X5ML92_CAEEL Loading...

Aa_trans domain-containing protein

AlphaFold DB , UniProt , Accession X5ML92, Species CAEEL (Caenorhabditis elegans), Gene n/a, Length 81 aa.

						>X5ML92_CAEEL|X5ML92
MLVEMKEQQKIQQELIVRQEQIVAQLNKKSEILANATAEGEAASEAAKIPEKLAPPENVETMEKEGKAAAESEKKAVNTET
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71.1	Confident	90.5	Very high	172 Å²	172	122.7 Å²	122.7	85%	0.847	60%	0.596	S	S	*	*				0	-70.1	0	-148.1	172.8	135	0	0	114.3	V3 E4 M5	M1-V3 VanDerWaalsContact C-N 3.33Å; M1-V3 PolarHBondContact O-N 2.86Å; M1-E4 WeakPolarHBondContact CA-OE2 3.36Å; M1-E4 PolarHBondContact N-OE2 3.39Å; M1-E4 PolarHBondContact O-N 3.4Å; M1-M5 WeakPolarHBondContact O-CG 3.45Å; M1-M5 PolarHBondContact O-N 3.36Å; M1-M5 VanDerWaalsContact O-N 3.13Å
2	L	84.3	Confident	91.1	Very high	129 Å²	129	122.3 Å²	122.3	68%	0.675	59%	0.592	S	S	*	*	H	α-helix	trans	-70.4	-27.7	-176.7	-154.2	133.5	0	0	0	113.7	K6	L2-K6 PolarHBondContact O-N 3.32Å
3	V	84.6	Confident	91.6	Very high	101 Å²	101	123.4 Å²	123.4	61%	0.612	60%	0.595	S	S	*	*	H	α-helix	trans	-70.5	-46.8	173.2	177.5	0	0	0	0	111.1	M1 M5 K6 E7	M1-V3 VanDerWaalsContact C-N 3.33Å; M1-V3 PolarHBondContact O-N 2.86Å; V3-M5 VanDerWaalsContact C-N 3.31Å; V3-M5 PolarHBondContact O-N 3.4Å; V3-K6 PolarHBondContact O-N 3.2Å; V3-K6 VanDerWaalsContact O-N 3.11Å; V3-E7 PolarHBondContact O-N 3.42Å
4	E	90.2	Very high	92.1	Very high	114 Å²	114	122.6 Å²	122.6	53%	0.533	59%	0.591	S	S	.	*	H	α-helix	trans	-60.8	-37.7	177.9	-66.3	151.2	171.1	0	0	112	M1 K6 E7 Q8	M1-E4 WeakPolarHBondContact CA-OE2 3.36Å; M1-E4 PolarHBondContact N-OE2 3.39Å; M1-E4 PolarHBondContact O-N 3.4Å; E4-K6 PolarHBondContact O-N 3.16Å; E4-E7 PolarHBondContact O-N 3.31Å; E4-Q8 WeakPolarHBondContact O-CG 3.42Å; E4-Q8 PolarHBondContact O-N 3.41Å
5	M	92.9	Very high	92.5	Very high	104 Å²	104	120.7 Å²	120.7	51%	0.512	58%	0.584	S	S	.	*	H	α-helix	trans	-64.3	-38.1	175.4	-71.6	-174.9	76.6	0	0	112.7	M1 V3 Q8 Q9	M1-M5 WeakPolarHBondContact O-CG 3.45Å; M1-M5 PolarHBondContact O-N 3.36Å; M1-M5 VanDerWaalsContact O-N 3.13Å; V3-M5 VanDerWaalsContact C-N 3.31Å; V3-M5 PolarHBondContact O-N 3.4Å; M5-Q8 PolarHBondContact O-N 3.26Å; M5-Q9 WeakPolarHBondContact O-CG 3.4Å; M5-Q9 PolarHBondContact O-N 3.48Å
6	K	93.4	Very high	92.8	Very high	134 Å²	134	118.5 Å²	118.5	58%	0.583	58%	0.575	S	S	*	*	H	α-helix	trans	-68.5	-38.8	176.6	-73.4	-178.6	176.9	-177.2	0	111.7	L2 V3 E4 Q9 K10	L2-K6 PolarHBondContact O-N 3.32Å; V3-K6 PolarHBondContact O-N 3.2Å; V3-K6 VanDerWaalsContact O-N 3.11Å; E4-K6 PolarHBondContact O-N 3.16Å; K6-Q9 PolarHBondContact O-N 3.28Å; K6-K10 PolarHBondContact O-N 3.4Å
7	E	94.8	Very high	93.1	Very high	117 Å²	117	115.4 Å²	115.4	55%	0.547	57%	0.565	S	S	.	*	H	α-helix	trans	-64.1	-43.2	174.6	-72.9	176.1	173.2	0	0	111.5	V3 E4 Q9 K10 I11	V3-E7 PolarHBondContact O-N 3.42Å; E4-E7 PolarHBondContact O-N 3.31Å; E7-Q9 VanDerWaalsContact C-N 3.35Å; E7-Q9 PolarHBondContact O-N 3.08Å; E7-K10 WeakPolarHBondContact O-CB 3.36Å; E7-K10 PolarHBondContact O-N 2.72Å; E7-I11 WeakPolarHBondContact O-CG1 3.47Å; E7-I11 PolarHBondContact O-N 3.26Å
