 3.03Å; N57-K59 VanDerWaalsContact C-N 3.35Å; N57-K59 PolarHBondContact O-N 3.32Å; K59-Y62 PolarHBondContact O-N 2.91Å; K59-D63 IonicContact NZ-OD2 2.78Å; K59-D63 PolarHBondContact NZ-OD2 3.08Å; K59-D63 WeakPolarHBondContact O-CB 3.33Å; K59-D63 VanDerWaalsContact O-CG 3.22Å; K59-D63 PolarHBondContact O-N 3.49Å
60	K	71.6	Confident	66.9	Low	138 Å²	138	101 Å²	101	60%	0.6	50%	0.496	S	S	*	.	H	α-helix	trans	-63	-42.4	177.7	-171.6	-179.5	178.7	-178.9	0	112.4	Y56 N57 Q58 A64	Y56-K60 PolarHBondContact O-N 3.16Å; Y56-K60 VanDerWaalsContact O-N 3.1Å; N57-K60 PolarHBondContact O-N 3.3Å; Q58-K60 VanDerWaalsContact C-N 3.32Å; Q58-K60 PolarHBondContact O-N 2.9Å; K60-A64 WeakPolarHBondContact O-CB 3.46Å; K60-A64 PolarHBondContact O-N 3.23Å; K60-A64 VanDerWaalsContact O-N 3.1Å
61	V	65.1	Low	67.6	Low	46 Å²	46	93.3 Å²	93.3	28%	0.279	48%	0.479	S	S	.	.	H	α-helix	trans	-66.8	-41.5	176.1	173.7	0	0	0	0	110.9	F49 L52 N57 Q58 A64 F65	F49-V61 HydrophobicContact CB-CG1 4.2Å; F49-V61 HydrophobicContact CD2-CB 4.41Å; F49-V61 HydrophobicContact CD2-CG1 4.34Å; L52-V61 HydrophobicContact CD1-CB 4.38Å; L52-V61 HydrophobicContact CD1-CG2 3.6Å; N57-V61 WeakPolarHBondContact O-CG2 3.43Å; N57-V61 PolarHBondContact O-N 2.96Å; N57-V61 VanDerWaalsContact O-N 3.08Å; Q58-V61 PolarHBondContact O-N 3.2Å; V61-A64 PolarHBondContact O-N 3.48Å; V61-F65 WeakPolarHBondContact O-CB 3.34Å; V61-F65 PolarHBondContact O-N 3.14Å
62	Y	66.9	Low	67.8	Low	127 Å²	127	88.3 Å²	88.3	50%	0.498	46%	0.455	S	S	.	.	H	α-helix	trans	-63.8	-45.1	175.9	-177.1	-98.5	0	0	0	112.6	Q58 K59 A64 F65 V66	Q58-Y62 WeakPolarHBondContact O-CB 3.43Å; Q58-Y62 PolarHBondContact O-N 3.36Å; K59-Y62 PolarHBondContact O-N 2.91Å; Y62-A64 VanDerWaalsContact C-N 3.32Å; Y62-A64 PolarHBondContact O-N 3.2Å; Y62-F65 WeakPolarHBondContact O-CB 3.37Å; Y62-F65 PolarHBondContact O-N 3.01Å; Y62-F65 VanDerWaalsContact O-N 3.15Å; Y62-V66 HydrophobicContact CD1-CG2 3.96Å; Y62-V66 HydrophobicContact CE1-CG2 3.55Å; Y62-V66 HydrophobicContact CE2-CG2 4.16Å; Y62-V66 HydrophobicContact CG-CG2 4.43Å; Y62-V66 WeakPolarHBondContact O-CG2 3.43Å; Y62-V66 PolarHBondContact O-N 2.92Å
63	D	71.6	Confident	68.5	Low	75 Å²	75	88.9 Å²	88.9	40%	0.401	46%	0.46	S	S	.	.	H	α-helix	trans	-62.8	-40.3	178.4	-73.2	-20.3	0	0	0	111	K59 V66 H67	K59-D63 IonicContact NZ-OD2 2.78Å; K59-D63 PolarHBondContact NZ-OD2 3.08Å; K59-D63 WeakPolarHBondContact O-CB 3.33Å; K59-D63 VanDerWaalsContact O-CG 3.22Å; K59-D63 PolarHBondContact O-N 3.49Å; D63-V66 PolarHBondContact O-N 3.49Å; D63-H67 WeakPolarHBondContact O-CB 3.43Å; D63-H67 PolarHBondContact O-N 3.46Å
64	A	74.3	Confident	69.6	Low	54 Å²	54	86.7 Å²	86.7	45%	0.446	43%	0.434	S	S	.	.	H	α-helix	trans	-64.3	-41.4	173.6	0	0	0	0	0	112	K60 V61 Y62 H67 Q68	K60-A64 WeakPolarHBondContact O-CB 3.46Å; K60-A64 PolarHBondContact O-N 3.23Å; K60-A64 VanDerWaalsContact O-N 3.1Å; V61-A64 PolarHBondContact O-N 3.48Å; Y62-A64 VanDerWaalsContact C-N 3.32Å; Y62-A64 PolarHBondContact O-N 3.2Å; A64-H67 PolarHBondContact O-N 3.11Å; A64-Q68 WeakPolarHBondContact O-CG 3.44Å; A64-Q68 PolarHBondContact O-N 3.45Å
