X6R2P6_HUMAN Loading...

Programmed cell death 5

AlphaFold DB , UniProt , Accession X6R2P6, Species HUMAN (Homo sapiens, Human), Gene PDCD5, Length 55 aa.

						>X6R2P6_HUMAN|X6R2P6|PDCD5
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHSRNEKQYLSPSSGSVGPGQVK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.4	Low	84.4	Confident	181 Å²	181	126.8 Å²	126.8	89%	0.892	63%	0.627	S	S	*	*				0	-84.5	0	-57.6	-62.4	-159.1	0	0	110.8	D3 E4 E5	M1-D3 PolarHBondContact O-N 3.16Å; M1-E4 VanDerWaalsContact CA-OE2 3.25Å; M1-E4 WeakPolarHBondContact CA-OE2 3.24Å; M1-E4 PolarHBondContact N-OE2 2.81Å; M1-E4 PolarHBondContact O-N 3.05Å; M1-E5 PolarHBondContact O-N 3.42Å
2	A	72.9	Confident	84.9	Confident	72 Å²	72	126.3 Å²	126.3	60%	0.595	62%	0.622	S	S	*	*	H	α-helix	trans	-65.7	-34.6	-173.7	0	0	0	0	0	114.7	E4 E5 L6	A2-E4 VanDerWaalsContact C-N 3.31Å; A2-E4 PolarHBondContact O-N 3.42Å; A2-E5 PolarHBondContact O-N 2.99Å; A2-L6 PolarHBondContact O-N 3.18Å; A2-L6 VanDerWaalsContact O-N 3.09Å
3	D	80.7	Confident	85.2	Confident	125 Å²	125	128.4 Å²	128.4	67%	0.668	62%	0.618	S	S	*	*	H	α-helix	trans	-69.6	-28.1	177.5	-66	-63	0	0	0	113	M1 L6 E7	M1-D3 PolarHBondContact O-N 3.16Å; D3-L6 PolarHBondContact O-N 3.46Å; D3-E7 WeakPolarHBondContact O-CB 3.4Å; D3-E7 PolarHBondContact O-N 3.46Å
4	E	82.5	Confident	85.1	Confident	133 Å²	133	126.1 Å²	126.1	62%	0.621	61%	0.61	S	S	*	*	H	α-helix	trans	-72.3	-39.6	177.4	-70.8	158.4	135.8	0	0	111.1	M1 A2 L6 E7 A8	M1-E4 VanDerWaalsContact CA-OE2 3.25Å; M1-E4 WeakPolarHBondContact CA-OE2 3.24Å; M1-E4 PolarHBondContact N-OE2 2.81Å; M1-E4 PolarHBondContact O-N 3.05Å; A2-E4 VanDerWaalsContact C-N 3.31Å; A2-E4 PolarHBondContact O-N 3.42Å; E4-L6 VanDerWaalsContact C-N 3.34Å; E4-E7 PolarHBondContact O-N 3.05Å; E4-A8 WeakPolarHBondContact O-CB 3.39Å; E4-A8 PolarHBondContact O-N 2.99Å
5	E	88.4	Confident	85.1	Confident	149 Å²	149	121.3 Å²	121.3	70%	0.696	60%	0.599	S	S	*	*	H	α-helix	trans	-66.9	-37.8	173.6	-67.6	-175.1	99.5	0	0	111.5	M1 A2 A8 L9	M1-E5 PolarHBondContact O-N 3.42Å; A2-E5 PolarHBondContact O-N 2.99Å; E5-A8 PolarHBondContact O-N 3.27Å; E5-L9 WeakPolarHBondContact O-CB 3.34Å; E5-L9 PolarHBondContact O-N 3.34Å
6	L	91.8	Very high	85.1	Confident	109 Å²	109	117.4 Å²	117.4	57%	0.571	58%	0.579	S	S	*	*	H	α-helix	trans	-66.9	-41.7	175.7	-173.8	61.7	0	0	0	111.9	A2 D3 E4 L9 R10	A2-L6 PolarHBondContact O-N 3.18Å; A2-L6 VanDerWaalsContact O-N 3.09Å; D3-L6 PolarHBondContact O-N 3.46Å; E4-L6 VanDerWaalsContact C-N 3.34Å; L6-L9 PolarHBondContact O-N 2.89Å; L6-R10 WeakPolarHBondContact O-CB 3.32Å; L6-R10 PolarHBondContact O-N 3Å