8	Q	94.9	Very high	93.4	Very high	118 Å²	118	118.7 Å²	118.7	55%	0.551	57%	0.57	S	S	*	*	H	α-helix	trans	-60.8	-41.9	174.4	-74.3	179	0.2	0	0	112.5	E4 M5 K10 I11 Q12	E4-Q8 WeakPolarHBondContact O-CG 3.42Å; E4-Q8 PolarHBondContact O-N 3.41Å; M5-Q8 PolarHBondContact O-N 3.26Å; Q8-K10 VanDerWaalsContact C-N 3.33Å; Q8-K10 PolarHBondContact O-N 2.98Å; Q8-I11 PolarHBondContact O-N 3.02Å; Q8-Q12 WeakPolarHBondContact O-CG 3.25Å; Q8-Q12 PolarHBondContact O-N 3.25Å
9	Q	95.5	Very high	93.6	Very high	121 Å²	121	117.9 Å²	117.9	57%	0.565	57%	0.565	S	S	*	*	H	α-helix	trans	-61.7	-41.3	175.2	-76	175.3	-13.4	0	0	112.1	M5 K6 E7 Q12 Q13	M5-Q9 WeakPolarHBondContact O-CG 3.4Å; M5-Q9 PolarHBondContact O-N 3.48Å; K6-Q9 PolarHBondContact O-N 3.28Å; E7-Q9 VanDerWaalsContact C-N 3.35Å; E7-Q9 PolarHBondContact O-N 3.08Å; Q9-Q12 PolarHBondContact O-N 2.91Å; Q9-Q13 WeakPolarHBondContact O-CB 3.45Å; Q9-Q13 PolarHBondContact O-N 2.89Å
10	K	96.9	Very high	93.9	Very high	131 Å²	131	118.3 Å²	118.3	57%	0.57	57%	0.566	S	S	*	*	H	α-helix	trans	-62.2	-45.9	176.3	-170.4	-175.5	179	-165.9	0	111.5	K6 E7 Q8 Q12 Q13 E14	K6-K10 PolarHBondContact O-N 3.4Å; E7-K10 WeakPolarHBondContact O-CB 3.36Å; E7-K10 PolarHBondContact O-N 2.72Å; Q8-K10 VanDerWaalsContact C-N 3.33Å; Q8-K10 PolarHBondContact O-N 2.98Å; K10-Q12 VanDerWaalsContact C-N 3.33Å; K10-Q12 PolarHBondContact O-N 3.37Å; K10-Q13 PolarHBondContact O-N 3.27Å; K10-E14 VanDerWaalsContact CE-OE1 3.23Å; K10-E14 WeakPolarHBondContact CE-OE1 3.4Å; K10-E14 IonicContact NZ-OE1 3.95Å; K10-E14 WeakPolarHBondContact O-CG 3.47Å; K10-E14 PolarHBondContact O-N 3.34Å
11	I	97.4	Very high	94.1	Very high	109 Å²	109	118 Å²	118	56%	0.559	57%	0.565	S	S	*	*	H	α-helix	trans	-60.3	-43.9	176.8	-67.5	165.1	0	0	0	110.8	E7 Q8 Q13 E14 L15	E7-I11 WeakPolarHBondContact O-CG1 3.47Å; E7-I11 PolarHBondContact O-N 3.26Å; Q8-I11 PolarHBondContact O-N 3.02Å; I11-Q13 VanDerWaalsContact C-N 3.31Å; I11-Q13 PolarHBondContact O-N 2.92Å; I11-E14 PolarHBondContact O-N 2.92Å; I11-L15 WeakPolarHBondContact O-CB 3.49Å; I11-L15 PolarHBondContact O-N 3.27Å
12	Q	97.3	Very high	95.3	Very high	117 Å²	117	113.9 Å²	113.9	55%	0.547	55%	0.545	S	S	.	.	H	α-helix	trans	-62	-40.5	176.8	-73.9	178.8	16.5	0	0	111.7	Q8 Q9 K10 L15 I16	Q8-Q12 WeakPolarHBondContact O-CG 3.25Å; Q8-Q12 PolarHBondContact O-N 3.25Å; Q9-Q12 PolarHBondContact O-N 2.91Å; K10-Q12 VanDerWaalsContact C-N 3.33Å; K10-Q12 PolarHBondContact O-N 3.37Å; Q12-L15 WeakPolarHBondContact O-CB 3.44Å; Q12-L15 PolarHBondContact O-N 3.44Å; Q12-I16 VanDerWaalsContact O-CG1 3.28Å; Q12-I16 WeakPolarHBondContact O-CG1 3.33Å; Q12-I16 PolarHBondContact O-N 2.89Å
13	Q	97.9	Very high	96	Very high	137 Å²	137	111.4 Å²	111.4	64%	0.64	54%	0.535	S	S	*	.	H	α-helix	trans	-67.3	-42.5	178.6	-166.8	157.8	34.8	0	0	112.1	Q9 K10 I11 L15 I16 V17	Q9-Q13 WeakPolarHBondContact O-CB 3.45Å; Q9-Q13 PolarHBondContact O-N 2.89Å; K10-Q13 PolarHBondContact O-N 3.27Å; I11-Q13 VanDerWaalsContact C-N 3.31Å; I11-Q13 PolarHBondContact O-N 2.92Å; Q13-L15 VanDerWaalsContact C-N 3.29Å; Q13-L15 PolarHBondContact O-N 2.91Å; Q13-I16 PolarHBondContact O-N 3.06Å; Q13-V17 WeakPolarHBondContact O-CG2 3.34Å; Q13-V17 PolarHBondContact O-N 3.49Å
14	E	97.9	Very high	96.6	Very high	113 Å²	113	109.5 Å²	109.5	53%	0.528	53%	0.53	S	S	.	.	H	α-helix	trans	-61.3	-39	173.4	-71.8	175.9	-168.3	0	0	111.8	K10 I11 R18	K10-E14 VanDerWaalsContact CE-OE1 3.23Å; K10-E14 WeakPolarHBondContact CE-OE1 3.4Å; K10-E14 IonicContact NZ-OE1 3.95Å; K10-E14 WeakPolarHBondContact O-CG 3.47Å; K10-E14 PolarHBondContact O-N 3.34Å; I11-E14 PolarHBondContact O-N 2.92Å; E14-R18 WeakPolarHBondContact O-CB 3.46Å; E14-R18 PolarHBondContact O-N 2.81Å