65	F	70	Confident	70.3	Confident	38 Å²	38	89.7 Å²	89.7	17%	0.167	44%	0.444	C	S	.	.	H	α-helix	trans	-62.6	-48	175.8	174.7	-109.8	0	0	0	112	H42 M46 V61 Y62 H67 Q68 L69	H42-F65 AromaticContact CD2-CE2 3.54Å; H42-F65 AromaticContact CD2-CZ 3.57Å; H42-F65 AromaticContact NE2-CZ 3.69Å; M46-F65 HydrophobicContact CE-CE1 3.94Å; M46-F65 HydrophobicContact CE-CZ 3.94Å; V61-F65 WeakPolarHBondContact O-CB 3.34Å; V61-F65 PolarHBondContact O-N 3.14Å; Y62-F65 WeakPolarHBondContact O-CB 3.37Å; Y62-F65 PolarHBondContact O-N 3.01Å; Y62-F65 VanDerWaalsContact O-N 3.15Å; F65-H67 VanDerWaalsContact C-N 3.31Å; F65-H67 PolarHBondContact O-N 3.49Å; F65-Q68 PolarHBondContact O-N 2.92Å; F65-L69 HydrophobicContact CD1-CD1 3.88Å; F65-L69 HydrophobicContact CD2-CD1 4.5Å; F65-L69 HydrophobicContact CE1-CD1 3.24Å; F65-L69 HydrophobicContact CE2-CD1 3.94Å; F65-L69 HydrophobicContact CG-CD1 4.47Å; F65-L69 HydrophobicContact CZ-CD1 3.28Å; F65-L69 HydrophobicContact CZ-CG 4.46Å; F65-L69 WeakPolarHBondContact O-CB 3.34Å; F65-L69 PolarHBondContact O-N 3.44Å
66	V	74.7	Confident	71.1	Confident	37 Å²	37	89.3 Å²	89.3	22%	0.224	44%	0.436	C	S	.	.	H	α-helix	trans	-61.2	-40.3	177	170.9	0	0	0	0	111.1	Y62 D63 L69 R70	Y62-V66 HydrophobicContact CD1-CG2 3.96Å; Y62-V66 HydrophobicContact CE1-CG2 3.55Å; Y62-V66 HydrophobicContact CE2-CG2 4.16Å; Y62-V66 HydrophobicContact CG-CG2 4.43Å; Y62-V66 WeakPolarHBondContact O-CG2 3.43Å; Y62-V66 PolarHBondContact O-N 2.92Å; D63-V66 PolarHBondContact O-N 3.49Å; V66-L69 WeakPolarHBondContact O-CB 3.26Å; V66-L69 PolarHBondContact O-N 2.93Å; V66-R70 WeakPolarHBondContact O-CG 3.39Å; V66-R70 PolarHBondContact O-N 3.47Å
67	H	79.7	Confident	71.6	Confident	146 Å²	146	86.6 Å²	86.6	68%	0.676	43%	0.43	S	S	*	.	H	α-helix	trans	-63.3	-43.7	176.5	-170.6	69.6	0	0	0	111.8	D63 A64 F65 L69 R70 G71	D63-H67 WeakPolarHBondContact O-CB 3.43Å; D63-H67 PolarHBondContact O-N 3.46Å; A64-H67 PolarHBondContact O-N 3.11Å; F65-H67 VanDerWaalsContact C-N 3.31Å; F65-H67 PolarHBondContact O-N 3.49Å; H67-L69 VanDerWaalsContact C-N 3.34Å; H67-L69 PolarHBondContact O-N 3.31Å; H67-R70 PolarHBondContact O-N 2.93Å; H67-G71 PolarHBondContact O-N 3Å
68	Q	77.3	Confident	72.3	Confident	100 Å²	100	89.9 Å²	89.9	47%	0.467	44%	0.441	S	S	.	.	H	α-helix	trans	-62.5	-41	173.4	-72.5	-173.6	-1.3	0	0	111.9	A64 F65 G71 K72	A64-Q68 WeakPolarHBondContact O-CG 3.44Å; A64-Q68 PolarHBondContact O-N 3.45Å; F65-Q68 PolarHBondContact O-N 2.92Å; Q68-G71 PolarHBondContact O-N 3.48Å; Q68-K72 WeakPolarHBondContact O-CB 3.49Å; Q68-K72 WeakPolarHBondContact O-CG 3.36Å; Q68-K72 PolarHBondContact O-N 3.47Å
69	L	76	Confident	73.3	Confident	80 Å²	80	91.2 Å²	91.2	42%	0.419	45%	0.449	S	S	.	.	H	α-helix	trans	-60.6	-49.4	177.1	-119	149.8	0	0	0	111.6	F65 V66 H67 G71 K72 T73	F65-L69 HydrophobicContact CD1-CD1 3.88Å; F65-L69 HydrophobicContact CD2-CD1 4.5Å; F65-L69 HydrophobicContact CE1-CD1 3.24Å; F65-L69 HydrophobicContact CE2-CD1 3.94Å; F65-L69 HydrophobicContact CG-CD1 4.47Å; F65-L69 HydrophobicContact CZ-CD1 3.28Å; F65-L69 HydrophobicContact CZ-CG 4.46Å; F65-L69 WeakPolarHBondContact O-CB 3.34Å; F65-L69 PolarHBondContact O-N 3.44Å; V66-L69 WeakPolarHBondContact O-CB 3.26Å; V66-L69 PolarHBondContact O-N 2.93Å; H67-L69 VanDerWaalsContact C-N 3.34Å; H67-L69 PolarHBondContact O-N 3.31Å; L69-G71 PolarHBondContact O-N 3.2Å; L69-K72 CarbonylContact O-C 3.56Å; L69-K72 WeakPolarHBondContact O-CA 3.42Å; L69-K72 WeakPolarHBondContact O-CB 3.37Å; L69-K72 PolarHBondContact O-N 2.95Å; L69-T73 PolarHBondContact O-N 2.95Å; L69-T73 PolarHBondContact O-OG1 3.28Å; L69-T73 VanDerWaalsContact O-OG1 3.08Å