7	E	90.2	Very high	85	Confident	107 Å²	107	116.1 Å²	116.1	50%	0.5	57%	0.574	S	S	.	*	H	α-helix	trans	-63.9	-42.6	173.1	-96.8	-158.9	-171.3	0	0	112.1	D3 E4 L9 R10 R11	D3-E7 WeakPolarHBondContact O-CB 3.4Å; D3-E7 PolarHBondContact O-N 3.46Å; E4-E7 PolarHBondContact O-N 3.05Å; E7-L9 VanDerWaalsContact C-N 3.33Å; E7-L9 PolarHBondContact O-N 3.08Å; E7-R10 PolarHBondContact O-N 3.29Å; E7-R11 VanDerWaalsContact O-CG 3.31Å; E7-R11 WeakPolarHBondContact O-CG 3.44Å; E7-R11 PolarHBondContact O-N 2.77Å; E7-R11 IonicContact OE2-CZ 3.63Å; E7-R11 IonicContact OE2-NE 3.71Å; E7-R11 IonicContact OE2-NH2 2.8Å; E7-R11 PolarHBondContact OE2-NH2 3.47Å
8	A	92.3	Very high	84.6	Confident	58 Å²	58	115.6 Å²	115.6	48%	0.479	57%	0.57	S	S	.	*	H	α-helix	trans	-60.1	-45.3	176.9	0	0	0	0	0	111.1	E4 E5 R10 R11 Q12	E4-A8 WeakPolarHBondContact O-CB 3.39Å; E4-A8 PolarHBondContact O-N 2.99Å; E5-A8 PolarHBondContact O-N 3.27Å; A8-R10 PolarHBondContact O-N 2.81Å; A8-R11 PolarHBondContact O-N 2.68Å; A8-Q12 WeakPolarHBondContact O-CB 3.35Å; A8-Q12 PolarHBondContact O-N 2.94Å
9	L	92.3	Very high	84.1	Confident	93 Å²	93	114.1 Å²	114.1	49%	0.487	58%	0.578	S	S	.	*	H	α-helix	trans	-63.2	-41.5	176.6	-174	62.7	0	0	0	111.7	E5 L6 E7 Q12 R13	E5-L9 WeakPolarHBondContact O-CB 3.34Å; E5-L9 PolarHBondContact O-N 3.34Å; L6-L9 PolarHBondContact O-N 2.89Å; E7-L9 VanDerWaalsContact C-N 3.33Å; E7-L9 PolarHBondContact O-N 3.08Å; L9-Q12 PolarHBondContact O-N 2.95Å; L9-R13 WeakPolarHBondContact O-CB 3.41Å; L9-R13 WeakPolarHBondContact O-CG 3.09Å; L9-R13 PolarHBondContact O-N 3.43Å
10	R	89.1	Confident	83.4	Confident	200 Å²	200	115.6 Å²	115.6	76%	0.755	58%	0.58	S	S	*	*	H	α-helix	trans	-62.8	-44.5	177.5	-170.6	177.9	179.5	164.5	0.5	111.7	L6 E7 A8 R13 L14	L6-R10 WeakPolarHBondContact O-CB 3.32Å; L6-R10 PolarHBondContact O-N 3Å; E7-R10 PolarHBondContact O-N 3.29Å; A8-R10 PolarHBondContact O-N 2.81Å; R10-R13 PolarHBondContact O-N 3.45Å; R10-L14 WeakPolarHBondContact O-CB 3.07Å; R10-L14 PolarHBondContact O-N 3.39Å
11	R	89	Confident	82.7	Confident	168 Å²	168	115.3 Å²	115.3	63%	0.634	58%	0.577	S	S	*	*	H	α-helix	trans	-65.3	-42.7	177.4	-69.4	176.8	-167	-155.6	7.4	111.6	E7 A8 L14 A15	E7-R11 VanDerWaalsContact O-CG 3.31Å; E7-R11 WeakPolarHBondContact O-CG 3.44Å; E7-R11 PolarHBondContact O-N 2.77Å; E7-R11 IonicContact OE2-CZ 3.63Å; E7-R11 IonicContact OE2-NE 3.71Å; E7-R11 IonicContact OE2-NH2 2.8Å; E7-R11 PolarHBondContact OE2-NH2 3.47Å; A8-R11 PolarHBondContact O-N 2.68Å; R11-L14 PolarHBondContact O-N 2.81Å; R11-A15 WeakPolarHBondContact O-CB 3.16Å; R11-A15 PolarHBondContact O-N 3.11Å
