X6R3I0_HUMAN Loading...

FTO alpha-ketoglutarate dependent dioxygenase

AlphaFold DB , UniProt , Accession X6R3I0, Species HUMAN (Homo sapiens, Human), Gene FTO, Length 129 aa.

						>X6R3I0_HUMAN|X6R3I0|FTO
EQRNEILTAILASLTARQNLRREWHARAERSVGASHELPEHYLLIRSQNVGHTGKRMMLRCLCRLTSQTSFQNSEVSFWKQNPRRSTSLRRRRKRDRLFSSNVVMGLSKSSGDFSWPLDCSTRVPIQNS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	E	62.8	Low	82.2	Confident	201 Å²	201	118 Å²	118	94%	0.939	59%	0.592	S	S	*	*				0	-37.6	0	-77.8	152.7	147.7	0	0	115	R3 N4	E1-R3 PolarHBondContact O-N 3.37Å; E1-N4 PolarHBondContact O-N 2.96Å
2	Q	75.2	Confident	82.2	Confident	157 Å²	157	113.8 Å²	113.8	73%	0.734	59%	0.588	S	S	*	*	H	α-helix	trans	-47.9	-35.8	-178	-75.2	-179.3	-32.9	0	0	116.2	N4 E5 I6	Q2-N4 VanDerWaalsContact C-N 3.27Å; Q2-N4 PolarHBondContact O-N 3.32Å; Q2-E5 PolarHBondContact O-N 3Å; Q2-I6 WeakPolarHBondContact O-CG1 3.38Å; Q2-I6 PolarHBondContact O-N 2.71Å; Q2-I6 VanDerWaalsContact O-N 3.14Å
3	R	78.3	Confident	82.2	Confident	193 Å²	193	109.8 Å²	109.8	73%	0.728	58%	0.577	S	S	*	*	H	α-helix	trans	-58.4	-37.8	177	-175.5	-176.5	174.3	-137.1	0.3	112.4	E1 L7	E1-R3 PolarHBondContact O-N 3.37Å; R3-L7 HydrophobicContact CG-CD1 3.96Å; R3-L7 HydrophobicContact CG-CG 4.45Å; R3-L7 WeakPolarHBondContact O-CB 3.17Å; R3-L7 WeakPolarHBondContact O-CG 3.42Å; R3-L7 PolarHBondContact O-N 3.14Å
4	N	83.4	Confident	82.7	Confident	102 Å²	102	108.4 Å²	108.4	55%	0.545	57%	0.569	S	S	.	*	H	α-helix	trans	-76.1	-33.1	-175.9	-69.1	-9	0	0	0	111.9	E1 Q2 T8	E1-N4 PolarHBondContact O-N 2.96Å; Q2-N4 VanDerWaalsContact C-N 3.27Å; Q2-N4 PolarHBondContact O-N 3.32Å; N4-T8 WeakPolarHBondContact O-CB 3.38Å; N4-T8 PolarHBondContact O-N 2.91Å; N4-T8 PolarHBondContact O-OG1 3.15Å
5	E	77.8	Confident	82.8	Confident	131 Å²	131	105.5 Å²	105.5	61%	0.612	56%	0.558	S	S	*	*	H	α-helix	trans	-67.2	-45.4	174.3	-67.4	171.1	-174.1	0	0	111.1	Q2 L7 T8 A9	Q2-E5 PolarHBondContact O-N 3Å; E5-L7 PolarHBondContact O-N 3.48Å; E5-T8 PolarHBondContact O-N 3.04Å; E5-A9 PolarHBondContact O-N 3.17Å
6	I	88.8	Confident	82.6	Confident	102 Å²	102	102.1 Å²	102.1	52%	0.523	55%	0.549	S	S	.	.	H	α-helix	trans	-62	-45.1	176.2	-66.1	168.6	0	0	0	110.5	Q2 T8 A9 I10	Q2-I6 WeakPolarHBondContact O-CG1 3.38Å; Q2-I6 PolarHBondContact O-N 2.71Å; Q2-I6 VanDerWaalsContact O-N 3.14Å; I6-T8 VanDerWaalsContact C-N 3.31Å; I6-T8 PolarHBondContact O-N 3.49Å; I6-A9 PolarHBondContact O-N 3.34Å; I6-I10 HydrophobicContact CG2-CD1 3.63Å; I6-I10 HydrophobicContact CG2-CG1 4.4Å; I6-I10 WeakPolarHBondContact O-CB 3.35Å; I6-I10 VanDerWaalsContact O-CG1 3.28Å; I6-I10 WeakPolarHBondContact O-CG1 3.45Å; I6-I10 PolarHBondContact O-N 3.48Å
7	L	87.9	Confident	82.5	Confident	74 Å²	74	104.1 Å²	104.1	39%	0.387	55%	0.547	S	S	.	.	H	α-helix	trans	-61.3	-41.3	177.4	-76.3	171.2	0	0	0	111.6	R3 E5 I10 L11	R3-L7 HydrophobicContact CG-CD1 3.96Å; R3-L7 HydrophobicContact CG-CG 4.45Å; R3-L7 WeakPolarHBondContact O-CB 3.17Å; R3-L7 WeakPolarHBondContact O-CG 3.42Å; R3-L7 PolarHBondContact O-N 3.14Å; E5-L7 PolarHBondContact O-N 3.48Å; L7-I10 PolarHBondContact O-N 3.42Å; L7-L11 WeakPolarHBondContact O-CB 3.18Å; L7-L11 WeakPolarHBondContact O-CD1 3.28Å; L7-L11 WeakPolarHBondContact O-CG 3.37Å; L7-L11 PolarHBondContact O-N 3.44Å
8	T	86.8	Confident	82.7	Confident	96 Å²	96	103.7 Å²	103.7	59%	0.589	54%	0.542	S	S	*	.	H	α-helix	trans	-65.7	-43.9	179.3	-56.2	0	0	0	0	111.7	N4 E5 I6 I10 L11 A12	N4-T8 WeakPolarHBondContact O-CB 3.38Å; N4-T8 PolarHBondContact O-N 2.91Å; N4-T8 PolarHBondContact O-OG1 3.15Å; E5-T8 PolarHBondContact O-N 3.04Å; I6-T8 VanDerWaalsContact C-N 3.31Å; I6-T8 PolarHBondContact O-N 3.49Å; T8-I10 PolarHBondContact O-N 2.98Å; T8-L11 PolarHBondContact O-N 3.22Å; T8-A12 PolarHBondContact O-N 3.43Å; T8-A12 VanDerWaalsContact O-N 3.15Å
9	A	80.9	Confident	82.8	Confident	63 Å²	63	102.6 Å²	102.6	52%	0.521	54%	0.537	S	S	.	.	H	α-helix	trans	-63.5	-41	177	0	0	0	0	0	112.4	E5 I6 S13	E5-A9 PolarHBondContact O-N 3.17Å; I6-A9 PolarHBondContact O-N 3.34Å; A9-S13 PolarHBondContact O-N 3.41Å; A9-S13 PolarHBondContact O-OG 2.8Å
10	I	91.1	Very high	82.6	Confident	80 Å²	80	101.9 Å²	101.9	41%	0.41	53%	0.533	S	S	.	.	H	α-helix	trans	-73.1	-39.2	178.6	-66.3	172.8	0	0	0	111	I6 L7 T8 A12 S13 L14	I6-I10 HydrophobicContact CG2-CD1 3.63Å; I6-I10 HydrophobicContact CG2-CG1 4.4Å; I6-I10 WeakPolarHBondContact O-CB 3.35Å; I6-I10 VanDerWaalsContact O-CG1 3.28Å; I6-I10 WeakPolarHBondContact O-CG1 3.45Å; I6-I10 PolarHBondContact O-N 3.48Å; L7-I10 PolarHBondContact O-N 3.42Å; T8-I10 PolarHBondContact O-N 2.98Å; I10-A12 PolarHBondContact O-N 3.25Å; I10-S13 CarbonylContact O-C 3.56Å; I10-S13 PolarHBondContact O-N 3.48Å; I10-L14 HydrophobicContact CG2-CD1 3.61Å; I10-L14 HydrophobicContact CG2-CG 3.92Å; I10-L14 WeakPolarHBondContact O-CB 3.5Å; I10-L14 WeakPolarHBondContact O-CG 3.32Å; I10-L14 PolarHBondContact O-N 2.95Å