70	R	75.3	Confident	73.7	Confident	185 Å²	185	87.8 Å²	87.8	70%	0.698	44%	0.444	S	S	*	.	H	α-helix	trans	-60	-44.4	177.2	-73	-178.3	-179.2	-159.1	0.7	112.2	V66 H67 K72 T73 A74	V66-R70 WeakPolarHBondContact O-CG 3.39Å; V66-R70 PolarHBondContact O-N 3.47Å; H67-R70 PolarHBondContact O-N 2.93Å; R70-K72 PolarHBondContact O-N 3.16Å; R70-T73 PolarHBondContact O-N 3.35Å; R70-A74 PolarHBondContact O-N 3.43Å; R70-A74 VanDerWaalsContact O-N 3.11Å
71	G	78.2	Confident	74.2	Confident	38 Å²	38	86.1 Å²	86.1	39%	0.392	44%	0.438	S	S	.	.	H	α-helix	trans	-62.7	-29.9	175.4	0	0	0	0	0	113	H67 Q68 L69 K75	H67-G71 PolarHBondContact O-N 3Å; Q68-G71 PolarHBondContact O-N 3.48Å; L69-G71 PolarHBondContact O-N 3.2Å; G71-K75 WeakPolarHBondContact O-CG 3.33Å; G71-K75 PolarHBondContact O-N 3.3Å
72	K	69.7	Low	74.7	Confident	57 Å²	57	88.5 Å²	88.5	25%	0.248	45%	0.446	C	S	.	.	H	α-helix	trans	-79	-40.9	176.1	-73.1	176.9	-176	-156.3	0	112.4	W38 Q68 L69 R70 A74 K75 I76	W38-K72 HydrophobicContact CD2-CD 4.49Å; W38-K72 HydrophobicContact CE3-CD 4.16Å; W38-K72 HydrophobicContact CH2-CG 4.49Å; W38-K72 HydrophobicContact CZ3-CD 4.34Å; W38-K72 HydrophobicContact CZ3-CG 4.33Å; Q68-K72 WeakPolarHBondContact O-CB 3.49Å; Q68-K72 WeakPolarHBondContact O-CG 3.36Å; Q68-K72 PolarHBondContact O-N 3.47Å; L69-K72 CarbonylContact O-C 3.56Å; L69-K72 WeakPolarHBondContact O-CA 3.42Å; L69-K72 WeakPolarHBondContact O-CB 3.37Å; L69-K72 PolarHBondContact O-N 2.95Å; R70-K72 PolarHBondContact O-N 3.16Å; K72-A74 VanDerWaalsContact C-N 3.3Å; K72-A74 PolarHBondContact O-N 3.49Å; K72-K75 WeakPolarHBondContact O-CB 3.44Å; K72-K75 PolarHBondContact O-N 2.93Å; K72-I76 WeakPolarHBondContact O-CG1 3.48Å; K72-I76 PolarHBondContact O-N 3.32Å
73	T	74.9	Confident	75	Confident	63 Å²	63	86.3 Å²	86.3	39%	0.387	45%	0.446	S	S	.	.	H	α-helix	trans	-56.1	-46.2	173.3	-55.4	0	0	0	0	110.9	L69 R70 K75 I76 E77	L69-T73 PolarHBondContact O-N 2.95Å; L69-T73 PolarHBondContact O-OG1 3.28Å; L69-T73 VanDerWaalsContact O-OG1 3.08Å; R70-T73 PolarHBondContact O-N 3.35Å; T73-K75 PolarHBondContact O-N 3.04Å; T73-I76 PolarHBondContact O-N 2.92Å; T73-I76 VanDerWaalsContact O-N 3.08Å; T73-E77 WeakPolarHBondContact O-CG 3.47Å; T73-E77 PolarHBondContact O-N 2.99Å
74	A	74.6	Confident	75.3	Confident	42 Å²	42	88 Å²	88	35%	0.347	45%	0.454	S	S	.	.	H	α-helix	trans	-61.8	-30	176.8	0	0	0	0	0	113.5	R70 K72 K78	R70-A74 PolarHBondContact O-N 3.43Å; R70-A74 VanDerWaalsContact O-N 3.11Å; K72-A74 VanDerWaalsContact C-N 3.3Å; K72-A74 PolarHBondContact O-N 3.49Å; A74-K78 WeakPolarHBondContact O-CG 3.48Å; A74-K78 PolarHBondContact O-N 3.02Å
75	K	74.2	Confident	75.5	Confident	135 Å²	135	91.4 Å²	91.4	59%	0.587	46%	0.455	S	S	*	.	H	α-helix	trans	-75.1	-36.4	174.8	-73.1	175.9	-178.2	179.9	0	112	G71 K72 T73 L79	G71-K75 WeakPolarHBondContact O-CG 3.33Å; G71-K75 PolarHBondContact O-N 3.3Å; K72-K75 WeakPolarHBondContact O-CB 3.44Å; K72-K75 PolarHBondContact O-N 2.93Å; T73-K75 PolarHBondContact O-N 3.04Å; K75-L79 PolarHBondContact O-N 3.45Å