12	Q	90.3	Very high	82.7	Confident	120 Å²	120	109.4 Å²	109.4	56%	0.561	56%	0.562	S	S	*	*	H	α-helix	trans	-61.4	-46.8	177.1	-170.4	-178.3	-76.5	0	0	111.4	A8 L9 L14 A15 E16	A8-Q12 WeakPolarHBondContact O-CB 3.35Å; A8-Q12 PolarHBondContact O-N 2.94Å; L9-Q12 PolarHBondContact O-N 2.95Å; Q12-L14 VanDerWaalsContact C-N 3.33Å; Q12-L14 PolarHBondContact O-N 3.34Å; Q12-A15 PolarHBondContact O-N 3.19Å; Q12-E16 PolarHBondContact O-N 2.9Å
13	R	88.2	Confident	82	Confident	154 Å²	154	111.3 Å²	111.3	58%	0.581	56%	0.562	S	S	*	*	H	α-helix	trans	-62	-40.2	176.4	-73.7	-59.7	-163.9	-166.2	6	112.5	L9 R10 E16 L17	L9-R13 WeakPolarHBondContact O-CB 3.41Å; L9-R13 WeakPolarHBondContact O-CG 3.09Å; L9-R13 PolarHBondContact O-N 3.43Å; R10-R13 PolarHBondContact O-N 3.45Å; R13-E16 IonicContact NH1-OE2 3.44Å; R13-E16 PolarHBondContact NH1-OE2 2.91Å; R13-E16 PolarHBondContact O-N 3.04Å; R13-L17 WeakPolarHBondContact O-CB 3.11Å; R13-L17 PolarHBondContact O-N 3.34Å
14	L	84.9	Confident	80.9	Confident	96 Å²	96	109.3 Å²	109.3	50%	0.503	56%	0.556	S	S	.	*	H	α-helix	trans	-65.3	-44	178.3	-172.9	65.8	0	0	0	111.7	R10 R11 Q12 L17 Q18	R10-L14 WeakPolarHBondContact O-CB 3.07Å; R10-L14 PolarHBondContact O-N 3.39Å; R11-L14 PolarHBondContact O-N 2.81Å; Q12-L14 VanDerWaalsContact C-N 3.33Å; Q12-L14 PolarHBondContact O-N 3.34Å; L14-L17 PolarHBondContact O-N 3.34Å; L14-Q18 WeakPolarHBondContact O-CB 3.34Å; L14-Q18 WeakPolarHBondContact O-CG 3.47Å; L14-Q18 PolarHBondContact O-N 3.48Å
15	A	85	Confident	79.8	Confident	54 Å²	54	104.1 Å²	104.1	45%	0.446	54%	0.538	S	S	.	.	H	α-helix	trans	-63.7	-43.1	176.9	0	0	0	0	0	112	R11 Q12 L17 Q18 A19	R11-A15 WeakPolarHBondContact O-CB 3.16Å; R11-A15 PolarHBondContact O-N 3.11Å; Q12-A15 PolarHBondContact O-N 3.19Å; A15-L17 VanDerWaalsContact C-N 3.32Å; A15-L17 PolarHBondContact O-N 2.96Å; A15-Q18 PolarHBondContact O-N 3.22Å; A15-A19 VanDerWaalsContact O-CB 3.32Å; A15-A19 WeakPolarHBondContact O-CB 3.28Å; A15-A19 PolarHBondContact O-N 3.42Å