11	L	91	Very high	82.3	Confident	99 Å²	99	105.6 Å²	105.6	52%	0.518	54%	0.54	S	S	.	.	H	α-helix	trans	-58.9	-47.4	178.1	-94.3	156.4	0	0	0	111.4	L7 T8 S13 L14 T15	L7-L11 WeakPolarHBondContact O-CB 3.18Å; L7-L11 WeakPolarHBondContact O-CD1 3.28Å; L7-L11 WeakPolarHBondContact O-CG 3.37Å; L7-L11 PolarHBondContact O-N 3.44Å; T8-L11 PolarHBondContact O-N 3.22Å; L11-S13 VanDerWaalsContact C-N 3.28Å; L11-S13 PolarHBondContact O-N 3.39Å; L11-L14 PolarHBondContact O-N 2.97Å; L11-L14 VanDerWaalsContact O-N 3.17Å; L11-T15 WeakPolarHBondContact O-CB 3.42Å; L11-T15 PolarHBondContact O-N 3.26Å; L11-T15 PolarHBondContact O-OG1 2.85Å; L11-T15 VanDerWaalsContact O-OG1 3.04Å
12	A	82	Confident	83.1	Confident	67 Å²	67	103 Å²	103	55%	0.554	52%	0.522	S	S	*	.	H	α-helix	trans	-57	-44.8	176.1	0	0	0	0	0	111.6	T8 I10 A16	T8-A12 PolarHBondContact O-N 3.43Å; T8-A12 VanDerWaalsContact O-N 3.15Å; I10-A12 PolarHBondContact O-N 3.25Å; A12-A16 WeakPolarHBondContact O-CB 3.49Å; A12-A16 PolarHBondContact O-N 3.46Å
13	S	82.1	Confident	83.3	Confident	62 Å²	62	99.6 Å²	99.6	43%	0.434	51%	0.506	S	S	.	.	H	α-helix	trans	-68.5	-34.1	178.2	-62.8	0	0	0	0	113.2	A9 I10 L11 R17	A9-S13 PolarHBondContact O-N 3.41Å; A9-S13 PolarHBondContact O-OG 2.8Å; I10-S13 CarbonylContact O-C 3.56Å; I10-S13 PolarHBondContact O-N 3.48Å; L11-S13 VanDerWaalsContact C-N 3.28Å; L11-S13 PolarHBondContact O-N 3.39Å; S13-R17 WeakPolarHBondContact O-CB 3.44Å; S13-R17 VanDerWaalsContact O-CG 3.26Å; S13-R17 WeakPolarHBondContact O-CG 3.4Å; S13-R17 PolarHBondContact O-N 3.27Å; S13-R17 PolarHBondContact O-NE 2.98Å
14	L	89.3	Confident	83.1	Confident	90 Å²	90	98.2 Å²	98.2	47%	0.471	50%	0.5	S	S	.	.	H	α-helix	trans	-72.6	-43.9	177.1	-75.7	174.2	0	0	0	111.3	I10 L11 R17 Q18	I10-L14 HydrophobicContact CG2-CD1 3.61Å; I10-L14 HydrophobicContact CG2-CG 3.92Å; I10-L14 WeakPolarHBondContact O-CB 3.5Å; I10-L14 WeakPolarHBondContact O-CG 3.32Å; I10-L14 PolarHBondContact O-N 2.95Å; L11-L14 PolarHBondContact O-N 2.97Å; L11-L14 VanDerWaalsContact O-N 3.17Å; L14-R17 PolarHBondContact O-N 3.39Å; L14-Q18 WeakPolarHBondContact O-CB 3.38Å; L14-Q18 PolarHBondContact O-N 3.17Å
15	T	84.9	Confident	82.7	Confident	65 Å²	65	98.5 Å²	98.5	40%	0.399	50%	0.498	S	S	.	.	H	α-helix	trans	-63.6	-44.2	177.7	-58.9	0	0	0	0	111.3	L11 R17 Q18 N19	L11-T15 WeakPolarHBondContact O-CB 3.42Å; L11-T15 PolarHBondContact O-N 3.26Å; L11-T15 PolarHBondContact O-OG1 2.85Å; L11-T15 VanDerWaalsContact O-OG1 3.04Å; T15-R17 PolarHBondContact O-N 3.44Å; T15-Q18 PolarHBondContact O-N 3Å; T15-N19 WeakPolarHBondContact O-CB 3.32Å; T15-N19 VanDerWaalsContact O-CG 3.31Å; T15-N19 PolarHBondContact O-N 2.79Å; T15-N19 PolarHBondContact O-ND2 3.19Å
16	A	79.5	Confident	82.2	Confident	51 Å²	51	93.7 Å²	93.7	42%	0.421	48%	0.481	S	S	.	.	H	α-helix	trans	-60	-45.4	174.3	0	0	0	0	0	111.8	A12 Q18 N19 L20	A12-A16 WeakPolarHBondContact O-CB 3.49Å; A12-A16 PolarHBondContact O-N 3.46Å; A16-Q18 VanDerWaalsContact C-N 3.34Å; A16-Q18 PolarHBondContact O-N 3.04Å; A16-N19 PolarHBondContact O-N 2.98Å; A16-L20 WeakPolarHBondContact O-CB 3.4Å; A16-L20 VanDerWaalsContact O-CG 3.32Å; A16-L20 WeakPolarHBondContact O-CG 3.26Å; A16-L20 PolarHBondContact O-N 2.87Å
17	R	80.4	Confident	81.1	Confident	136 Å²	136	94.8 Å²	94.8	51%	0.513	48%	0.479	S	S	.	.	H	α-helix	trans	-62.6	-39	176.3	-79.5	-178.8	-73.2	-164.2	0.3	112.6	S13 L14 T15 R21	S13-R17 WeakPolarHBondContact O-CB 3.44Å; S13-R17 VanDerWaalsContact O-CG 3.26Å; S13-R17 WeakPolarHBondContact O-CG 3.4Å; S13-R17 PolarHBondContact O-N 3.27Å; S13-R17 PolarHBondContact O-NE 2.98Å; L14-R17 PolarHBondContact O-N 3.39Å; T15-R17 PolarHBondContact O-N 3.44Å; R17-R21 WeakPolarHBondContact O-CB 3.34Å; R17-R21 VanDerWaalsContact O-CG 3.31Å; R17-R21 WeakPolarHBondContact O-CG 3.48Å; R17-R21 PolarHBondContact O-N 2.88Å
18	Q	86.6	Confident	80.1	Confident	98 Å²	98	93.4 Å²	93.4	46%	0.458	48%	0.478	S	S	.	.	H	α-helix	trans	-67.6	-43.1	178.8	-171.4	175.9	14.2	0	0	111.6	L14 T15 A16 R21 R22	L14-Q18 WeakPolarHBondContact O-CB 3.38Å; L14-Q18 PolarHBondContact O-N 3.17Å; T15-Q18 PolarHBondContact O-N 3Å; A16-Q18 VanDerWaalsContact C-N 3.34Å; A16-Q18 PolarHBondContact O-N 3.04Å; Q18-R21 PolarHBondContact O-N 3.48Å; Q18-R22 VanDerWaalsContact NE2-NH2 3.16Å; Q18-R22 WeakPolarHBondContact O-CG 3.38Å; Q18-R22 PolarHBondContact O-N 3.37Å
19	N	85.6	Confident	79.1	Confident	83 Å²	83	95.6 Å²	95.6	44%	0.444	48%	0.481	S	S	.	.	H	α-helix	trans	-64.3	-44.4	177.8	-71	-16	0	0	0	111.4	T15 A16 R21 R22 E23	T15-N19 WeakPolarHBondContact O-CB 3.32Å; T15-N19 VanDerWaalsContact O-CG 3.31Å; T15-N19 PolarHBondContact O-N 2.79Å; T15-N19 PolarHBondContact O-ND2 3.19Å; A16-N19 PolarHBondContact O-N 2.98Å; N19-R21 PolarHBondContact O-N 2.89Å; N19-R22 PolarHBondContact O-N 2.94Å; N19-E23 PolarHBondContact O-N 3.36Å
20	L	77.3	Confident	78.1	Confident	88 Å²	88	101.9 Å²	101.9	46%	0.461	49%	0.492	S	S	.	.	H	α-helix	trans	-61.1	-44.4	174.7	-71.4	171.5	0	0	0	111.6	A16 R22 E23 W24	A16-L20 WeakPolarHBondContact O-CB 3.4Å; A16-L20 VanDerWaalsContact O-CG 3.32Å; A16-L20 WeakPolarHBondContact O-CG 3.26Å; A16-L20 PolarHBondContact O-N 2.87Å; L20-R22 VanDerWaalsContact C-N 3.3Å; L20-R22 PolarHBondContact O-N 3.21Å; L20-E23 PolarHBondContact O-N 3.17Å; L20-W24 WeakPolarHBondContact O-CB 3.4Å; L20-W24 PolarHBondContact O-N 3.33Å