15	L	98.3	Very high	96.9	Very high	94 Å²	94	109.7 Å²	109.7	49%	0.492	53%	0.531	S	S	.	.	H	α-helix	trans	-63.2	-45.7	175.8	178.9	62.5	0	0	0	111.8	I11 Q12 Q13 R18 Q19	I11-L15 WeakPolarHBondContact O-CB 3.49Å; I11-L15 PolarHBondContact O-N 3.27Å; Q12-L15 WeakPolarHBondContact O-CB 3.44Å; Q12-L15 PolarHBondContact O-N 3.44Å; Q13-L15 VanDerWaalsContact C-N 3.29Å; Q13-L15 PolarHBondContact O-N 2.91Å; L15-R18 PolarHBondContact O-N 2.93Å; L15-Q19 HydrophobicContact CD1-CG 4.48Å; L15-Q19 WeakPolarHBondContact O-CG 3.34Å; L15-Q19 PolarHBondContact O-N 3.01Å
16	I	98.1	Very high	97.1	Very high	85 Å²	85	109.2 Å²	109.2	44%	0.436	53%	0.53	S	S	.	.	H	α-helix	trans	-60.2	-50.2	177.9	-70.3	163.1	0	0	0	110.3	Q12 Q13 R18 Q19 E20	Q12-I16 VanDerWaalsContact O-CG1 3.28Å; Q12-I16 WeakPolarHBondContact O-CG1 3.33Å; Q12-I16 PolarHBondContact O-N 2.89Å; Q13-I16 PolarHBondContact O-N 3.06Å; I16-R18 PolarHBondContact O-N 3.07Å; I16-Q19 WeakPolarHBondContact O-CB 3.5Å; I16-Q19 PolarHBondContact O-N 3.18Å; I16-E20 HydrophobicContact CG2-CG 4.45Å; I16-E20 WeakPolarHBondContact O-CG 3.37Å; I16-E20 PolarHBondContact O-N 3.37Å
17	V	98	Very high	97.3	Very high	66 Å²	66	107.7 Å²	107.7	40%	0.4	53%	0.528	S	S	.	.	H	α-helix	trans	-57.2	-41.5	178.9	171.1	0	0	0	0	111	Q13 E20 Q21	Q13-V17 WeakPolarHBondContact O-CG2 3.34Å; Q13-V17 PolarHBondContact O-N 3.49Å; V17-E20 PolarHBondContact O-N 3.29Å; V17-Q21 WeakPolarHBondContact O-CG 3.5Å; V17-Q21 PolarHBondContact O-N 2.93Å; V17-Q21 VanDerWaalsContact O-N 3.1Å
18	R	98.1	Very high	97.4	Very high	175 Å²	175	108.7 Å²	108.7	66%	0.66	53%	0.53	S	S	*	.	H	α-helix	trans	-67.3	-38.1	177.6	-167.9	170.1	-174.8	166.9	0.9	112.5	E14 L15 I16 Q21 I22	E14-R18 WeakPolarHBondContact O-CB 3.46Å; E14-R18 PolarHBondContact O-N 2.81Å; L15-R18 PolarHBondContact O-N 2.93Å; I16-R18 PolarHBondContact O-N 3.07Å; R18-Q21 PolarHBondContact O-N 3.44Å; R18-I22 HydrophobicContact CG-CD1 4.31Å; R18-I22 VanDerWaalsContact O-CG1 3.3Å; R18-I22 WeakPolarHBondContact O-CG1 3.45Å; R18-I22 PolarHBondContact O-N 3.36Å; R18-I22 VanDerWaalsContact O-N 3.07Å
19	Q	97.7	Very high	97.4	Very high	103 Å²	103	109.2 Å²	109.2	48%	0.481	53%	0.531	S	S	.	.	H	α-helix	trans	-64.1	-44.2	175.2	-73.5	174.6	8.6	0	0	111.5	L15 I16 Q21 I22 V23	L15-Q19 HydrophobicContact CD1-CG 4.48Å; L15-Q19 WeakPolarHBondContact O-CG 3.34Å; L15-Q19 PolarHBondContact O-N 3.01Å; I16-Q19 WeakPolarHBondContact O-CB 3.5Å; I16-Q19 PolarHBondContact O-N 3.18Å; Q19-Q21 VanDerWaalsContact C-N 3.31Å; Q19-Q21 PolarHBondContact O-N 2.94Å; Q19-I22 PolarHBondContact O-N 2.94Å; Q19-I22 VanDerWaalsContact O-N 3.16Å; Q19-V23 WeakPolarHBondContact O-CG2 3.38Å; Q19-V23 PolarHBondContact O-N 3.01Å
20	E	98.1	Very high	97.4	Very high	126 Å²	126	106.8 Å²	106.8	59%	0.589	53%	0.527	S	S	*	.	H	α-helix	trans	-58.8	-43	176.2	-70.2	175.3	167	0	0	111.7	I16 V17 I22 V23 A24	I16-E20 HydrophobicContact CG2-CG 4.45Å; I16-E20 WeakPolarHBondContact O-CG 3.37Å; I16-E20 PolarHBondContact O-N 3.37Å; V17-E20 PolarHBondContact O-N 3.29Å; E20-I22 PolarHBondContact O-N 3.44Å; E20-V23 PolarHBondContact O-N 3.4Å; E20-A24 WeakPolarHBondContact O-CB 3.45Å; E20-A24 PolarHBondContact O-N 3.43Å