76	I	74.1	Confident	75.8	Confident	101 Å²	101	94.2 Å²	94.2	52%	0.518	47%	0.465	S	S	.	.	H	α-helix	trans	-66.6	-43.7	175.3	-67.1	169	0	0	0	110.2	K72 T73 K78 L79 A80	K72-I76 WeakPolarHBondContact O-CG1 3.48Å; K72-I76 PolarHBondContact O-N 3.32Å; T73-I76 PolarHBondContact O-N 2.92Å; T73-I76 VanDerWaalsContact O-N 3.08Å; I76-K78 PolarHBondContact O-N 2.87Å; I76-L79 WeakPolarHBondContact O-CB 3.29Å; I76-L79 PolarHBondContact O-N 3.49Å; I76-L79 VanDerWaalsContact O-N 3.14Å; I76-A80 PolarHBondContact O-N 3.45Å
77	E	75.2	Confident	75.9	Confident	114 Å²	114	96.4 Å²	96.4	53%	0.533	48%	0.476	S	S	.	.	H	α-helix	trans	-59	-46.2	175.5	-71.9	168.8	170.2	0	0	111.4	T73 L79 A80 E81	T73-E77 WeakPolarHBondContact O-CG 3.47Å; T73-E77 PolarHBondContact O-N 2.99Å; E77-L79 VanDerWaalsContact C-N 3.31Å; E77-L79 PolarHBondContact O-N 3.32Å; E77-A80 WeakPolarHBondContact O-CB 3.3Å; E77-A80 PolarHBondContact O-N 2.97Å; E77-A80 VanDerWaalsContact O-N 3.16Å; E77-E81 WeakPolarHBondContact O-CG 3.31Å; E77-E81 PolarHBondContact O-N 3.19Å
78	K	76.9	Confident	75.8	Confident	134 Å²	134	93.3 Å²	93.3	58%	0.583	46%	0.464	S	S	*	.	H	α-helix	trans	-60.9	-37.3	174.1	-77.4	-177.2	178.7	-172.2	0	113.5	A74 I76 E81 H82	A74-K78 WeakPolarHBondContact O-CG 3.48Å; A74-K78 PolarHBondContact O-N 3.02Å; I76-K78 PolarHBondContact O-N 2.87Å; K78-E81 PolarHBondContact O-N 3.39Å; K78-H82 PolarHBondContact O-CD2 3.02Å; K78-H82 PolarHBondContact O-N 2.94Å
79	L	71.9	Confident	75.6	Confident	83 Å²	83	93.9 Å²	93.9	44%	0.435	47%	0.467	S	S	.	.	H	α-helix	trans	-65.8	-42.7	175.7	-170	73.8	0	0	0	110.6	T31 K75 I76 E77 E81 H82 V83	T31-L79 HydrophobicContact CG2-CD2 4.02Å; K75-L79 PolarHBondContact O-N 3.45Å; I76-L79 WeakPolarHBondContact O-CB 3.29Å; I76-L79 PolarHBondContact O-N 3.49Å; I76-L79 VanDerWaalsContact O-N 3.14Å; E77-L79 VanDerWaalsContact C-N 3.31Å; E77-L79 PolarHBondContact O-N 3.32Å; L79-E81 VanDerWaalsContact C-N 3.35Å; L79-E81 PolarHBondContact O-N 3.37Å; L79-H82 WeakPolarHBondContact O-CB 3.49Å; L79-H82 PolarHBondContact O-N 3.04Å; L79-V83 WeakPolarHBondContact O-CG2 3.38Å; L79-V83 PolarHBondContact O-N 3.49Å
80	A	74.9	Confident	75.4	Confident	51 Å²	51	94.1 Å²	94.1	42%	0.421	47%	0.468	S	S	.	.	H	α-helix	trans	-61.1	-42.7	175.3	0	0	0	0	0	111.7	I76 E77 H82 V83 L84	I76-A80 PolarHBondContact O-N 3.45Å; E77-A80 WeakPolarHBondContact O-CB 3.3Å; E77-A80 PolarHBondContact O-N 2.97Å; E77-A80 VanDerWaalsContact O-N 3.16Å; A80-H82 VanDerWaalsContact C-N 3.33Å; A80-H82 PolarHBondContact O-N 3.29Å; A80-V83 PolarHBondContact O-N 3.28Å; A80-L84 WeakPolarHBondContact O-CG 3.4Å; A80-L84 PolarHBondContact O-N 2.89Å
81	E	82.8	Confident	75.2	Confident	103 Å²	103	88.7 Å²	88.7	48%	0.481	45%	0.453	S	S	.	.	H	α-helix	trans	-61.6	-37.6	173.9	-72.2	175.3	-175.5	0	0	113.1	E77 K78 L79 R85	E77-E81 WeakPolarHBondContact O-CG 3.31Å; E77-E81 PolarHBondContact O-N 3.19Å; K78-E81 PolarHBondContact O-N 3.39Å; L79-E81 VanDerWaalsContact C-N 3.35Å; L79-E81 PolarHBondContact O-N 3.37Å; E81-R85 PolarHBondContact O-N 3.49Å