21	R	77.9	Confident	76.4	Confident	180 Å²	180	100.6 Å²	100.6	68%	0.679	49%	0.49	S	S	*	.	H	α-helix	trans	-56.1	-45.8	175.9	-78.7	179.7	-178	-147.3	2.1	111.5	R17 Q18 N19 W24 H25	R17-R21 WeakPolarHBondContact O-CB 3.34Å; R17-R21 VanDerWaalsContact O-CG 3.31Å; R17-R21 WeakPolarHBondContact O-CG 3.48Å; R17-R21 PolarHBondContact O-N 2.88Å; Q18-R21 PolarHBondContact O-N 3.48Å; N19-R21 PolarHBondContact O-N 2.89Å; R21-W24 PolarHBondContact O-N 2.98Å; R21-H25 WeakPolarHBondContact O-CB 3.45Å; R21-H25 PolarHBondContact O-CD2 2.9Å; R21-H25 PolarHBondContact O-N 3.39Å
22	R	79	Confident	74.7	Confident	147 Å²	147	100 Å²	100	56%	0.555	49%	0.49	S	S	*	.	H	α-helix	trans	-62.6	-44.4	177.5	-71.2	177.5	-179.5	148.1	-5.1	112.1	Q18 N19 L20 H25 A26	Q18-R22 VanDerWaalsContact NE2-NH2 3.16Å; Q18-R22 WeakPolarHBondContact O-CG 3.38Å; Q18-R22 PolarHBondContact O-N 3.37Å; N19-R22 PolarHBondContact O-N 2.94Å; L20-R22 VanDerWaalsContact C-N 3.3Å; L20-R22 PolarHBondContact O-N 3.21Å; R22-H25 PolarHBondContact O-N 3.23Å; R22-A26 WeakPolarHBondContact O-CB 3.27Å; R22-A26 PolarHBondContact O-N 3.06Å
23	E	78.1	Confident	73.1	Confident	84 Å²	84	100.5 Å²	100.5	39%	0.393	50%	0.502	S	S	.	.	H	α-helix	trans	-62.9	-45	179.1	-172.2	-177.2	173.7	0	0	111.8	N19 L20 A26 R27	N19-E23 PolarHBondContact O-N 3.36Å; L20-E23 PolarHBondContact O-N 3.17Å; E23-A26 PolarHBondContact O-N 2.92Å; E23-R27 WeakPolarHBondContact O-CB 3.31Å; E23-R27 WeakPolarHBondContact O-CG 3.49Å; E23-R27 PolarHBondContact O-N 3.46Å; E23-R27 IonicContact OE1-CZ 3.13Å; E23-R27 IonicContact OE1-NE 3.71Å; E23-R27 IonicContact OE1-NH1 3.69Å; E23-R27 IonicContact OE1-NH2 2.63Å; E23-R27 PolarHBondContact OE1-NH2 3.43Å
24	W	75	Confident	71.5	Confident	164 Å²	164	101.7 Å²	101.7	62%	0.621	52%	0.515	S	S	*	.	H	α-helix	trans	-65.5	-40.5	176.5	-78	109.7	0	0	0	112.5	L20 R21 R27 A28	L20-W24 WeakPolarHBondContact O-CB 3.4Å; L20-W24 PolarHBondContact O-N 3.33Å; R21-W24 PolarHBondContact O-N 2.98Å; W24-R27 PolarHBondContact O-N 2.63Å; W24-A28 WeakPolarHBondContact O-CB 3.45Å; W24-A28 PolarHBondContact O-N 3Å
25	H	74.3	Confident	69.4	Low	109 Å²	109	99.8 Å²	99.8	51%	0.505	51%	0.509	S	S	.	.	H	α-helix	trans	-61.5	-47.3	173.6	-90.1	-73.4	0	0	0	111.6	R21 R22 R27 A28 E29	R21-H25 WeakPolarHBondContact O-CB 3.45Å; R21-H25 PolarHBondContact O-CD2 2.9Å; R21-H25 PolarHBondContact O-N 3.39Å; R22-H25 PolarHBondContact O-N 3.23Å; H25-R27 VanDerWaalsContact C-N 3.31Å; H25-R27 PolarHBondContact O-N 3.28Å; H25-A28 WeakPolarHBondContact O-CB 3.43Å; H25-A28 PolarHBondContact O-N 3.43Å; H25-E29 WeakPolarHBondContact O-CG 3.38Å; H25-E29 PolarHBondContact O-N 3.13Å
26	A	67.6	Low	67.5	Low	30 Å²	30	106.1 Å²	106.1	25%	0.248	53%	0.534	C	S	.	.	H	α-helix	trans	-64.7	-34.3	177.7	0	0	0	0	0	112.6	R22 E23 R30	R22-A26 WeakPolarHBondContact O-CB 3.27Å; R22-A26 PolarHBondContact O-N 3.06Å; E23-A26 PolarHBondContact O-N 2.92Å; A26-R30 WeakPolarHBondContact O-CB 3.48Å; A26-R30 VanDerWaalsContact O-CG 3.27Å; A26-R30 WeakPolarHBondContact O-CG 3.39Å; A26-R30 PolarHBondContact O-N 2.87Å
27	R	65.8	Low	66	Low	125 Å²	125	112 Å²	112	47%	0.472	55%	0.553	S	S	.	*	H	α-helix	trans	-67.3	-43	172.4	-77.5	-180	179.3	168	4.6	111.8	E23 W24 H25 R30 S31	E23-R27 WeakPolarHBondContact O-CB 3.31Å; E23-R27 WeakPolarHBondContact O-CG 3.49Å; E23-R27 PolarHBondContact O-N 3.46Å; E23-R27 IonicContact OE1-CZ 3.13Å; E23-R27 IonicContact OE1-NE 3.71Å; E23-R27 IonicContact OE1-NH1 3.69Å; E23-R27 IonicContact OE1-NH2 2.63Å; E23-R27 PolarHBondContact OE1-NH2 3.43Å; W24-R27 PolarHBondContact O-N 2.63Å; H25-R27 VanDerWaalsContact C-N 3.31Å; H25-R27 PolarHBondContact O-N 3.28Å; R27-R30 PolarHBondContact O-N 3.39Å; R27-S31 WeakPolarHBondContact O-CB 3.37Å; R27-S31 PolarHBondContact O-N 3.43Å; R27-S31 PolarHBondContact O-OG 3.42Å; R27-S31 VanDerWaalsContact O-OG 3.13Å
28	A	68	Low	64.6	Low	45 Å²	45	109.3 Å²	109.3	37%	0.372	55%	0.548	S	S	.	.	H	α-helix	trans	-60.8	-49.2	175.8	0	0	0	0	0	110.7	W24 H25 R30 S31 V32	W24-A28 WeakPolarHBondContact O-CB 3.45Å; W24-A28 PolarHBondContact O-N 3Å; H25-A28 WeakPolarHBondContact O-CB 3.43Å; H25-A28 PolarHBondContact O-N 3.43Å; A28-R30 PolarHBondContact O-N 3.37Å; A28-S31 WeakPolarHBondContact CA-OG 3.17Å; A28-S31 CarbonylContact O-C 3.58Å; A28-S31 PolarHBondContact O-N 3.41Å; A28-S31 VanDerWaalsContact O-N 3.11Å; A28-S31 PolarHBondContact O-OG 3.28Å; A28-V32 WeakPolarHBondContact O-CG2 3.35Å; A28-V32 PolarHBondContact O-N 3.04Å
29	E	65.1	Low	62.8	Low	141 Å²	141	108.4 Å²	108.4	66%	0.659	55%	0.551	S	S	*	*	H	α-helix	trans	-60.9	-42.9	177.6	-72.6	173.3	-177.5	0	0	112.5	H25 S31 V32 G33	H25-E29 WeakPolarHBondContact O-CG 3.38Å; H25-E29 PolarHBondContact O-N 3.13Å; E29-S31 VanDerWaalsContact C-N 3.31Å; E29-S31 PolarHBondContact O-N 2.9Å; E29-V32 PolarHBondContact O-N 2.88Å; E29-G33 PolarHBondContact O-N 3.18Å