21	Q	98	Very high	97.2	Very high	113 Å²	113	106.4 Å²	106.4	53%	0.528	53%	0.527	S	S	.	.	H	α-helix	trans	-62	-42	175.3	-71.9	174.1	-2.3	0	0	112.5	V17 R18 Q19 A24 Q25	V17-Q21 WeakPolarHBondContact O-CG 3.5Å; V17-Q21 PolarHBondContact O-N 2.93Å; V17-Q21 VanDerWaalsContact O-N 3.1Å; R18-Q21 PolarHBondContact O-N 3.44Å; Q19-Q21 VanDerWaalsContact C-N 3.31Å; Q19-Q21 PolarHBondContact O-N 2.94Å; Q21-A24 PolarHBondContact O-N 3.1Å; Q21-Q25 WeakPolarHBondContact O-CG 3.3Å; Q21-Q25 PolarHBondContact O-N 3.45Å
22	I	97.8	Very high	96.9	Very high	84 Å²	84	105.8 Å²	105.8	43%	0.431	52%	0.524	S	S	.	.	H	α-helix	trans	-63.7	-46.3	177.4	-69.9	164.6	0	0	0	110.2	R18 Q19 E20 A24 Q25 L26	R18-I22 HydrophobicContact CG-CD1 4.31Å; R18-I22 VanDerWaalsContact O-CG1 3.3Å; R18-I22 WeakPolarHBondContact O-CG1 3.45Å; R18-I22 PolarHBondContact O-N 3.36Å; R18-I22 VanDerWaalsContact O-N 3.07Å; Q19-I22 PolarHBondContact O-N 2.94Å; Q19-I22 VanDerWaalsContact O-N 3.16Å; E20-I22 PolarHBondContact O-N 3.44Å; I22-A24 VanDerWaalsContact C-N 3.34Å; I22-A24 PolarHBondContact O-N 3.48Å; I22-Q25 PolarHBondContact O-N 3.25Å; I22-L26 HydrophobicContact CG2-CD1 3.93Å; I22-L26 HydrophobicContact CG2-CG 4.34Å; I22-L26 WeakPolarHBondContact O-CG 3.36Å; I22-L26 PolarHBondContact O-N 3.41Å
23	V	98.1	Very high	96.6	Very high	78 Å²	78	105.7 Å²	105.7	47%	0.473	53%	0.527	S	S	.	.	H	α-helix	trans	-60.6	-44.5	178	171.8	0	0	0	0	110.8	Q19 E20 Q25 L26 N27	Q19-V23 WeakPolarHBondContact O-CG2 3.38Å; Q19-V23 PolarHBondContact O-N 3.01Å; E20-V23 PolarHBondContact O-N 3.4Å; V23-Q25 VanDerWaalsContact C-N 3.34Å; V23-Q25 PolarHBondContact O-N 2.87Å; V23-L26 PolarHBondContact O-N 3.22Å; V23-N27 WeakPolarHBondContact O-CB 3.28Å; V23-N27 VanDerWaalsContact O-CG 3.25Å; V23-N27 PolarHBondContact O-N 3.43Å
24	A	97.6	Very high	96.2	Very high	60 Å²	60	101.9 Å²	101.9	50%	0.496	52%	0.519	S	S	.	.	H	α-helix	trans	-60.3	-42.4	176.5	0	0	0	0	0	112.4	E20 Q21 I22 K28	E20-A24 WeakPolarHBondContact O-CB 3.45Å; E20-A24 PolarHBondContact O-N 3.43Å; Q21-A24 PolarHBondContact O-N 3.1Å; I22-A24 VanDerWaalsContact C-N 3.34Å; I22-A24 PolarHBondContact O-N 3.48Å; A24-K28 WeakPolarHBondContact O-CB 3.23Å; A24-K28 PolarHBondContact O-N 2.94Å
25	Q	96.9	Very high	95.6	Very high	119 Å²	119	100.4 Å²	100.4	56%	0.556	51%	0.514	S	S	*	.	H	α-helix	trans	-66.6	-39.6	176.2	-72.7	-179.6	16.7	0	0	112.6	Q21 I22 V23 K28 K29	Q21-Q25 WeakPolarHBondContact O-CG 3.3Å; Q21-Q25 PolarHBondContact O-N 3.45Å; I22-Q25 PolarHBondContact O-N 3.25Å; V23-Q25 VanDerWaalsContact C-N 3.34Å; V23-Q25 PolarHBondContact O-N 2.87Å; Q25-K28 PolarHBondContact O-N 3.25Å; Q25-K29 WeakPolarHBondContact O-CG 3.35Å; Q25-K29 PolarHBondContact O-N 3.04Å
26	L	97.5	Very high	94.7	Very high	94 Å²	94	98.6 Å²	98.6	49%	0.492	51%	0.513	S	S	.	.	H	α-helix	trans	-63.5	-48.6	176.1	-74.9	173.2	0	0	0	110.7	I22 V23 K28 K29 S30	I22-L26 HydrophobicContact CG2-CD1 3.93Å; I22-L26 HydrophobicContact CG2-CG 4.34Å; I22-L26 WeakPolarHBondContact O-CG 3.36Å; I22-L26 PolarHBondContact O-N 3.41Å; V23-L26 PolarHBondContact O-N 3.22Å; L26-K28 VanDerWaalsContact C-N 3.3Å; L26-K28 PolarHBondContact O-N 3.29Å; L26-K29 PolarHBondContact O-N 2.96Å; L26-S30 WeakPolarHBondContact O-CB 3.41Å; L26-S30 PolarHBondContact O-N 3.07Å; L26-S30 PolarHBondContact O-OG 3.4Å