82	H	76	Confident	75	Confident	96 Å²	96	95.6 Å²	95.6	44%	0.444	47%	0.467	S	S	.	.	H	α-helix	trans	-66.6	-43.8	175.4	-81.8	-160.4	0	0	0	111.4	K78 L79 A80 L84 R85 W86	K78-H82 PolarHBondContact O-CD2 3.02Å; K78-H82 PolarHBondContact O-N 2.94Å; L79-H82 WeakPolarHBondContact O-CB 3.49Å; L79-H82 PolarHBondContact O-N 3.04Å; A80-H82 VanDerWaalsContact C-N 3.33Å; A80-H82 PolarHBondContact O-N 3.29Å; H82-L84 VanDerWaalsContact C-N 3.35Å; H82-L84 PolarHBondContact O-N 3.19Å; H82-R85 PolarHBondContact CD2-NH2 2.98Å; H82-R85 VanDerWaalsContact CD2-NH2 3.3Å; H82-R85 PolarHBondContact O-N 3.4Å; H82-W86 PolarHBondContact O-N 3.09Å
83	V	73	Confident	74.9	Confident	81 Å²	81	99.3 Å²	99.3	49%	0.491	49%	0.485	S	S	.	.	H	α-helix	trans	-62.8	-41.9	177.2	171.7	0	0	0	0	111.3	L79 A80 W86 N87	L79-V83 WeakPolarHBondContact O-CG2 3.38Å; L79-V83 PolarHBondContact O-N 3.49Å; A80-V83 PolarHBondContact O-N 3.28Å; V83-W86 PolarHBondContact O-N 3.47Å; V83-N87 PolarHBondContact O-N 3.4Å
84	L	77.5	Confident	74.4	Confident	109 Å²	109	103 Å²	103	57%	0.571	50%	0.5	S	S	*	.	H	α-helix	trans	-63.6	-45.7	176	-72.7	170.8	0	0	0	111.9	A80 H82 W86 N87 D88	A80-L84 WeakPolarHBondContact O-CG 3.4Å; A80-L84 PolarHBondContact O-N 2.89Å; H82-L84 VanDerWaalsContact C-N 3.35Å; H82-L84 PolarHBondContact O-N 3.19Å; L84-W86 VanDerWaalsContact C-N 3.29Å; L84-W86 PolarHBondContact O-N 2.99Å; L84-N87 WeakPolarHBondContact O-CB 3.43Å; L84-N87 PolarHBondContact O-N 3.35Å; L84-N87 VanDerWaalsContact O-N 3.16Å; L84-D88 PolarHBondContact O-N 3.35Å
85	R	78.1	Confident	73.9	Confident	126 Å²	126	108.6 Å²	108.6	48%	0.475	52%	0.519	S	S	.	.	H	α-helix	trans	-59.1	-40.4	174.6	-93	-176.3	-82.3	172.6	-10	112.7	E81 H82 D88 E89	E81-R85 PolarHBondContact O-N 3.49Å; H82-R85 PolarHBondContact CD2-NH2 2.98Å; H82-R85 VanDerWaalsContact CD2-NH2 3.3Å; H82-R85 PolarHBondContact O-N 3.4Å; R85-D88 PolarHBondContact O-N 2.98Å; R85-E89 WeakPolarHBondContact O-CG 3.44Å; R85-E89 PolarHBondContact O-N 3.37Å
86	W	77.8	Confident	72.6	Confident	98 Å²	98	112 Å²	112	37%	0.371	53%	0.528	S	S	.	.	H	α-helix	trans	-65.1	-40.1	176.2	-78.4	14.2	0	0	0	112.1	F24 Q27 H82 V83 L84 D88 E89 L90	F24-W86 HydrophobicContact CD2-CZ3 4.21Å; Q27-W86 VanDerWaalsContact OE1-CH2 3.3Å; H82-W86 PolarHBondContact O-N 3.09Å; V83-W86 PolarHBondContact O-N 3.47Å; L84-W86 VanDerWaalsContact C-N 3.29Å; L84-W86 PolarHBondContact O-N 2.99Å; W86-D88 VanDerWaalsContact C-N 3.34Å; W86-E89 PolarHBondContact O-N 3.42Å; W86-L90 WeakPolarHBondContact O-CB 3.46Å; W86-L90 PolarHBondContact O-N 3.06Å
87	N	75.4	Confident	71.4	Confident	83 Å²	83	112 Å²	112	44%	0.444	53%	0.534	S	S	.	.	H	α-helix	trans	-59.5	-46.9	173.7	-173.6	77.5	0	0	0	111.1	V83 L84 E89 L90 D91	V83-N87 PolarHBondContact O-N 3.4Å; L84-N87 WeakPolarHBondContact O-CB 3.43Å; L84-N87 PolarHBondContact O-N 3.35Å; L84-N87 VanDerWaalsContact O-N 3.16Å; N87-E89 VanDerWaalsContact C-N 3.33Å; N87-E89 PolarHBondContact O-N 3.16Å; N87-L90 PolarHBondContact O-N 3.32Å; N87-D91 PolarHBondContact ND2-OD2 2.95Å; N87-D91 PolarHBondContact O-N 3Å