30	R	60.1	Low	61.1	Low	195 Å²	195	111.9 Å²	111.9	74%	0.736	56%	0.564	S	S	*	*	H	α-helix	trans	-64.8	-33.9	174.2	-74.7	-177.2	-172	120.5	-1.8	113	A26 R27 A28	A26-R30 WeakPolarHBondContact O-CB 3.48Å; A26-R30 VanDerWaalsContact O-CG 3.27Å; A26-R30 WeakPolarHBondContact O-CG 3.39Å; A26-R30 PolarHBondContact O-N 2.87Å; R27-R30 PolarHBondContact O-N 3.39Å; A28-R30 PolarHBondContact O-N 3.37Å
31	S	55.3	Low	59.7	Low	54 Å²	54	112.4 Å²	112.4	38%	0.378	56%	0.564	S	S	.	*	H	α-helix	trans	-76	-28	175.7	64.8	0	0	0	0	113.3	R27 A28 E29 G33 A34 S35	R27-S31 WeakPolarHBondContact O-CB 3.37Å; R27-S31 PolarHBondContact O-N 3.43Å; R27-S31 PolarHBondContact O-OG 3.42Å; R27-S31 VanDerWaalsContact O-OG 3.13Å; A28-S31 WeakPolarHBondContact CA-OG 3.17Å; A28-S31 CarbonylContact O-C 3.58Å; A28-S31 PolarHBondContact O-N 3.41Å; A28-S31 VanDerWaalsContact O-N 3.11Å; A28-S31 PolarHBondContact O-OG 3.28Å; E29-S31 VanDerWaalsContact C-N 3.31Å; E29-S31 PolarHBondContact O-N 2.9Å; S31-G33 VanDerWaalsContact C-N 3.27Å; S31-G33 PolarHBondContact O-N 3.22Å; S31-A34 CarbonylContact O-C 3.57Å; S31-A34 PolarHBondContact O-N 3.11Å; S31-S35 PolarHBondContact O-N 3.49Å
32	V	54.9	Low	58.3	Low	87 Å²	87	110.6 Å²	110.6	53%	0.527	56%	0.558	S	S	.	*	H	α-helix	trans	-68.9	-26.7	177.6	169.3	0	0	0	0	111.4	A28 E29 A34 S35 L38	A28-V32 WeakPolarHBondContact O-CG2 3.35Å; A28-V32 PolarHBondContact O-N 3.04Å; E29-V32 PolarHBondContact O-N 2.88Å; V32-A34 PolarHBondContact O-N 2.85Å; V32-S35 PolarHBondContact O-N 2.7Å; V32-L38 HydrophobicContact CG2-CD1 4.12Å
33	G	47.9	Very low	57.1	Low	77 Å²	77	109.3 Å²	109.3	79%	0.794	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68	-12.3	169.5	0	0	0	0	0	115	E29 S31	E29-G33 PolarHBondContact O-N 3.18Å; S31-G33 VanDerWaalsContact C-N 3.27Å; S31-G33 PolarHBondContact O-N 3.22Å
34	A	48.2	Very low	55.9	Low	86 Å²	86	108.5 Å²	108.5	71%	0.711	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-120.2	7.7	179.7	0	0	0	0	0	113.2	S31 V32	S31-A34 CarbonylContact O-C 3.57Å; S31-A34 PolarHBondContact O-N 3.11Å; V32-A34 PolarHBondContact O-N 2.85Å
35	S	45.2	Very low	54.8	Low	50 Å²	50	105.5 Å²	105.5	35%	0.35	56%	0.555	S	S	.	*			trans	-143.7	80.3	-176.3	-64.3	0	0	0	0	110.4	S31 V32 E37	S31-S35 PolarHBondContact O-N 3.49Å; V32-S35 PolarHBondContact O-N 2.7Å; S35-E37 PolarHBondContact O-N 3.25Å
36	H	45.5	Very low	53.6	Low	199 Å²	199	110.2 Å²	110.2	92%	0.921	57%	0.568	S	S	*	*	S	Bend	trans	-67.2	9.8	160.9	-147	-82.8	0	0	0	112.6
37	E	48.8	Very low	52.6	Low	175 Å²	175	112 Å²	112	82%	0.818	58%	0.579	S	S	*	*			trans	-142.8	65.9	176.3	-62.9	-169.4	-178.8	0	0	109.6	S35 P39	S35-E37 PolarHBondContact O-N 3.25Å; E37-P39 WeakPolarHBondContact O-CD 3.21Å
38	L	49.5	Very low	52	Low	78 Å²	78	115.3 Å²	115.3	41%	0.408	60%	0.6	S	S	.	*			trans	-84.8	114.8	157.8	-82.1	166.9	0	0	0	107.1	V32 E40 Y42	V32-L38 HydrophobicContact CG2-CD1 4.12Å; L38-E40 PolarHBondContact O-N 3.07Å; L38-Y42 HydrophobicContact CD2-CD2 3.86Å; L38-Y42 HydrophobicContact CD2-CE2 3.72Å
39	P	49	Very low	51.2	Low	79 Å²	79	120.3 Å²	120.3	51%	0.513	62%	0.62	S	S	.	*			trans	-58.6	135.4	178.3	-20	31.4	0	0	0	109.1	E37 H41 Y42	E37-P39 WeakPolarHBondContact O-CD 3.21Å; P39-H41 WeakPolarHBondContact O-CA 3.44Å; P39-H41 PolarHBondContact O-N 3.31Å; P39-Y42 PolarHBondContact O-N 3.49Å; P39-Y42 VanDerWaalsContact O-N 3.09Å
40	E	49.7	Very low	50.8	Low	156 Å²	156	115.3 Å²	115.3	73%	0.729	60%	0.6	S	S	*	*	G	3₁₀ helix	trans	-35	-17	171.6	-71.2	-75.7	144	0	0	115.8	L38 Y42 L43	L38-E40 PolarHBondContact O-N 3.07Å; E40-Y42 VanDerWaalsContact C-N 3.27Å; E40-Y42 PolarHBondContact O-N 3.04Å; E40-L43 PolarHBondContact O-N 3.1Å
41	H	49.8	Very low	50.7	Low	100 Å²	100	108.3 Å²	108.3	46%	0.463	59%	0.588	S	S	.	*	G	3₁₀ helix	trans	-58	-24.4	170.2	-77.3	-74.1	0	0	0	115.9	P39 L43 L44	P39-H41 WeakPolarHBondContact O-CA 3.44Å; P39-H41 PolarHBondContact O-N 3.31Å; H41-L43 VanDerWaalsContact C-N 3.33Å; H41-L44 PolarHBondContact O-N 3.44Å
42	Y	48.5	Very low	50.7	Low	141 Å²	141	113 Å²	113	55%	0.553	60%	0.604	S	S	*	*	G	3₁₀ helix	trans	-73.2	-24.6	177.6	-86.7	-87.9	0	0	0	113.4	L38 P39 E40 L44	L38-Y42 HydrophobicContact CD2-CD2 3.86Å; L38-Y42 HydrophobicContact CD2-CE2 3.72Å; P39-Y42 PolarHBondContact O-N 3.49Å; P39-Y42 VanDerWaalsContact O-N 3.09Å; E40-Y42 VanDerWaalsContact C-N 3.27Å; E40-Y42 PolarHBondContact O-N 3.04Å; Y42-L44 VanDerWaalsContact C-N 3.33Å
43	L	53	Low	50.7	Low	121 Å²	121	114.6 Å²	114.6	63%	0.634	61%	0.614	S	S	*	*	G	3₁₀ helix	trans	-76	-22.4	177.7	-67.8	172.8	0	0	0	112.7	E40 H41 I45 R46	E40-L43 PolarHBondContact O-N 3.1Å; H41-L43 VanDerWaalsContact C-N 3.33Å; L43-I45 PolarHBondContact O-N 3.23Å; L43-R46 PolarHBondContact O-N 2.9Å
44	L	53.5	Low	51.1	Low	67 Å²	67	111.6 Å²	111.6	35%	0.351	58%	0.583	S	S	.	*	G	3₁₀ helix	trans	-65.5	-22.3	176.7	-95.3	154.4	0	0	0	113.7	H41 Y42 R46 M57	H41-L44 PolarHBondContact O-N 3.44Å; Y42-L44 VanDerWaalsContact C-N 3.33Å; L44-R46 VanDerWaalsContact C-N 3.31Å; L44-M57 HydrophobicContact CD1-CE 4.12Å