27	N	96	Very high	93.6	Very high	101 Å²	101	99.2 Å²	99.2	54%	0.54	52%	0.521	S	S	.	.	H	α-helix	trans	-56.8	-45.2	177.5	-70.5	-10.8	0	0	0	111.5	V23 K29 S30 E31	V23-N27 WeakPolarHBondContact O-CB 3.28Å; V23-N27 VanDerWaalsContact O-CG 3.25Å; V23-N27 PolarHBondContact O-N 3.43Å; N27-K29 PolarHBondContact O-N 3.03Å; N27-S30 PolarHBondContact O-N 3.31Å; N27-E31 PolarHBondContact O-N 3.04Å
28	K	96.4	Very high	92.3	Very high	139 Å²	139	98.9 Å²	98.9	60%	0.604	53%	0.525	S	S	*	.	H	α-helix	trans	-60.4	-42.8	175.9	-175.3	174.5	-177.7	175.5	0	112.4	A24 Q25 L26 I32	A24-K28 WeakPolarHBondContact O-CB 3.23Å; A24-K28 PolarHBondContact O-N 2.94Å; Q25-K28 PolarHBondContact O-N 3.25Å; L26-K28 VanDerWaalsContact C-N 3.3Å; L26-K28 PolarHBondContact O-N 3.29Å; K28-I32 HydrophobicContact CG-CD1 4.15Å; K28-I32 WeakPolarHBondContact O-CD1 3.35Å; K28-I32 VanDerWaalsContact O-CG1 3.25Å; K28-I32 WeakPolarHBondContact O-CG1 3.35Å; K28-I32 PolarHBondContact O-N 3.21Å; K28-I32 VanDerWaalsContact O-N 3.08Å
29	K	95.7	Very high	90.5	Very high	128 Å²	128	97.5 Å²	97.5	56%	0.557	53%	0.526	S	S	*	.	H	α-helix	trans	-66.9	-40.7	176.9	-74.1	177.5	-179.6	-178.8	0	111.8	Q25 L26 N27 E31 I32 L33	Q25-K29 WeakPolarHBondContact O-CG 3.35Å; Q25-K29 PolarHBondContact O-N 3.04Å; L26-K29 PolarHBondContact O-N 2.96Å; N27-K29 PolarHBondContact O-N 3.03Å; K29-E31 VanDerWaalsContact C-N 3.34Å; K29-I32 PolarHBondContact O-N 3.47Å; K29-L33 WeakPolarHBondContact O-CG 3.46Å; K29-L33 PolarHBondContact O-N 3.16Å
30	S	94.7	Very high	88.1	Confident	71 Å²	71	94.7 Å²	94.7	50%	0.497	53%	0.525	S	S	.	.	H	α-helix	trans	-61.4	-42.7	176.2	-67.2	0	0	0	0	111.7	L26 N27 L33 A34	L26-S30 WeakPolarHBondContact O-CB 3.41Å; L26-S30 PolarHBondContact O-N 3.07Å; L26-S30 PolarHBondContact O-OG 3.4Å; N27-S30 PolarHBondContact O-N 3.31Å; S30-L33 PolarHBondContact O-N 3.03Å; S30-A34 WeakPolarHBondContact O-CB 3.34Å; S30-A34 PolarHBondContact O-N 2.93Å
31	E	93	Very high	86	Confident	122 Å²	122	95.7 Å²	95.7	57%	0.57	53%	0.53	S	S	*	.	H	α-helix	trans	-61.7	-46.2	174.4	-174.8	-178.5	-174.2	0	0	111.6	N27 K29 L33 A34 N35	N27-E31 PolarHBondContact O-N 3.04Å; K29-E31 VanDerWaalsContact C-N 3.34Å; E31-L33 VanDerWaalsContact C-N 3.33Å; E31-L33 PolarHBondContact O-N 3.44Å; E31-A34 PolarHBondContact O-N 2.98Å; E31-N35 WeakPolarHBondContact O-CB 3.48Å; E31-N35 VanDerWaalsContact O-CG 3.24Å; E31-N35 PolarHBondContact O-N 3.34Å; E31-N35 PolarHBondContact O-ND2 3.45Å
32	I	92.5	Very high	83.6	Confident	97 Å²	97	94.1 Å²	94.1	50%	0.497	54%	0.536	S	S	.	.	H	α-helix	trans	-59.4	-44.5	176.7	-68.9	164.1	0	0	0	111.3	K28 K29 N35 A36	K28-I32 HydrophobicContact CG-CD1 4.15Å; K28-I32 WeakPolarHBondContact O-CD1 3.35Å; K28-I32 VanDerWaalsContact O-CG1 3.25Å; K28-I32 WeakPolarHBondContact O-CG1 3.35Å; K28-I32 PolarHBondContact O-N 3.21Å; K28-I32 VanDerWaalsContact O-N 3.08Å; K29-I32 PolarHBondContact O-N 3.47Å; I32-N35 PolarHBondContact O-N 3.39Å; I32-A36 WeakPolarHBondContact O-CB 3.38Å; I32-A36 PolarHBondContact O-N 3.19Å