88	D	77.8	Confident	70.3	Confident	81 Å²	81	111.1 Å²	111.1	43%	0.433	54%	0.539	S	S	.	.	H	α-helix	trans	-63.3	-37	178.4	-65.9	-14.8	0	0	0	112.9	L84 R85 W86 R92	L84-D88 PolarHBondContact O-N 3.35Å; R85-D88 PolarHBondContact O-N 2.98Å; W86-D88 VanDerWaalsContact C-N 3.34Å; D88-R92 WeakPolarHBondContact O-CB 3.34Å; D88-R92 VanDerWaalsContact O-CG 3.24Å; D88-R92 WeakPolarHBondContact O-CG 3.47Å; D88-R92 PolarHBondContact O-N 2.99Å
89	E	73.3	Confident	69.2	Low	112 Å²	112	108.2 Å²	108.2	52%	0.523	54%	0.54	S	S	.	.	H	α-helix	trans	-65.4	-42	174.6	-78	173.3	-173.1	0	0	111.5	R85 W86 N87 R92 E93	R85-E89 WeakPolarHBondContact O-CG 3.44Å; R85-E89 PolarHBondContact O-N 3.37Å; W86-E89 PolarHBondContact O-N 3.42Å; N87-E89 VanDerWaalsContact C-N 3.33Å; N87-E89 PolarHBondContact O-N 3.16Å; E89-R92 PolarHBondContact O-N 2.95Å; E89-E93 PolarHBondContact O-N 3.29Å
90	L	71.8	Confident	68	Low	84 Å²	84	112.1 Å²	112.1	44%	0.44	56%	0.555	S	S	.	*	H	α-helix	trans	-67.1	-42.7	179.1	-147.5	138.9	0	0	0	111.1	W86 N87 R92 E93 M94	W86-L90 WeakPolarHBondContact O-CB 3.46Å; W86-L90 PolarHBondContact O-N 3.06Å; N87-L90 PolarHBondContact O-N 3.32Å; L90-R92 VanDerWaalsContact C-N 3.35Å; L90-R92 PolarHBondContact O-N 2.95Å; L90-E93 PolarHBondContact O-N 3.44Å; L90-M94 HydrophobicContact CD2-SD 3.81Å; L90-M94 WeakPolarHBondContact O-CB 3.24Å; L90-M94 VanDerWaalsContact O-CG 3.31Å; L90-M94 WeakPolarHBondContact O-CG 3.44Å; L90-M94 PolarHBondContact O-N 3.31Å
91	D	71.5	Confident	66.7	Low	71 Å²	71	121.7 Å²	121.7	38%	0.38	58%	0.581	S	S	.	*	H	α-helix	trans	-61.7	-41.1	174.1	-74.4	-28.9	0	0	0	111.4	N87 M94 E95	N87-D91 PolarHBondContact ND2-OD2 2.95Å; N87-D91 PolarHBondContact O-N 3Å; D91-M94 PolarHBondContact O-N 3.23Å; D91-E95 WeakPolarHBondContact O-CB 3.44Å; D91-E95 WeakPolarHBondContact O-CG 3.46Å; D91-E95 PolarHBondContact O-N 3.25Å
92	R	74.5	Confident	65	Low	184 Å²	184	121.2 Å²	121.2	69%	0.694	58%	0.581	S	S	*	*	H	α-helix	trans	-66.3	-37.7	175.4	-76.5	174.7	-172.7	-179.5	6.2	113.6	D88 E89 L90 M94 R96	D88-R92 WeakPolarHBondContact O-CB 3.34Å; D88-R92 VanDerWaalsContact O-CG 3.24Å; D88-R92 WeakPolarHBondContact O-CG 3.47Å; D88-R92 PolarHBondContact O-N 2.99Å; E89-R92 PolarHBondContact O-N 2.95Å; L90-R92 VanDerWaalsContact C-N 3.35Å; L90-R92 PolarHBondContact O-N 2.95Å; R92-M94 VanDerWaalsContact C-N 3.29Å; R92-R96 PolarHBondContact O-N 2.96Å
93	E	66.7	Low	63.5	Low	134 Å²	134	122.4 Å²	122.4	63%	0.626	60%	0.597	S	S	*	*	H	α-helix	trans	-66.7	-34.9	174.2	-75.4	-166.8	163.8	0	0	111.6	E89 L90	E89-E93 PolarHBondContact O-N 3.29Å; L90-E93 PolarHBondContact O-N 3.44Å
94	M	63.7	Low	62.4	Low	142 Å²	142	130.1 Å²	130.1	70%	0.7	62%	0.617	S	S	*	*	H	α-helix	trans	-74.2	-34.7	176.1	-72.4	-176.9	60.5	0	0	113.5	L90 D91 R92 R96	L90-M94 HydrophobicContact CD2-SD 3.81Å; L90-M94 WeakPolarHBondContact O-CB 3.24Å; L90-M94 VanDerWaalsContact O-CG 3.31Å; L90-M94 WeakPolarHBondContact O-CG 3.44Å; L90-M94 PolarHBondContact O-N 3.31Å; D91-M94 PolarHBondContact O-N 3.23Å; R92-M94 VanDerWaalsContact C-N 3.29Å; M94-R96 VanDerWaalsContact C-N 3.31Å
95	E	64	Low	60.9	Low	159 Å²	159	129.9 Å²	129.9	74%	0.743	62%	0.624	S	S	*	*	H	α-helix	trans	-77.3	-14.1	176.7	-76.6	-166.8	160.7	0	0	113.7	D91 P97	D91-E95 WeakPolarHBondContact O-CB 3.44Å; D91-E95 WeakPolarHBondContact O-CG 3.46Å; D91-E95 PolarHBondContact O-N 3.25Å; E95-P97 WeakPolarHBondContact O-CD 3.09Å