45	I	51.6	Low	51.7	Low	101 Å²	101	113.6 Å²	113.6	52%	0.518	58%	0.576	S	S	.	*	G	3₁₀ helix	trans	-78.3	-18.2	-178.3	-58.7	175.7	0	0	0	111.5	L43 M58	L43-I45 PolarHBondContact O-N 3.23Å; I45-M58 HydrophobicContact CG1-SD 4.17Å
46	R	48.5	Very low	52.3	Low	207 Å²	207	120 Å²	120	78%	0.781	59%	0.592	S	S	*	*	G	3₁₀ helix	trans	-89.8	-6.9	-175.2	-141.3	-179.9	-177.2	173.7	0.5	114.6	L43 L44 Q48	L43-R46 PolarHBondContact O-N 2.9Å; L44-R46 VanDerWaalsContact C-N 3.31Å; R46-Q48 PolarHBondContact O-N 3.05Å
47	S	46.4	Very low	53.1	Low	68 Å²	68	115.1 Å²	115.1	48%	0.476	57%	0.571	S	S	.	*			trans	-91.2	106.2	-178	-166.2	0	0	0	0	111.1	N49 V50	S47-N49 PolarHBondContact O-N 3.12Å; S47-V50 WeakPolarHBondContact O-CG2 3.33Å
48	Q	53.8	Low	53.9	Low	194 Å²	194	109.2 Å²	109.2	91%	0.907	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.7	7.2	-179.2	-67.5	-177.2	8.6	0	0	114.4	R46	R46-Q48 PolarHBondContact O-N 3.05Å
49	N	51.6	Low	54.6	Low	150 Å²	150	111 Å²	111	80%	0.802	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-121.9	26.2	-175.6	-70.2	-27.3	0	0	0	114.3	S47 G51	S47-N49 PolarHBondContact O-N 3.12Å; N49-G51 PolarHBondContact O-N 2.82Å
50	V	56.1	Low	55.3	Low	37 Å²	37	115.9 Å²	115.9	22%	0.224	56%	0.562	C	S	.	*			trans	-79.1	109.3	171.9	-109.3	0	0	0	0	109.4	S47 M58	S47-V50 WeakPolarHBondContact O-CG2 3.33Å; V50-M58 HydrophobicContact CG2-CE 3.66Å
51	G	56.9	Low	55.7	Low	48 Å²	48	110 Å²	110	50%	0.495	54%	0.538	S	S	.	.			trans	-54.7	177.5	169.9	0	0	0	0	0	112.4	N49 T53 G54 K55	N49-G51 PolarHBondContact O-N 2.82Å; G51-T53 PolarHBondContact O-N 3.38Å; G51-G54 PolarHBondContact O-N 3.14Å; G51-K55 PolarHBondContact O-N 3.13Å
52	H	55.8	Low	56.5	Low	152 Å²	152	109.8 Å²	109.8	70%	0.704	54%	0.539	S	S	*	.	H	α-helix	trans	-49.7	-32.8	-174.3	-88.3	-80.7	0	0	0	114.4	R56	H52-R56 WeakPolarHBondContact O-CG 3.43Å; H52-R56 PolarHBondContact O-N 3.04Å; H52-R56 VanDerWaalsContact O-N 3.1Å
53	T	54.8	Low	57.2	Low	120 Å²	120	106.2 Å²	106.2	74%	0.736	53%	0.534	S	S	*	.	H	α-helix	trans	-65.2	-42.4	176.3	-14.3	0	0	0	0	112.5	G51 R56 M57	G51-T53 PolarHBondContact O-N 3.38Å; T53-R56 PolarHBondContact O-N 2.61Å; T53-M57 PolarHBondContact O-N 2.88Å
54	G	56.6	Low	57.5	Low	15 Å²	15	108.8 Å²	108.8	16%	0.155	54%	0.535	C	S	.	.	H	α-helix	trans	-71.9	-36.5	178.3	0	0	0	0	0	113.2	G51 R56 M57 M58	G51-G54 PolarHBondContact O-N 3.14Å; G54-R56 VanDerWaalsContact C-N 3.35Å; G54-R56 PolarHBondContact O-N 3.01Å; G54-M57 PolarHBondContact O-N 2.88Å; G54-M58 PolarHBondContact O-N 3.16Å
55	K	60.4	Low	57.6	Low	127 Å²	127	109.4 Å²	109.4	55%	0.552	54%	0.538	S	S	*	.	H	α-helix	trans	-62.1	-41.1	171.5	-65.7	-179.8	-176.2	176.8	0	111.8	G51 M58 L59	G51-K55 PolarHBondContact O-N 3.13Å; K55-M58 PolarHBondContact O-N 3.47Å; K55-L59 WeakPolarHBondContact O-CB 3.37Å; K55-L59 PolarHBondContact O-N 3.34Å
56	R	58.2	Low	57.7	Low	185 Å²	185	108.1 Å²	108.1	70%	0.698	54%	0.535	S	S	*	.	H	α-helix	trans	-65.4	-38.1	174.5	-79.4	-178.2	178.1	176.6	1.5	112.5	H52 T53 G54 L59 R60	H52-R56 WeakPolarHBondContact O-CG 3.43Å; H52-R56 PolarHBondContact O-N 3.04Å; H52-R56 VanDerWaalsContact O-N 3.1Å; T53-R56 PolarHBondContact O-N 2.61Å; G54-R56 VanDerWaalsContact C-N 3.35Å; G54-R56 PolarHBondContact O-N 3.01Å; R56-L59 PolarHBondContact O-N 2.66Å; R56-R60 WeakPolarHBondContact O-CB 3.39Å; R56-R60 WeakPolarHBondContact O-CG 3.28Å; R56-R60 PolarHBondContact O-N 3.09Å
57	M	63.4	Low	57.9	Low	96 Å²	96	101.3 Å²	101.3	47%	0.473	52%	0.52	S	S	.	.	H	α-helix	trans	-69.3	-40.6	177.8	-147.4	-179.5	83.4	0	0	111.4	L44 T53 G54 R60 C61	L44-M57 HydrophobicContact CD1-CE 4.12Å; T53-M57 PolarHBondContact O-N 2.88Å; G54-M57 PolarHBondContact O-N 2.88Å; M57-R60 PolarHBondContact O-N 3.35Å; M57-C61 PolarHBondContact O-N 3.5Å; M57-C61 PolarHBondContact O-SG 2.78Å
58	M	65.4	Low	57.8	Low	52 Å²	52	104 Å²	104	26%	0.256	53%	0.525	S	S	.	.	H	α-helix	trans	-60.1	-47.6	170.6	-97.3	-168.9	-66.1	0	0	111.8	I45 V50 G54 K55 R60 C61 L62	I45-M58 HydrophobicContact CG1-SD 4.17Å; V50-M58 HydrophobicContact CG2-CE 3.66Å; G54-M58 PolarHBondContact O-N 3.16Å; K55-M58 PolarHBondContact O-N 3.47Å; M58-R60 VanDerWaalsContact C-N 3.28Å; M58-R60 PolarHBondContact O-N 3.34Å; M58-C61 PolarHBondContact O-N 3.3Å; M58-C61 VanDerWaalsContact O-N 3.1Å; M58-L62 WeakPolarHBondContact O-CB 3.21Å; M58-L62 PolarHBondContact O-N 3.45Å
59	L	64.4	Low	57.4	Low	116 Å²	116	98.8 Å²	98.8	61%	0.607	51%	0.506	S	S	*	.	H	α-helix	trans	-59.2	-42	177.7	-160.9	81.6	0	0	0	111	K55 R56 L62 C63	K55-L59 WeakPolarHBondContact O-CB 3.37Å; K55-L59 PolarHBondContact O-N 3.34Å; R56-L59 PolarHBondContact O-N 2.66Å; L59-L62 PolarHBondContact O-N 3.48Å; L59-C63 VanDerWaalsContact O-CB 3.28Å; L59-C63 WeakPolarHBondContact O-CB 3.44Å; L59-C63 PolarHBondContact O-N 2.85Å; L59-C63 PolarHBondContact O-SG 3.1Å
60	R	62.9	Low	56.7	Low	181 Å²	181	94.5 Å²	94.5	68%	0.683	49%	0.488	S	S	*	.	H	α-helix	trans	-64.2	-39.4	174.8	-77.7	-178.5	178.2	-170	0.3	112.8	R56 M57 M58 R64	R56-R60 WeakPolarHBondContact O-CB 3.39Å; R56-R60 WeakPolarHBondContact O-CG 3.28Å; R56-R60 PolarHBondContact O-N 3.09Å; M57-R60 PolarHBondContact O-N 3.35Å; M58-R60 VanDerWaalsContact C-N 3.28Å; M58-R60 PolarHBondContact O-N 3.34Å; R60-R64 WeakPolarHBondContact O-CB 3.5Å; R60-R64 WeakPolarHBondContact O-CG 3.35Å; R60-R64 PolarHBondContact O-N 2.89Å