16	E	85.1	Confident	78.3	Confident	60 Å²	60	101.5 Å²	101.5	28%	0.28	53%	0.529	S	S	.	.	H	α-helix	trans	-61.2	-40.9	173.4	-78.2	-171.9	74.7	0	0	112.2	Q12 R13 A19 K20	Q12-E16 PolarHBondContact O-N 2.9Å; R13-E16 IonicContact NH1-OE2 3.44Å; R13-E16 PolarHBondContact NH1-OE2 2.91Å; R13-E16 PolarHBondContact O-N 3.04Å; E16-A19 PolarHBondContact O-N 3.31Å; E16-K20 WeakPolarHBondContact O-CB 3.35Å; E16-K20 VanDerWaalsContact O-CG 3.24Å; E16-K20 WeakPolarHBondContact O-CG 3.24Å; E16-K20 PolarHBondContact O-N 3.47Å; E16-K20 IonicContact OE1-NZ 3.14Å; E16-K20 PolarHBondContact OE1-NZ 3.14Å; E16-K20 VanDerWaalsContact OE1-NZ 3.14Å
17	L	82.9	Confident	76.7	Confident	94 Å²	94	99 Å²	99	49%	0.492	52%	0.524	S	S	.	.	H	α-helix	trans	-66.4	-42.5	179.3	-159.5	80.6	0	0	0	111	R13 L14 A15 K20 H21	R13-L17 WeakPolarHBondContact O-CB 3.11Å; R13-L17 PolarHBondContact O-N 3.34Å; L14-L17 PolarHBondContact O-N 3.34Å; A15-L17 VanDerWaalsContact C-N 3.32Å; A15-L17 PolarHBondContact O-N 2.96Å; L17-K20 PolarHBondContact O-N 2.83Å; L17-H21 VanDerWaalsContact O-CB 3.28Å; L17-H21 WeakPolarHBondContact O-CB 3.39Å; L17-H21 PolarHBondContact O-N 3.08Å
18	Q	78	Confident	75.1	Confident	108 Å²	108	96.9 Å²	96.9	51%	0.505	53%	0.525	S	S	.	.	H	α-helix	trans	-67.2	-35.2	175.8	-73.9	177.8	-23.4	0	0	112.7	L14 A15 H21	L14-Q18 WeakPolarHBondContact O-CB 3.34Å; L14-Q18 WeakPolarHBondContact O-CG 3.47Å; L14-Q18 PolarHBondContact O-N 3.48Å; A15-Q18 PolarHBondContact O-N 3.22Å; Q18-H21 CarbonylContact O-C 3.33Å
19	A	74.6	Confident	73.6	Confident	86 Å²	86	99.2 Å²	99.2	71%	0.711	53%	0.526	S	S	*	.	H	α-helix	trans	-71.6	-34.3	176.4	0	0	0	0	0	112.4	A15 E16	A15-A19 VanDerWaalsContact O-CB 3.32Å; A15-A19 WeakPolarHBondContact O-CB 3.28Å; A15-A19 PolarHBondContact O-N 3.42Å; E16-A19 PolarHBondContact O-N 3.31Å
20	K	70.9	Confident	72.1	Confident	144 Å²	144	100.9 Å²	100.9	63%	0.626	53%	0.531	S	S	*	.	H	α-helix	trans	-80.4	-40.1	177.8	-71.5	171.3	-172.6	167.7	0	112.3	E16 L17	E16-K20 WeakPolarHBondContact O-CB 3.35Å; E16-K20 VanDerWaalsContact O-CG 3.24Å; E16-K20 WeakPolarHBondContact O-CG 3.24Å; E16-K20 PolarHBondContact O-N 3.47Å; E16-K20 IonicContact OE1-NZ 3.14Å; E16-K20 PolarHBondContact OE1-NZ 3.14Å; E16-K20 VanDerWaalsContact OE1-NZ 3.14Å; L17-K20 PolarHBondContact O-N 2.83Å
21	H	68.5	Low	70.7	Confident	111 Å²	111	98.8 Å²	98.8	51%	0.514	53%	0.53	S	S	.	.	S	Bend	trans	-104.2	77	176.2	-52.2	166.3	0	0	0	106.8	L17 Q18 D23	L17-H21 VanDerWaalsContact O-CB 3.28Å; L17-H21 WeakPolarHBondContact O-CB 3.39Å; L17-H21 PolarHBondContact O-N 3.08Å; Q18-H21 CarbonylContact O-C 3.33Å; H21-D23 PolarHBondContact O-N 3.14Å; H21-D23 VanDerWaalsContact O-N 3.08Å
22	G	58.3	Low	69.4	Low	56 Å²	56	94 Å²	94	58%	0.577	53%	0.526	S	S	*	.			trans	-47.2	122.1	174.3	0	0	0	0	0	109.8