33	L	90.7	Very high	81.3	Confident	115 Å²	115	93.5 Å²	93.5	60%	0.602	54%	0.543	S	S	*	.	H	α-helix	trans	-66.4	-39	178.7	-72	173.2	0	0	0	112.1	K29 S30 E31 T37	K29-L33 WeakPolarHBondContact O-CG 3.46Å; K29-L33 PolarHBondContact O-N 3.16Å; S30-L33 PolarHBondContact O-N 3.03Å; E31-L33 VanDerWaalsContact C-N 3.33Å; E31-L33 PolarHBondContact O-N 3.44Å; L33-T37 WeakPolarHBondContact O-CB 3.47Å; L33-T37 PolarHBondContact O-N 3.33Å; L33-T37 PolarHBondContact O-OG1 2.95Å
34	A	88.8	Confident	78.8	Confident	56 Å²	56	94 Å²	94	46%	0.463	55%	0.55	S	S	.	*	H	α-helix	trans	-62.8	-45.8	175.1	0	0	0	0	0	110.9	S30 E31 T37 A38	S30-A34 WeakPolarHBondContact O-CB 3.34Å; S30-A34 PolarHBondContact O-N 2.93Å; E31-A34 PolarHBondContact O-N 2.98Å; A34-T37 PolarHBondContact O-N 2.94Å; A34-A38 WeakPolarHBondContact O-CB 3.47Å; A34-A38 PolarHBondContact O-N 3.32Å
35	N	84.9	Confident	76.5	Confident	82 Å²	82	100 Å²	100	44%	0.439	57%	0.568	S	S	.	*	H	α-helix	trans	-64.4	-43.6	177.9	-67.4	-16.2	0	0	0	112	E31 I32 T37 A38 E39	E31-N35 WeakPolarHBondContact O-CB 3.48Å; E31-N35 VanDerWaalsContact O-CG 3.24Å; E31-N35 PolarHBondContact O-N 3.34Å; E31-N35 PolarHBondContact O-ND2 3.45Å; I32-N35 PolarHBondContact O-N 3.39Å; N35-T37 VanDerWaalsContact C-N 3.27Å; N35-T37 PolarHBondContact O-N 3.45Å; N35-A38 PolarHBondContact O-N 2.94Å; N35-E39 WeakPolarHBondContact O-CB 3.36Å; N35-E39 WeakPolarHBondContact O-CG 3.01Å; N35-E39 PolarHBondContact O-N 3.38Å
36	A	80.8	Confident	74.2	Confident	57 Å²	57	98.5 Å²	98.5	47%	0.471	58%	0.576	S	S	.	*	H	α-helix	trans	-63.1	-34.6	176	0	0	0	0	0	112.5	I32 G40	I32-A36 WeakPolarHBondContact O-CB 3.38Å; I32-A36 PolarHBondContact O-N 3.19Å; A36-G40 PolarHBondContact O-N 3.45Å
37	T	74.1	Confident	71.6	Confident	98 Å²	98	97.9 Å²	97.9	60%	0.601	59%	0.585	S	S	*	*	H	α-helix	trans	-69.8	-43.6	175.6	-53.8	0	0	0	0	110.9	L33 A34 N35 G40 E41	L33-T37 WeakPolarHBondContact O-CB 3.47Å; L33-T37 PolarHBondContact O-N 3.33Å; L33-T37 PolarHBondContact O-OG1 2.95Å; A34-T37 PolarHBondContact O-N 2.94Å; N35-T37 VanDerWaalsContact C-N 3.27Å; N35-T37 PolarHBondContact O-N 3.45Å; T37-G40 PolarHBondContact O-N 3.11Å; T37-E41 PolarHBondContact O-N 3.35Å; T37-E41 VanDerWaalsContact O-N 3.16Å
38	A	72	Confident	69.6	Low	58 Å²	58	102.6 Å²	102.6	48%	0.479	60%	0.6	S	S	.	*	H	α-helix	trans	-65.8	-39.1	177.5	0	0	0	0	0	112.6	A34 N35 G40 E41 A42	A34-A38 WeakPolarHBondContact O-CB 3.47Å; A34-A38 PolarHBondContact O-N 3.32Å; N35-A38 PolarHBondContact O-N 2.94Å; A38-G40 VanDerWaalsContact C-N 3.35Å; A38-E41 PolarHBondContact O-N 3.07Å; A38-A42 PolarHBondContact O-N 3.36Å
39	E	58.3	Low	67.7	Low	146 Å²	146	103.6 Å²	103.6	68%	0.682	61%	0.611	S	S	*	*	H	α-helix	trans	-70.8	-29.8	174.7	-71.7	177.8	-173.1	0	0	112.3	N35	N35-E39 WeakPolarHBondContact O-CB 3.36Å; N35-E39 WeakPolarHBondContact O-CG 3.01Å; N35-E39 PolarHBondContact O-N 3.38Å
40	G	48.9	Very low	65.5	Low	44 Å²	44	102.7 Å²	102.7	45%	0.454	62%	0.618	S	S	.	*	H	α-helix	trans	-69.3	-29.2	172.9	0	0	0	0	0	114	A36 T37 A38 S44	A36-G40 PolarHBondContact O-N 3.45Å; T37-G40 PolarHBondContact O-N 3.11Å; A38-G40 VanDerWaalsContact C-N 3.35Å; G40-S44 PolarHBondContact O-N 3.48Å
41	E	52.5	Low	63.3	Low	148 Å²	148	108.2 Å²	108.2	69%	0.692	64%	0.636	S	S	*	*	H	α-helix	trans	-76.2	-36.2	177.9	-138.9	168.5	-170.2	0	0	111.7	T37 A38 A43 S44	T37-E41 PolarHBondContact O-N 3.35Å; T37-E41 VanDerWaalsContact O-N 3.16Å; A38-E41 PolarHBondContact O-N 3.07Å; E41-A43 VanDerWaalsContact C-N 3.29Å; E41-A43 PolarHBondContact O-N 3.46Å; E41-S44 PolarHBondContact O-N 2.95Å