61	C	59.3	Low	55.6	Low	33 Å²	33	98.6 Å²	98.6	22%	0.223	50%	0.503	C	S	.	.	H	α-helix	trans	-68.8	-44.6	176.8	-68.2	0	0	0	0	111.1	M57 M58 C63 R64 L65	M57-C61 PolarHBondContact O-N 3.5Å; M57-C61 PolarHBondContact O-SG 2.78Å; M58-C61 PolarHBondContact O-N 3.3Å; M58-C61 VanDerWaalsContact O-N 3.1Å; C61-C63 PolarHBondContact O-N 3.29Å; C61-R64 PolarHBondContact O-N 3.28Å; C61-L65 WeakPolarHBondContact O-CB 3.36Å; C61-L65 WeakPolarHBondContact O-CG 3.47Å; C61-L65 PolarHBondContact O-N 3.25Å
62	L	64.7	Low	54.7	Low	94 Å²	94	104 Å²	104	49%	0.492	52%	0.515	S	S	.	.	H	α-helix	trans	-60.2	-47.2	175.7	-131.7	101.4	0	0	0	110.5	M58 L59 R64 L65 T66	M58-L62 WeakPolarHBondContact O-CB 3.21Å; M58-L62 PolarHBondContact O-N 3.45Å; L59-L62 PolarHBondContact O-N 3.48Å; L62-R64 VanDerWaalsContact C-N 3.29Å; L62-R64 PolarHBondContact O-N 3.35Å; L62-L65 PolarHBondContact O-N 2.9Å; L62-T66 WeakPolarHBondContact O-CG2 3.45Å; L62-T66 PolarHBondContact O-N 2.88Å; L62-T66 PolarHBondContact O-OG1 3.25Å; L62-T66 VanDerWaalsContact O-OG1 3.12Å
63	C	63.3	Low	53.7	Low	66 Å²	66	102.9 Å²	102.9	45%	0.446	51%	0.514	S	S	.	.	H	α-helix	trans	-61.7	-34.8	176.4	-71.5	0	0	0	0	112.7	L59 C61 T66 S67	L59-C63 VanDerWaalsContact O-CB 3.28Å; L59-C63 WeakPolarHBondContact O-CB 3.44Å; L59-C63 PolarHBondContact O-N 2.85Å; L59-C63 PolarHBondContact O-SG 3.1Å; C61-C63 PolarHBondContact O-N 3.29Å; C63-T66 WeakPolarHBondContact CA-OG1 3.35Å; C63-T66 PolarHBondContact O-OG1 3.49Å; C63-T66 VanDerWaalsContact O-OG1 3.05Å; C63-S67 WeakPolarHBondContact O-CB 3.37Å; C63-S67 PolarHBondContact O-N 3.4Å; C63-S67 PolarHBondContact O-OG 3.17Å
64	R	60.3	Low	52.9	Low	176 Å²	176	100.1 Å²	100.1	66%	0.664	50%	0.5	S	S	*	.	H	α-helix	trans	-70.6	-42.8	173.9	-79.6	-176.3	-163.9	-163.6	4.4	111.9	R60 C61 L62 S67 Q68	R60-R64 WeakPolarHBondContact O-CB 3.5Å; R60-R64 WeakPolarHBondContact O-CG 3.35Å; R60-R64 PolarHBondContact O-N 2.89Å; C61-R64 PolarHBondContact O-N 3.28Å; L62-R64 VanDerWaalsContact C-N 3.29Å; L62-R64 PolarHBondContact O-N 3.35Å; R64-S67 CarbonylContact O-C 3.58Å; R64-S67 PolarHBondContact O-N 3.1Å; R64-Q68 WeakPolarHBondContact O-CB 3.5Å; R64-Q68 WeakPolarHBondContact O-CG 3.49Å; R64-Q68 PolarHBondContact O-N 3.19Å
65	L	54.8	Low	51.8	Low	79 Å²	79	103.6 Å²	103.6	41%	0.414	51%	0.513	S	S	.	.	H	α-helix	trans	-62.9	-46	176.8	-74	164.1	0	0	0	110.8	C61 L62 S67 Q68 T69	C61-L65 WeakPolarHBondContact O-CB 3.36Å; C61-L65 WeakPolarHBondContact O-CG 3.47Å; C61-L65 PolarHBondContact O-N 3.25Å; L62-L65 PolarHBondContact O-N 2.9Å; L65-S67 VanDerWaalsContact C-N 3.28Å; L65-S67 PolarHBondContact O-N 3.45Å; L65-Q68 PolarHBondContact O-N 3.45Å; L65-Q68 VanDerWaalsContact O-N 3.14Å; L65-T69 WeakPolarHBondContact O-CG2 3.22Å; L65-T69 PolarHBondContact O-N 2.85Å; L65-T69 PolarHBondContact O-OG1 2.96Å
66	T	55.3	Low	50.9	Low	74 Å²	74	102.7 Å²	102.7	45%	0.454	52%	0.517	S	S	.	.	H	α-helix	trans	-65.6	-32.3	175	58.2	0	0	0	0	112.4	L62 C63 T69 S70	L62-T66 WeakPolarHBondContact O-CG2 3.45Å; L62-T66 PolarHBondContact O-N 2.88Å; L62-T66 PolarHBondContact O-OG1 3.25Å; L62-T66 VanDerWaalsContact O-OG1 3.12Å; C63-T66 WeakPolarHBondContact CA-OG1 3.35Å; C63-T66 PolarHBondContact O-OG1 3.49Å; C63-T66 VanDerWaalsContact O-OG1 3.05Å; T66-T69 WeakPolarHBondContact CA-OG1 3.28Å; T66-T69 PolarHBondContact O-OG1 3.21Å; T66-T69 VanDerWaalsContact O-OG1 3.1Å; T66-S70 WeakPolarHBondContact O-CB 3.38Å; T66-S70 PolarHBondContact O-N 3.36Å; T66-S70 PolarHBondContact O-OG 2.63Å; T66-S70 VanDerWaalsContact O-OG 3.04Å
67	S	51.4	Low	50	Low	65 Å²	65	97.9 Å²	97.9	46%	0.455	51%	0.512	S	S	.	.	H	α-helix	trans	-71.5	-31.2	174.3	-60.5	0	0	0	0	112.2	C63 R64 L65 S70 F71	C63-S67 WeakPolarHBondContact O-CB 3.37Å; C63-S67 PolarHBondContact O-N 3.4Å; C63-S67 PolarHBondContact O-OG 3.17Å; R64-S67 CarbonylContact O-C 3.58Å; R64-S67 PolarHBondContact O-N 3.1Å; L65-S67 VanDerWaalsContact C-N 3.28Å; L65-S67 PolarHBondContact O-N 3.45Å; S67-S70 WeakPolarHBondContact CA-OG 3.36Å; S67-S70 PolarHBondContact O-OG 3.17Å; S67-S70 VanDerWaalsContact O-OG 3.13Å; S67-F71 VanDerWaalsContact O-CB 3.3Å; S67-F71 WeakPolarHBondContact O-CB 3.3Å; S67-F71 PolarHBondContact O-N 2.85Å
68	Q	44.6	Very low	48.5	Very low	124 Å²	124	101.2 Å²	101.2	58%	0.579	52%	0.524	S	S	*	.	H	α-helix	trans	-76	-38.6	174.9	-75.3	175.6	-7	0	0	111.7	R64 L65 S70 F71 Q72	R64-Q68 WeakPolarHBondContact O-CB 3.5Å; R64-Q68 WeakPolarHBondContact O-CG 3.49Å; R64-Q68 PolarHBondContact O-N 3.19Å; L65-Q68 PolarHBondContact O-N 3.45Å; L65-Q68 VanDerWaalsContact O-N 3.14Å; Q68-S70 VanDerWaalsContact C-N 3.33Å; Q68-F71 PolarHBondContact O-N 3.33Å; Q68-Q72 PolarHBondContact O-N 3.2Å