23	D	58.7	Low	68	Low	112 Å²	112	94.7 Å²	94.7	60%	0.599	53%	0.527	S	S	*	.			trans	47.3	114.9	-176.5	-157.2	-98.4	0	0	0	116.9	H21 G25 D26	H21-D23 PolarHBondContact O-N 3.14Å; H21-D23 VanDerWaalsContact O-N 3.08Å; D23-G25 PolarHBondContact O-N 3.43Å; D23-G25 WeakPolarHBondContact OD1-CA 3.41Å; D23-G25 PolarHBondContact OD1-N 2.95Å; D23-D26 PolarHBondContact O-N 3.25Å
24	P	57.1	Low	66.6	Low	84 Å²	84	93.5 Å²	93.5	55%	0.545	53%	0.528	S	S	.	.	H	α-helix	trans	-61.4	-13.9	174	26.2	-33.4	0	0	0	113.4	D26 A28	P24-D26 VanDerWaalsContact C-N 3.27Å; P24-D26 PolarHBondContact O-N 3.46Å; P24-A28 VanDerWaalsContact O-CB 3.27Å; P24-A28 WeakPolarHBondContact O-CB 3.27Å; P24-A28 PolarHBondContact O-N 2.99Å
25	G	59.5	Low	65.3	Low	23 Å²	23	91.8 Å²	91.8	24%	0.237	52%	0.524	C	S	.	.	H	α-helix	trans	-66	-24.8	170.7	0	0	0	0	0	113.5	D23 Q29	D23-G25 PolarHBondContact O-N 3.43Å; D23-G25 WeakPolarHBondContact OD1-CA 3.41Å; D23-G25 PolarHBondContact OD1-N 2.95Å; G25-Q29 WeakPolarHBondContact O-CB 3.34Å; G25-Q29 WeakPolarHBondContact O-CG 3.46Å; G25-Q29 PolarHBondContact O-N 3.44Å; G25-Q29 VanDerWaalsContact O-N 3.08Å; G25-Q29 PolarHBondContact O-NE2 3.5Å; G25-Q29 VanDerWaalsContact O-NE2 3.14Å
26	D	57.5	Low	64.1	Low	94 Å²	94	98.4 Å²	98.4	50%	0.503	54%	0.538	S	S	.	.	H	α-helix	trans	-79.9	-42	176.7	-143.2	-73.7	0	0	0	111.4	D23 P24 Q29 Q30	D23-D26 PolarHBondContact O-N 3.25Å; P24-D26 VanDerWaalsContact C-N 3.27Å; P24-D26 PolarHBondContact O-N 3.46Å; D26-Q29 PolarHBondContact O-N 2.9Å; D26-Q30 WeakPolarHBondContact O-CB 3.48Å; D26-Q30 PolarHBondContact O-N 2.97Å
27	A	57.3	Low	62.7	Low	57 Å²	57	100 Å²	100	47%	0.471	55%	0.548	S	S	.	.	H	α-helix	trans	-64.7	-44.6	174.1	0	0	0	0	0	112.1	Q29 Q30 E31	A27-Q29 VanDerWaalsContact C-N 3.33Å; A27-Q29 PolarHBondContact O-N 3.4Å; A27-Q30 PolarHBondContact O-N 3.49Å; A27-E31 PolarHBondContact O-N 2.9Å
28	A	57.5	Low	61.6	Low	63 Å²	63	101.4 Å²	101.4	52%	0.521	55%	0.552	S	S	.	*	H	α-helix	trans	-65.7	-35	175.6	0	0	0	0	0	112.3	P24 A32	P24-A28 VanDerWaalsContact O-CB 3.27Å; P24-A28 WeakPolarHBondContact O-CB 3.27Å; P24-A28 PolarHBondContact O-N 2.99Å; A28-A32 WeakPolarHBondContact O-CB 3.33Å; A28-A32 PolarHBondContact O-N 2.96Å