42	A	49.1	Very low	61.1	Low	80 Å²	80	111.9 Å²	111.9	66%	0.661	65%	0.65	S	S	*	*	H	α-helix	trans	-67.2	-25.6	175.6	0	0	0	0	0	113.8	A38	A38-A42 PolarHBondContact O-N 3.36Å
43	A	48.9	Very low	59.1	Low	70 Å²	70	115.7 Å²	115.7	58%	0.579	67%	0.67	S	S	*	*	H	α-helix	trans	-83.8	-19.3	174.8	0	0	0	0	0	113.5	E41	E41-A43 VanDerWaalsContact C-N 3.29Å; E41-A43 PolarHBondContact O-N 3.46Å
44	S	46.2	Very low	57	Low	89 Å²	89	114.3 Å²	114.3	62%	0.622	68%	0.676	S	S	*	*	H	α-helix	trans	-80.3	-24.6	-175.9	-166.5	0	0	0	0	113.1	G40 E41 A46	G40-S44 PolarHBondContact O-N 3.48Å; E41-S44 PolarHBondContact O-N 2.95Å; S44-A46 VanDerWaalsContact C-N 3.29Å; S44-A46 PolarHBondContact O-N 3.44Å
45	E	48.7	Very low	55	Low	185 Å²	185	117.1 Å²	117.1	86%	0.864	69%	0.689	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80	-9.9	-177.9	-148.9	162.1	-164.4	0	0	113.8
46	A	48.9	Very low	53.4	Low	89 Å²	89	118.7 Å²	118.7	74%	0.736	70%	0.704	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.8	-11.9	177.7	0	0	0	0	0	114.8	S44 K48	S44-A46 VanDerWaalsContact C-N 3.29Å; S44-A46 PolarHBondContact O-N 3.44Å; A46-K48 PolarHBondContact O-N 3.02Å
47	A	42.9	Very low	52.4	Low	81 Å²	81	125.5 Å²	125.5	67%	0.669	73%	0.726	S	S	*	*			trans	-99	56	-175.5	0	0	0	0	0	112.6	I49	A47-I49 PolarHBondContact O-N 3.13Å
48	K	53.1	Low	51.1	Low	199 Å²	199	127.9 Å²	127.9	87%	0.865	74%	0.735	S	S	*	*			trans	-85.4	85	171.8	-153.2	175.4	-163.6	173.1	0	109.7	A46	A46-K48 PolarHBondContact O-N 3.02Å
49	I	57.5	Low	50.2	Low	161 Å²	161	131.2 Å²	131.2	83%	0.826	75%	0.749	S	S	*	*			trans	-142.2	139.6	166	-54.2	-177.8	0	0	0	109.8	A47	A47-I49 PolarHBondContact O-N 3.13Å
50	P	49.7	Very low	49.2	Very low	109 Å²	109	132.7 Å²	132.7	71%	0.708	76%	0.756	S	S	*	*			trans	-101.1	168.4	-148.9	39.4	-33.6	0	0	0	115.7
51	E	48.6	Very low	48.6	Very low	186 Å²	186	135.9 Å²	135.9	87%	0.869	77%	0.767	S	S	*	*			trans	52.4	104.1	142	-165.5	175.6	-171.1	0	0	119.2
52	K	45.2	Very low	48.2	Very low	200 Å²	200	136.5 Å²	136.5	87%	0.87	77%	0.772	S	S	*	*				-169	108.8	115.3	-158	166.6	-176.1	178.7	0	110.3	A54	K52-A54 PolarHBondContact O-N 3.39Å
53	L	51.3	Low	47.8	Very low	176 Å²	176	139.2 Å²	139.2	92%	0.921	77%	0.77	S	S	*	*			trans	-66.7	114.3	166.3	-76.9	155.3	0	0	0	108.3
54	A	46.4	Very low	47.5	Very low	87 Å²	87	143.4 Å²	143.4	72%	0.719	78%	0.776	S	S	*	*	P	Polyproline II helix	trans	-77.5	134.3	164	0	0	0	0	0	108.6	K52	K52-A54 PolarHBondContact O-N 3.39Å
55	P	48.1	Very low	47.4	Very low	114 Å²	114	148.7 Å²	148.7	74%	0.74	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-71.1	152.4	-178.8	29.1	-32.7	0	0	0	111.4	E57	P55-E57 PolarHBondContact O-N 3.38Å
56	P	51.4	Low	46.9	Very low	116 Å²	116	143.5 Å²	143.5	75%	0.753	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-70.6	122.1	174	29.4	-32.1	0	0	0	109.6	N58	P56-N58 PolarHBondContact O-N 2.72Å
57	E	57.8	Low	46.4	Very low	199 Å²	199	149.6 Å²	149.6	93%	0.93	80%	0.797	S	S	*	*	P	Polyproline II helix	trans	-70.1	125.2	164.8	-80.2	-175.5	155.5	0	0	109.2	P55	P55-E57 PolarHBondContact O-N 3.38Å
58	N	48.7	Very low	46.1	Very low	149 Å²	149	150.6 Å²	150.6	80%	0.797	81%	0.805	S	S	*	*	P	Polyproline II helix	trans	-70.7	135.5	-174	-88.2	-26.8	0	0	0	113.6	P56	P56-N58 PolarHBondContact O-N 2.72Å