69	T	44.4	Very low	46.9	Very low	85 Å²	85	105.4 Å²	105.4	52%	0.521	54%	0.537	S	S	.	.	H	α-helix	trans	-72.9	-25.7	173.2	59.9	0	0	0	0	112.6	L65 T66 N73	L65-T69 WeakPolarHBondContact O-CG2 3.22Å; L65-T69 PolarHBondContact O-N 2.85Å; L65-T69 PolarHBondContact O-OG1 2.96Å; T66-T69 WeakPolarHBondContact CA-OG1 3.28Å; T66-T69 PolarHBondContact O-OG1 3.21Å; T66-T69 VanDerWaalsContact O-OG1 3.1Å; T69-N73 PolarHBondContact O-N 3.22Å; T69-N73 PolarHBondContact O-ND2 2.96Å
70	S	37.7	Very low	45.9	Very low	59 Å²	59	108.5 Å²	108.5	41%	0.413	55%	0.546	S	S	.	.	H	α-helix	trans	-83	-24.4	170.4	72.4	0	0	0	0	112.7	T66 S67 Q68 S74	T66-S70 WeakPolarHBondContact O-CB 3.38Å; T66-S70 PolarHBondContact O-N 3.36Å; T66-S70 PolarHBondContact O-OG 2.63Å; T66-S70 VanDerWaalsContact O-OG 3.04Å; S67-S70 WeakPolarHBondContact CA-OG 3.36Å; S67-S70 PolarHBondContact O-OG 3.17Å; S67-S70 VanDerWaalsContact O-OG 3.13Å; Q68-S70 VanDerWaalsContact C-N 3.33Å; S70-S74 VanDerWaalsContact O-CB 3.28Å; S70-S74 WeakPolarHBondContact O-CB 3.33Å; S70-S74 PolarHBondContact O-N 3.3Å; S70-S74 PolarHBondContact O-OG 2.99Å
71	F	33.8	Very low	44.9	Very low	124 Å²	124	107.7 Å²	107.7	54%	0.544	55%	0.55	S	S	.	.	H	α-helix	trans	-66	-41.3	170.8	-141.4	-99	0	0	0	111.3	S67 Q68 E75	S67-F71 VanDerWaalsContact O-CB 3.3Å; S67-F71 WeakPolarHBondContact O-CB 3.3Å; S67-F71 PolarHBondContact O-N 2.85Å; Q68-F71 PolarHBondContact O-N 3.33Å; F71-E75 HydrophobicContact CE1-CG 4.39Å; F71-E75 WeakPolarHBondContact CE1-OE1 3.47Å; F71-E75 WeakPolarHBondContact CE1-OE2 3.4Å; F71-E75 WeakPolarHBondContact CZ-OE1 3.5Å
72	Q	37.5	Very low	43.6	Very low	161 Å²	161	112 Å²	112	75%	0.752	57%	0.57	S	S	*	*	H	α-helix	trans	-75.2	-25.2	177.8	-72.1	-165.3	-22	0	0	114.3	Q68	Q68-Q72 PolarHBondContact O-N 3.2Å
73	N	35.7	Very low	42.4	Very low	128 Å²	128	113.2 Å²	113.2	68%	0.684	58%	0.584	S	S	*	*	H	α-helix	trans	-101.5	-8.8	-177.5	-72.1	-34.2	0	0	0	115.2	T69	T69-N73 PolarHBondContact O-N 3.22Å; T69-N73 PolarHBondContact O-ND2 2.96Å
74	S	38	Very low	41.4	Very low	63 Å²	63	121.2 Å²	121.2	44%	0.441	61%	0.605	S	S	.	*	H	α-helix	trans	-109.1	-19	178.2	67.4	0	0	0	0	114.8	S70 F78	S70-S74 VanDerWaalsContact O-CB 3.28Å; S70-S74 WeakPolarHBondContact O-CB 3.33Å; S70-S74 PolarHBondContact O-N 3.3Å; S70-S74 PolarHBondContact O-OG 2.99Å; S74-F78 WeakPolarHBondContact O-CB 3.41Å; S74-F78 PolarHBondContact O-N 3.23Å; S74-F78 VanDerWaalsContact O-N 3.16Å
75	E	33	Very low	40.6	Very low	88 Å²	88	123.6 Å²	123.6	41%	0.411	61%	0.614	S	S	.	*	H	α-helix	trans	-75	-26.7	175	-74.6	-163.5	141.2	0	0	113.6	F71 S77	F71-E75 HydrophobicContact CE1-CG 4.39Å; F71-E75 WeakPolarHBondContact CE1-OE1 3.47Å; F71-E75 WeakPolarHBondContact CE1-OE2 3.4Å; F71-E75 WeakPolarHBondContact CZ-OE1 3.5Å; E75-S77 PolarHBondContact O-N 3.32Å
76	V	40.4	Very low	39.7	Very low	107 Å²	107	123.8 Å²	123.8	65%	0.648	62%	0.622	S	S	*	*	H	α-helix	trans	-70.5	-22.3	177.9	-178.2	0	0	0	0	112.3
77	S	39.1	Very low	39.1	Very low	84 Å²	84	126.6 Å²	126.6	59%	0.587	64%	0.639	S	S	*	*	H	α-helix	trans	-111.5	-28.7	-172.8	-53.1	0	0	0	0	114.1	E75	E75-S77 PolarHBondContact O-N 3.32Å
78	F	32.7	Very low	38.5	Very low	166 Å²	166	128.1 Å²	128.1	73%	0.728	65%	0.65	S	S	*	*	H	α-helix	trans	-86.2	-37.1	-177.6	-169.8	-102.9	0	0	0	113.4	S74 K80	S74-F78 WeakPolarHBondContact O-CB 3.41Å; S74-F78 PolarHBondContact O-N 3.23Å; S74-F78 VanDerWaalsContact O-N 3.16Å; F78-K80 VanDerWaalsContact C-N 3.25Å; F78-K80 PolarHBondContact O-N 3.02Å
79	W	31.9	Very low	38.5	Very low	140 Å²	140	129.6 Å²	129.6	53%	0.53	66%	0.661	S	S	.	*	T	Hydrogen-bonded Turn	trans	-75.5	-12.1	180	-74.7	108.3	0	0	0	114.1	Q81	W79-Q81 VanDerWaalsContact C-N 3.32Å; W79-Q81 PolarHBondContact O-N 2.84Å
80	K	43.2	Very low	38.3	Very low	182 Å²	182	137.4 Å²	137.4	79%	0.791	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.5	-12	-179.6	-133.3	174.4	-175.7	179.8	0	114	F78	F78-K80 VanDerWaalsContact C-N 3.25Å; F78-K80 PolarHBondContact O-N 3.02Å
81	Q	41	Very low	38.3	Very low	163 Å²	163	146 Å²	146	76%	0.762	70%	0.704	S	S	*	*	S	Bend	trans	-116	-4.9	-171.2	-83.2	-176.5	8.4	0	0	117	W79	W79-Q81 VanDerWaalsContact C-N 3.32Å; W79-Q81 PolarHBondContact O-N 2.84Å
82	N	32.3	Very low	38.6	Very low	123 Å²	123	150.6 Å²	150.6	66%	0.658	72%	0.718	S	S	*	*			trans	-158.8	93.1	177.4	-106	-53	0	0	0	115	R84	N82-R84 VanDerWaalsContact C-N 3.29Å; N82-R84 PolarHBondContact O-N 2.93Å
83	P	40.5	Very low	39	Very low	121 Å²	121	154.6 Å²	154.6	79%	0.786	73%	0.726	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.2	-5.3	179.9	-9.6	24.4	0	0	0	115
84	R	42.6	Very low	39.1	Very low	233 Å²	233	158.4 Å²	158.4	88%	0.879	74%	0.737	S	S	*	*	T	Hydrogen-bonded Turn	trans	-112.6	22.9	-163.7	-68.2	-167.9	-179.1	-145.7	2.5	117	N82	N82-R84 VanDerWaalsContact C-N 3.29Å; N82-R84 PolarHBondContact O-N 2.93Å
85	R	43	Very low	39.3	Very low	227 Å²	227	166.1 Å²	166.1	86%	0.857	76%	0.756	S	S	*	*			trans	-127.9	7.1	175.9	-102.3	-176.3	-179.4	-168.7	1.4	116.7	T87	R85-T87 PolarHBondContact O-N 3.28Å
86	S	36.6	Very low	39.4	Very low	82 Å²	82	169.6 Å²	169.6	57%	0.573	78%	0.777	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.7	41.6	-171.9	-169.5	0	0	0	0	115.4