29	Q	60	Low	60.8	Low	107 Å²	107	104 Å²	104	50%	0.5	56%	0.561	S	S	.	*	H	α-helix	trans	-72.4	-36.1	173.2	-80.3	179.3	64.3	0	0	112.9	G25 D26 A27 A32 K33	G25-Q29 WeakPolarHBondContact O-CB 3.34Å; G25-Q29 WeakPolarHBondContact O-CG 3.46Å; G25-Q29 PolarHBondContact O-N 3.44Å; G25-Q29 VanDerWaalsContact O-N 3.08Å; G25-Q29 PolarHBondContact O-NE2 3.5Å; G25-Q29 VanDerWaalsContact O-NE2 3.14Å; D26-Q29 PolarHBondContact O-N 2.9Å; A27-Q29 VanDerWaalsContact C-N 3.33Å; A27-Q29 PolarHBondContact O-N 3.4Å; Q29-A32 PolarHBondContact O-N 3.3Å; Q29-K33 WeakPolarHBondContact O-CB 3.41Å; Q29-K33 VanDerWaalsContact O-CG 3.24Å; Q29-K33 WeakPolarHBondContact O-CG 3.34Å; Q29-K33 PolarHBondContact O-N 2.94Å
30	Q	61.5	Low	60	Low	128 Å²	128	106.8 Å²	106.8	60%	0.598	56%	0.56	S	S	*	*	H	α-helix	trans	-63.2	-45.8	173.1	-86.7	-156.3	7.7	0	0	110.7	D26 A27 A32 K33 H34	D26-Q30 WeakPolarHBondContact O-CB 3.48Å; D26-Q30 PolarHBondContact O-N 2.97Å; A27-Q30 PolarHBondContact O-N 3.49Å; Q30-A32 VanDerWaalsContact C-N 3.32Å; Q30-A32 PolarHBondContact O-N 2.99Å; Q30-K33 PolarHBondContact O-N 3.42Å; Q30-H34 WeakPolarHBondContact O-CB 3.31Å; Q30-H34 PolarHBondContact O-N 3.36Å
31	E	60.7	Low	59.5	Low	156 Å²	156	109.4 Å²	109.4	73%	0.729	57%	0.567	S	S	*	*	H	α-helix	trans	-63.3	-39.5	177.8	-146.2	178.4	99.3	0	0	111.3	A27 H34 S35	A27-E31 PolarHBondContact O-N 2.9Å; E31-H34 PolarHBondContact O-N 3.44Å; E31-S35 WeakPolarHBondContact O-CB 3.39Å; E31-S35 PolarHBondContact O-N 2.98Å
32	A	60.7	Low	59.2	Low	66 Å²	66	110.5 Å²	110.5	55%	0.545	58%	0.576	S	S	.	*	H	α-helix	trans	-64.9	-38.6	173.6	0	0	0	0	0	113.2	A28 Q29 Q30 R36	A28-A32 WeakPolarHBondContact O-CB 3.33Å; A28-A32 PolarHBondContact O-N 2.96Å; Q29-A32 PolarHBondContact O-N 3.3Å; Q30-A32 VanDerWaalsContact C-N 3.32Å; Q30-A32 PolarHBondContact O-N 2.99Å; A32-R36 PolarHBondContact O-N 3.47Å
33	K	60.2	Low	58.7	Low	136 Å²	136	112.2 Å²	112.2	59%	0.591	58%	0.579	S	S	*	*	H	α-helix	trans	-69	-41.5	174.7	-74.2	169.2	-174.5	172.5	0	111.4	Q29 Q30 R36 N37	Q29-K33 WeakPolarHBondContact O-CB 3.41Å; Q29-K33 VanDerWaalsContact O-CG 3.24Å; Q29-K33 WeakPolarHBondContact O-CG 3.34Å; Q29-K33 PolarHBondContact O-N 2.94Å; Q30-K33 PolarHBondContact O-N 3.42Å; K33-R36 PolarHBondContact O-N 3.37Å; K33-N37 PolarHBondContact O-N 2.91Å
34	H	60	Low	58.5	Low	128 Å²	128	112.1 Å²	112.1	59%	0.593	59%	0.585	S	S	*	*	H	α-helix	trans	-65.9	-42.6	179	-133.4	-96.2	0	0	0	111.5	Q30 E31 R36 N37 E38	Q30-H34 WeakPolarHBondContact O-CB 3.31Å; Q30-H34 PolarHBondContact O-N 3.36Å; E31-H34 PolarHBondContact O-N 3.44Å; H34-R36 VanDerWaalsContact C-N 3.28Å; H34-R36 PolarHBondContact O-N 3.47Å; H34-N37 PolarHBondContact O-N 3.25Å; H34-N37 VanDerWaalsContact O-N 3.11Å; H34-E38 IonicContact ND1-OE2 3.91Å; H34-E38 PolarHBondContact O-N 3.45Å