59	V	51.3	Low	45.4	Very low	127 Å²	127	145.6 Å²	145.6	77%	0.77	80%	0.801	S	S	*	*			trans	-1.4	133.9	134.6	-152	0	0	0	0	118.3
60	E	39.1	Very low	44.4	Very low	178 Å²	178	142.2 Å²	142.2	83%	0.832	80%	0.797	S	S	*	*			trans	160	140.4	137.9	-99.3	-174.3	147.8	0	0	109.2
61	T	36	Very low	44.2	Very low	111 Å²	111	146.1 Å²	146.1	68%	0.681	81%	0.806	S	S	*	*			cis	-163.9	157.7	13.9	30.9	0	0	0	0	104.7
62	M	44.5	Very low	43.6	Very low	161 Å²	161	142.5 Å²	142.5	79%	0.793	80%	0.801	S	S	*	*				-159.7	131.2	54.3	-76.5	176.3	87.5	0	0	106.1
63	E	38.8	Very low	43.5	Very low	136 Å²	136	141.4 Å²	141.4	64%	0.636	80%	0.799	S	S	*	*				49.1	124.9	87.7	-66.2	-147.7	139.7	0	0	111.9
64	K	43.7	Very low	43.4	Very low	158 Å²	158	142.9 Å²	142.9	69%	0.687	80%	0.798	S	S	*	*			cis	-176	178.8	25.3	-110.1	162.4	179.6	150.7	0	106
65	E	44.1	Very low	43.6	Very low	200 Å²	200	148.1 Å²	148.1	94%	0.935	80%	0.804	S	S	*	*			trans	87.5	122.2	173.7	-52.5	-176.4	170.4	0	0	114.1
66	G	37.8	Very low	43.4	Very low	76 Å²	76	147.1 Å²	147.1	78%	0.784	81%	0.806	S	S	*	*			cis	179.8	130.4	5.8	0	0	0	0	0	106.4
67	K	37.6	Very low	43.2	Very low	217 Å²	217	148.7 Å²	148.7	94%	0.943	81%	0.813	S	S	*	*			trans	-77.4	140.7	173.5	-148	179.9	-173.7	-177.2	0	107.8
68	A	37.6	Very low	42.7	Very low	102 Å²	102	146.4 Å²	146.4	84%	0.843	81%	0.807	S	S	*	*			trans	118.8	153.8	153.4	0	0	0	0	0	117.9
69	A	39	Very low	42.4	Very low	94 Å²	94	144.7 Å²	144.7	78%	0.777	80%	0.803	S	S	*	*			trans	95.4	94.9	174.3	0	0	0	0	0	113.9
70	A	36.8	Very low	42	Very low	91 Å²	91	147.1 Å²	147.1	75%	0.752	81%	0.805	S	S	*	*				59.4	114.8	60.7	0	0	0	0	0	112.8
71	E	43.6	Very low	42	Very low	191 Å²	191	148.6 Å²	148.6	89%	0.893	83%	0.827	S	S	*	*			trans	36.8	112.8	154.3	-70.5	-177.7	139.3	0	0	120.1
72	S	36.2	Very low	42.3	Very low	110 Å²	110	150.5 Å²	150.5	77%	0.769	83%	0.834	S	S	*	*			trans	170.8	143.5	141.1	38.6	0	0	0	0	105.7
73	E	43.9	Very low	42.2	Very low	177 Å²	177	149.9 Å²	149.9	83%	0.827	84%	0.836	S	S	*	*			cis	-166.5	143.8	25.4	-133.8	170.8	172.4	0	0	108.4
74	K	50	Low	42.4	Very low	206 Å²	206	150.7 Å²	150.7	90%	0.896	85%	0.848	S	S	*	*			trans	-63.5	132.7	160.6	-66.3	172.8	177.1	177.3	0	109
75	K	48.9	Very low	42.3	Very low	197 Å²	197	150.3 Å²	150.3	86%	0.857	86%	0.857	S	S	*	*			trans	-157.5	97.8	148	-112.6	179.1	178.8	177.9	0	108
76	A	44.7	Very low	42.2	Very low	94 Å²	94	147.2 Å²	147.2	78%	0.777	85%	0.852	S	S	*	*				67.9	91.3	93.1	0	0	0	0	0	112.4
77	V	47.3	Very low	42.5	Very low	148 Å²	148	151.9 Å²	151.9	90%	0.897	86%	0.857	S	S	*	*			trans	-114.9	90.9	151.5	174.8	0	0	0	0	105.9
78	N	47.6	Very low	42.8	Very low	151 Å²	151	147.3 Å²	147.3	81%	0.807	85%	0.851	S	S	*	*			trans	-96	131.8	156.4	-114	1.5	0	0	0	105.6
79	T	42.3	Very low	43.2	Very low	114 Å²	114	150.8 Å²	150.8	70%	0.699	85%	0.851	S	S	*	*				172.4	124.1	124.7	38.5	0	0	0	0	110.8
80	E	42.3	Very low	43.6	Very low	178 Å²	178	155.5 Å²	155.5	83%	0.832	86%	0.857	S	S	*	*			trans	62.5	131.6	134.8	-67.1	175.3	136.9	0	0	118.1
81	T	39.5	Very low	44.2	Very low	209 Å²	209	161.4 Å²	161.4	100%	1.282	87%	0.867	S	S	*	*			cis	-156.5	0	18.1	-36	0	0	0	0	108.2

Retrieved 81 of 81 residues in 13.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).