96	R	46.8	Very low	59.5	Low	206 Å²	206	129.5 Å²	129.5	78%	0.777	64%	0.641	S	S	*	*			trans	-62.6	108.7	179.3	-157	176.3	-170.1	179.7	4.2	109	R92 M94	R92-R96 PolarHBondContact O-N 2.96Å; M94-R96 VanDerWaalsContact C-N 3.31Å
97	P	50.8	Low	58	Low	101 Å²	101	130.9 Å²	130.9	66%	0.656	66%	0.661	S	S	*	*			trans	-63.9	140.9	-179	-12.4	26.6	0	0	0	107.6	E95 A99	E95-P97 WeakPolarHBondContact O-CD 3.09Å; P97-A99 VanDerWaalsContact C-N 3.33Å; P97-A99 PolarHBondContact O-N 3.03Å
98	P	51.6	Low	56.9	Low	96 Å²	96	132.3 Å²	132.3	62%	0.623	68%	0.675	S	S	*	*			trans	-57.9	107.4	161.9	23.9	-29.4	0	0	0	106.6	H100	P98-H100 PolarHBondContact O-N 3.33Å; P98-H100 VanDerWaalsContact O-N 3.16Å
99	A	53.4	Low	55.7	Low	73 Å²	73	132.8 Å²	132.8	60%	0.603	69%	0.689	S	S	*	*	S	Bend	trans	-51.7	126.9	167.7	0	0	0	0	0	106.8	P97	P97-A99 VanDerWaalsContact C-N 3.33Å; P97-A99 PolarHBondContact O-N 3.03Å
100	H	47.6	Very low	54.6	Low	164 Å²	164	133.6 Å²	133.6	76%	0.759	70%	0.704	S	S	*	*			trans	95.9	81.2	-167.9	-51.8	-49.5	0	0	0	115.2	P98 L102	P98-H100 PolarHBondContact O-N 3.33Å; P98-H100 VanDerWaalsContact O-N 3.16Å; H100-L102 PolarHBondContact O-N 2.84Å
101	R	45.7	Very low	53.9	Low	253 Å²	253	133.5 Å²	133.5	96%	0.955	72%	0.716	S	S	*	*			trans	-54.5	96.2	136.5	-71.6	-176.4	178.7	-173.7	0.1	107.5
102	L	47.7	Very low	53.2	Low	93 Å²	93	135.4 Å²	135.4	49%	0.487	73%	0.732	S	S	.	*			trans	-64.5	135.9	162.4	-68.9	159.6	0	0	0	107.2	Q2 H100 R104	Q2-L102 VanDerWaalsContact CD-CD1 3.48Å; Q2-L102 HydrophobicContact CG-CD1 4.39Å; H100-L102 PolarHBondContact O-N 2.84Å; L102-R104 PolarHBondContact O-N 3.27Å
103	P	44.9	Very low	52.3	Low	120 Å²	120	132.7 Å²	132.7	78%	0.779	74%	0.739	S	S	*	*			trans	-56.3	127.8	172.6	23	-29.9	0	0	0	107.8	S105	P103-S105 PolarHBondContact O-N 3.23Å
104	R	49.3	Very low	51.2	Low	243 Å²	243	135.8 Å²	135.8	92%	0.917	75%	0.75	S	S	*	*			trans	-52.5	114.5	173.9	-77.3	177.6	166.4	172.3	-5.2	107.5	L102 S106	L102-R104 PolarHBondContact O-N 3.27Å; R104-S106 PolarHBondContact O-N 3.1Å
105	S	46.4	Very low	50.4	Low	104 Å²	104	135.1 Å²	135.1	73%	0.727	75%	0.749	S	S	*	*			trans	-63.9	123.5	168.4	63.9	0	0	0	0	107.4	P103 T107	P103-S105 PolarHBondContact O-N 3.23Å; S105-T107 PolarHBondContact O-N 3.48Å
106	S	49.8	Very low	49.7	Very low	118 Å²	118	134.5 Å²	134.5	83%	0.825	75%	0.751	S	S	*	*			trans	-51.4	105.6	171.8	-37.6	0	0	0	0	109.2	R104	R104-S106 PolarHBondContact O-N 3.1Å
107	T	46.1	Very low	49.7	Very low	127 Å²	127	128.2 Å²	128.2	78%	0.779	74%	0.739	S	S	*	*			trans	-64.1	126.3	172	-35.7	0	0	0	0	107.8	S105	S105-T107 PolarHBondContact O-N 3.48Å
108	P	51	Low	49.6	Very low	114 Å²	114	129.3 Å²	129.3	74%	0.74	74%	0.743	S	S	*	*			trans	-63.5	146.6	164.4	-9.3	24.8	0	0	0	108.5
109	A	53	Low	49.4	Very low	90 Å²	90	128.9 Å²	128.9	74%	0.744	75%	0.748	S	S	*	*			trans	-45	148.7	-175.4	0	0	0	0	0	113.8	A111	A109-A111 PolarHBondContact O-N 3.16Å
110	P	51.1	Low	49	Very low	129 Å²	129	135.6 Å²	135.6	84%	0.838	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-58.2	128.3	178.2	23.5	-31.5	0	0	0	110.5