35	S	58.1	Low	58.3	Low	60 Å²	60	113.5 Å²	113.5	42%	0.42	60%	0.597	S	S	.	*	H	α-helix	trans	-61.9	-32.8	176.6	-169.2	0	0	0	0	113.1	E31 K39	E31-S35 WeakPolarHBondContact O-CB 3.39Å; E31-S35 PolarHBondContact O-N 2.98Å; S35-K39 WeakPolarHBondContact O-CG 3.38Å; S35-K39 PolarHBondContact O-N 2.9Å
36	R	58.3	Low	58.2	Low	194 Å²	194	117.6 Å²	117.6	73%	0.732	62%	0.622	S	S	*	*	H	α-helix	trans	-69.5	-40.8	173.8	-170.2	-179.9	-172	-150.8	2.1	111.9	A32 K33 H34 Q40	A32-R36 PolarHBondContact O-N 3.47Å; K33-R36 PolarHBondContact O-N 3.37Å; H34-R36 VanDerWaalsContact C-N 3.28Å; H34-R36 PolarHBondContact O-N 3.47Å; R36-Q40 PolarHBondContact O-N 3.47Å
37	N	57.3	Low	57.9	Low	93 Å²	93	115.9 Å²	115.9	50%	0.497	63%	0.626	S	S	.	*	H	α-helix	trans	-70.1	-38.8	-179.6	-104	61.7	0	0	0	112.5	K33 H34 K39 Q40	K33-N37 PolarHBondContact O-N 2.91Å; H34-N37 PolarHBondContact O-N 3.25Å; H34-N37 VanDerWaalsContact O-N 3.11Å; N37-K39 VanDerWaalsContact C-N 3.34Å; N37-K39 PolarHBondContact O-N 2.95Å; N37-Q40 PolarHBondContact O-N 2.8Å
38	E	59.1	Low	57.7	Low	124 Å²	124	118.6 Å²	118.6	58%	0.579	64%	0.642	S	S	*	*	H	α-helix	trans	-64.5	-37.8	176.9	-111.7	177.9	90.9	0	0	112.5	H34 Q40 Y41 L42	H34-E38 IonicContact ND1-OE2 3.91Å; H34-E38 PolarHBondContact O-N 3.45Å; E38-Q40 PolarHBondContact O-N 3.4Å; E38-Y41 PolarHBondContact O-N 2.93Å; E38-L42 WeakPolarHBondContact O-CD1 3.47Å
39	K	60.5	Low	57.8	Low	161 Å²	161	122.5 Å²	122.5	70%	0.7	66%	0.658	S	S	*	*	H	α-helix	trans	-67.7	-20.1	176	-70.9	178.8	-175.9	172.7	0	113.6	S35 N37	S35-K39 WeakPolarHBondContact O-CG 3.38Å; S35-K39 PolarHBondContact O-N 2.9Å; N37-K39 VanDerWaalsContact C-N 3.34Å; N37-K39 PolarHBondContact O-N 2.95Å
40	Q	58.6	Low	57.3	Low	145 Å²	145	120.3 Å²	120.3	68%	0.678	67%	0.665	S	S	*	*	H	α-helix	trans	-85.2	-18.8	-179.4	-155.5	171.2	-14.7	0	0	112.9	R36 N37 E38	R36-Q40 PolarHBondContact O-N 3.47Å; N37-Q40 PolarHBondContact O-N 2.8Å; E38-Q40 PolarHBondContact O-N 3.4Å
41	Y	59.4	Low	57.2	Low	199 Å²	199	121 Å²	121	78%	0.78	68%	0.681	S	S	*	*	H	α-helix	trans	-90.8	-16.8	175	-85.3	-86.9	0	0	0	114	E38 S43	E38-Y41 PolarHBondContact O-N 2.93Å; Y41-S43 VanDerWaalsContact C-N 3.34Å; Y41-S43 PolarHBondContact O-N 3.09Å
42	L	62.7	Low	56.9	Low	135 Å²	135	116.6 Å²	116.6	71%	0.707	68%	0.676	S	S	*	*			trans	-95.2	40.1	173.3	-78.4	102.4	0	0	0	112.9	E38 P44	E38-L42 WeakPolarHBondContact O-CD1 3.47Å; L42-P44 WeakPolarHBondContact O-CD 3.25Å
43	S	47.7	Very low	56.5	Low	92 Å²	92	123 Å²	123	64%	0.643	70%	0.695	S	S	*	*			trans	-68.1	114.5	158.5	-173	0	0	0	0	107.1	Y41 S45	Y41-S43 VanDerWaalsContact C-N 3.34Å; Y41-S43 PolarHBondContact O-N 3.09Å; S43-S45 PolarHBondContact O-N 3.47Å