111	A	57.1	Low	49	Very low	82 Å²	82	137.8 Å²	137.8	68%	0.678	76%	0.762	S	S	*	*	P	Polyproline II helix	trans	-58.1	148.8	170	0	0	0	0	0	110.2	A109	A109-A111 PolarHBondContact O-N 3.16Å
112	P	56.4	Low	49	Very low	112 Å²	112	135.8 Å²	135.8	73%	0.727	76%	0.761	S	S	*	*	P	Polyproline II helix	trans	-59.6	151	-178.7	24.8	-33.2	0	0	0	111.3	F114	P112-F114 PolarHBondContact O-N 2.81Å
113	P	55.8	Low	49	Very low	127 Å²	127	139.9 Å²	139.9	83%	0.825	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-59.6	135.8	-177.2	24.5	-32.5	0	0	0	110.5	D115	P113-D115 PolarHBondContact O-N 2.93Å
114	F	43.3	Very low	48.8	Very low	199 Å²	199	142.8 Å²	142.8	87%	0.873	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-55.8	134.7	177	-71.5	-90.8	0	0	0	111	P112	P112-F114 PolarHBondContact O-N 2.81Å
115	D	45.4	Very low	48.2	Very low	127 Å²	127	140.5 Å²	140.5	68%	0.679	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-65.8	127	174.6	-172	14.2	0	0	0	110	P113 S117	P113-D115 PolarHBondContact O-N 2.93Å; D115-S117 PolarHBondContact O-N 2.96Å; D115-S117 PolarHBondContact OD2-OG 3.26Å
116	N	49.6	Very low	48	Very low	147 Å²	147	149.4 Å²	149.4	79%	0.786	81%	0.806	S	S	*	*	G	3₁₀ helix	trans	-73.8	13.1	-174.1	-99.9	-12.1	0	0	0	113.6	V118	N116-V118 VanDerWaalsContact C-N 3.33Å; N116-V118 PolarHBondContact O-N 3.01Å
117	S	47.8	Very low	47.9	Very low	73 Å²	73	151 Å²	151	51%	0.51	81%	0.805	S	S	.	*	G	3₁₀ helix	trans	-81	-6.3	-175.7	51.6	0	0	0	0	114.3	D115	D115-S117 PolarHBondContact O-N 2.96Å; D115-S117 PolarHBondContact OD2-OG 3.26Å
118	V	48.6	Very low	48	Very low	125 Å²	125	152.2 Å²	152.2	76%	0.758	81%	0.806	S	S	*	*	G	3₁₀ helix	trans	-95	-11.9	-177	-169.2	0	0	0	0	113.4	N116 Y120	N116-V118 VanDerWaalsContact C-N 3.33Å; N116-V118 PolarHBondContact O-N 3.01Å; V118-Y120 VanDerWaalsContact C-N 3.27Å; V118-Y120 PolarHBondContact O-N 3.2Å
119	A	46.6	Very low	47.8	Very low	86 Å²	86	154.3 Å²	154.3	71%	0.711	81%	0.81	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.2	-3.1	-176.6	0	0	0	0	0	115.1
120	Y	45	Very low	47.5	Very low	214 Å²	214	158.1 Å²	158.1	84%	0.839	81%	0.814	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.3	9.5	-169.9	-106	-81.6	0	0	0	116.5	V118	V118-Y120 VanDerWaalsContact C-N 3.27Å; V118-Y120 PolarHBondContact O-N 3.2Å
121	Y	48.4	Very low	47.3	Very low	211 Å²	211	159.9 Å²	159.9	83%	0.827	81%	0.812	S	S	*	*	S	Bend	trans	-109.3	10.8	-176.2	-96.5	-79.7	0	0	0	116.3
122	F	46.7	Very low	46.6	Very low	210 Å²	210	165.1 Å²	165.1	92%	0.921	82%	0.821	S	S	*	*	S	Bend	trans	-123.3	9.7	-179.2	-96.6	-77.4	0	0	0	116.4
123	E	45.7	Very low	45.9	Very low	179 Å²	179	168.9 Å²	168.9	84%	0.836	83%	0.828	S	S	*	*	S	Bend	trans	-114.4	2.5	-178.6	-97.7	-171.1	165.8	0	0	117.2
124	H	42.4	Very low	45.2	Very low	181 Å²	181	172.2 Å²	172.2	84%	0.838	83%	0.828	S	S	*	*			trans	-144.1	101.2	173	-75.4	-68.2	0	0	0	112.8
125	Q	36.8	Very low	45.3	Very low	196 Å²	196	169.9 Å²	169.9	92%	0.916	83%	0.825	S	S	*	*				-179.9	84.7	125.9	-95.2	173.1	20.6	0	0	110.2
126	F	40.9	Very low	45.3	Very low	290 Å²	290	173.8 Å²	173.8	100%	1.272	84%	0.838	S	S	*	*				-97.1	0	127.8	-84.5	-79.5	0	0	0	107

Retrieved 126 of 126 residues in 35.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).