44	P	55.7	Low	56.1	Low	110 Å²	110	123.1 Å²	123.1	71%	0.714	71%	0.707	S	S	*	*			trans	-61.1	114.4	163.6	25.8	-29.3	0	0	0	104.8	L42 S46	L42-P44 WeakPolarHBondContact O-CD 3.25Å; P44-S46 PolarHBondContact O-N 3.43Å
45	S	52.4	Low	55.9	Low	113 Å²	113	130.6 Å²	130.6	79%	0.79	74%	0.738	S	S	*	*			trans	-51.4	93	169.3	169.8	0	0	0	0	107.6	S43 G47	S43-S45 PolarHBondContact O-N 3.47Å; S45-G47 PolarHBondContact O-N 3.45Å
46	S	57.8	Low	55.7	Low	109 Å²	109	134.2 Å²	134.2	76%	0.762	75%	0.754	S	S	*	*			trans	-71.5	75.8	165.8	59.7	0	0	0	0	105.8	P44 S48	P44-S46 PolarHBondContact O-N 3.43Å; S46-S48 PolarHBondContact O-N 2.89Å
47	G	50.4	Low	55.6	Low	57 Å²	57	131 Å²	131	59%	0.588	76%	0.755	S	S	*	*			trans	-69	81.6	168.1	0	0	0	0	0	108.2	S45 V49	S45-G47 PolarHBondContact O-N 3.45Å; G47-V49 VanDerWaalsContact C-N 3.32Å; G47-V49 PolarHBondContact O-N 3.47Å
48	S	53.3	Low	55.5	Low	115 Å²	115	133.1 Å²	133.1	80%	0.804	77%	0.769	S	S	*	*			trans	-68.7	90.9	163.3	57.2	0	0	0	0	108.5	S46 G50	S46-S48 PolarHBondContact O-N 2.89Å; S48-G50 PolarHBondContact O-N 2.7Å
49	V	59.3	Low	55.3	Low	144 Å²	144	133.6 Å²	133.6	87%	0.873	78%	0.78	S	S	*	*			trans	-84.3	97.7	157.3	-80.9	0	0	0	0	107.1	G47	G47-V49 VanDerWaalsContact C-N 3.32Å; G47-V49 PolarHBondContact O-N 3.47Å
50	G	49.4	Very low	55	Low	62 Å²	62	131.9 Å²	131.9	64%	0.639	79%	0.785	S	S	*	*			trans	-61	149.3	176.4	0	0	0	0	0	111.7	S48 G52	S48-G50 PolarHBondContact O-N 2.7Å; G50-G52 PolarHBondContact O-N 3.21Å
51	P	59.4	Low	54.7	Low	143 Å²	143	131.1 Å²	131.1	93%	0.929	79%	0.792	S	S	*	*			trans	-72.5	103.1	176.7	29.7	-32.3	0	0	0	109.3
52	G	53.8	Low	54.4	Low	62 Å²	62	126.2 Å²	126.2	64%	0.639	79%	0.793	S	S	*	*			trans	-138.8	53.9	178.1	0	0	0	0	0	111.6	G50 V54	G50-G52 PolarHBondContact O-N 3.21Å; G52-V54 PolarHBondContact O-N 3.36Å; G52-V54 VanDerWaalsContact O-N 3.16Å
53	Q	52.3	Low	53.8	Low	202 Å²	202	125.5 Å²	125.5	94%	0.944	80%	0.8	S	S	*	*			trans	-73.8	97.9	162.9	-67.1	-140.7	101.6	0	0	108.3
54	V	53.3	Low	54.3	Low	137 Å²	137	128.3 Å²	128.3	83%	0.83	81%	0.813	S	S	*	*			trans	-116.9	96.1	161.6	-83.9	0	0	0	0	108.1	G52	G52-V54 PolarHBondContact O-N 3.36Å; G52-V54 VanDerWaalsContact O-N 3.16Å
55	K	54.3	Low	54.1	Low	286 Å²	286	130 Å²	130	100%	1.243	82%	0.822	S	S	*	*			trans	-143	0	152.3	-91.5	-169.8	168.3	-172.9	0	108.1

Retrieved 55 of 55 residues in 45.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).