87	T	40.9	Very low	39.3	Very low	134 Å²	134	176.2 Å²	176.2	82%	0.822	79%	0.791	S	S	*	*	T	Hydrogen-bonded Turn	trans	-128	-6.1	174.6	53.3	0	0	0	0	116.1	R85	R85-T87 PolarHBondContact O-N 3.28Å
88	S	40.7	Very low	39.4	Very low	97 Å²	97	179.6 Å²	179.6	68%	0.678	80%	0.801	S	S	*	*	S	Bend	trans	-95.8	-18	-176.8	66.4	0	0	0	0	115.9
89	L	42.6	Very low	39.3	Very low	155 Å²	155	181.6 Å²	181.6	81%	0.812	81%	0.81	S	S	*	*	G	3₁₀ helix	trans	-94.9	-5.6	-175.3	-89.7	158.4	0	0	0	115.4	R91	L89-R91 VanDerWaalsContact C-N 3.3Å; L89-R91 PolarHBondContact O-N 3.44Å
90	R	40.1	Very low	39.2	Very low	248 Å²	248	180.2 Å²	180.2	94%	0.936	82%	0.822	S	S	*	*	G	3₁₀ helix	trans	-79.8	-4.4	176.3	-108.1	-176.5	-176.9	-167.9	2	114.6
91	R	38.1	Very low	38.8	Very low	239 Å²	239	177 Å²	177	90%	0.902	82%	0.823	S	S	*	*	G	3₁₀ helix	trans	-99	4.1	-178.3	-88.5	-169.8	174.7	-169.6	-0	116.1	L89	L89-R91 VanDerWaalsContact C-N 3.3Å; L89-R91 PolarHBondContact O-N 3.44Å
92	R	41.5	Very low	38.2	Very low	222 Å²	222	176.5 Å²	176.5	84%	0.838	83%	0.825	S	S	*	*	S	Bend	trans	-110.6	16.8	-174.2	-133.7	-179.7	-174.7	-173.4	1.5	116.5
93	R	45.6	Very low	38.3	Very low	245 Å²	245	176.6 Å²	176.6	93%	0.925	83%	0.83	S	S	*	*	S	Bend	trans	-126.9	31.2	174.7	-70.5	-170.1	178.9	179.7	1.1	114
94	K	38.3	Very low	37.7	Very low	208 Å²	208	177 Å²	177	90%	0.904	83%	0.83	S	S	*	*	S	Bend	trans	-133.3	8.3	176.4	-115.4	-171.9	-177.5	-174	0	115.3
95	R	41.1	Very low	37.1	Very low	225 Å²	225	174.4 Å²	174.4	85%	0.849	83%	0.83	S	S	*	*	S	Bend	trans	-115.1	152.4	160.2	-74.4	-179.8	-167.4	165.3	2.6	106.4
96	D	35.8	Very low	36.3	Very low	161 Å²	161	166.7 Å²	166.7	86%	0.861	82%	0.82	S	S	*	*	S	Bend	trans	94.9	26.2	-175.8	-42.5	-15	0	0	0	115
97	R	38.4	Very low	36.1	Very low	246 Å²	246	171.4 Å²	171.4	93%	0.928	84%	0.838	S	S	*	*	S	Bend	trans	-114.5	16.9	164.5	-117	-169.4	-157.1	-172.8	5.6	114.8
98	L	40.9	Very low	35.5	Very low	154 Å²	154	169.4 Å²	169.4	81%	0.806	83%	0.83	S	S	*	*	S	Bend	trans	-144	136.5	172.2	-65.7	171.4	0	0	0	107.2
99	F	31.2	Very low	35	Very low	208 Å²	208	174 Å²	174	91%	0.912	84%	0.838	S	S	*	*			trans	81.9	118.4	-162.6	-65.1	-86.3	0	0	0	113.2
100	S	30	Very low	34.3	Very low	112 Å²	112	171.4 Å²	171.4	78%	0.783	83%	0.832	S	S	*	*			cis	-156.4	141.8	12.9	-159	0	0	0	0	109.4
101	S	32.9	Very low	33.9	Very low	115 Å²	115	165 Å²	165	80%	0.804	83%	0.826	S	S	*	*			trans	-60.4	151.4	-179.6	-65.8	0	0	0	0	113.6
102	N	30.1	Very low	33.5	Very low	151 Å²	151	156.6 Å²	156.6	81%	0.807	81%	0.813	S	S	*	*			trans	-55.8	132	161.1	-77.7	-32.1	0	0	0	111.5
103	V	32.9	Very low	33	Very low	125 Å²	125	153.8 Å²	153.8	76%	0.758	82%	0.815	S	S	*	*				52.5	122	126.8	-172.1	0	0	0	0	118.1
104	V	28.8	Very low	32.3	Very low	130 Å²	130	151.6 Å²	151.6	79%	0.788	81%	0.812	S	S	*	*				-176.6	142.1	123.9	148.5	0	0	0	0	110.5
105	M	29.6	Very low	31.8	Very low	179 Å²	179	146.7 Å²	146.7	88%	0.882	80%	0.804	S	S	*	*			trans	88	97.4	172.2	-66.1	-76.2	-91.3	0	0	119.2
106	G	25.5	Very low	31.6	Very low	64 Å²	64	147.1 Å²	147.1	66%	0.66	81%	0.806	S	S	*	*				120	116.9	110.3	0	0	0	0	0	118
107	L	32.4	Very low	31.6	Very low	181 Å²	181	144.1 Å²	144.1	95%	0.948	80%	0.796	S	S	*	*			trans	79	139.5	154.6	-48	167.8	0	0	0	116.2
108	S	28.5	Very low	31.3	Very low	92 Å²	92	139.6 Å²	139.6	64%	0.643	79%	0.789	S	S	*	*			cis	176.6	147.1	-15.8	179.3	0	0	0	0	104.9
109	K	31	Very low	30.7	Very low	195 Å²	195	138.9 Å²	138.9	85%	0.848	79%	0.786	S	S	*	*			trans	69.6	138.4	167.6	-70.3	161.6	172.2	179	0	116.2
110	S	27.9	Very low	30.5	Very low	99 Å²	99	134.7 Å²	134.7	69%	0.692	78%	0.781	S	S	*	*			cis	-173.2	153	8.2	40.7	0	0	0	0	108.3
111	S	32.2	Very low	30.5	Very low	114 Å²	114	134.8 Å²	134.8	80%	0.797	78%	0.782	S	S	*	*			trans	37.7	119.6	146.9	60.2	0	0	0	0	118.2
112	G	29.6	Very low	30.6	Very low	63 Å²	63	135.4 Å²	135.4	65%	0.649	78%	0.781	S	S	*	*				127.8	139.9	58.7	0	0	0	0	0	107.9
113	D	29.9	Very low	30.7	Very low	163 Å²	163	139.1 Å²	139.1	87%	0.872	78%	0.783	S	S	*	*			trans	73.6	108.4	150.8	-50.6	-28.3	0	0	0	121.7
114	F	31.6	Very low	30.8	Very low	198 Å²	198	139.3 Å²	139.3	87%	0.868	79%	0.785	S	S	*	*			trans	-15.6	124.5	140.1	-118.9	-102.5	0	0	0	115.5
115	S	27.6	Very low	31.4	Very low	105 Å²	105	137.8 Å²	137.8	73%	0.734	78%	0.778	S	S	*	*			trans	-165.7	122.7	143.5	-152.6	0	0	0	0	110.6
116	W	36.4	Very low	31.7	Very low	235 Å²	235	136.1 Å²	136.1	89%	0.89	77%	0.771	S	S	*	*			trans	-89.2	134.6	156.6	-73	93.5	0	0	0	107.1
117	P	37.3	Very low	32.1	Very low	98 Å²	98	142.4 Å²	142.4	64%	0.636	78%	0.783	S	S	*	*				-146.1	140.8	128.9	28.4	-8.7	0	0	0	114.7
118	L	31.9	Very low	32.3	Very low	151 Å²	151	141.1 Å²	141.1	79%	0.791	78%	0.777	S	S	*	*				47.5	142	128	-67.5	157.6	0	0	0	122
119	D	27.8	Very low	32.6	Very low	138 Å²	138	146 Å²	146	74%	0.738	81%	0.811	S	S	*	*			trans	79.9	103.1	149.2	-65.3	-23.8	0	0	0	120.7
120	C	26.9	Very low	32.7	Very low	121 Å²	121	143.5 Å²	143.5	82%	0.818	81%	0.809	S	S	*	*				18.8	129.1	127.5	-62.8	0	0	0	0	119.2
121	S	30.4	Very low	32.9	Very low	114 Å²	114	145.8 Å²	145.8	80%	0.797	82%	0.815	S	S	*	*			trans	105	139.8	133.3	-145.4	0	0	0	0	117.2
122	T	35.6	Very low	33	Very low	127 Å²	127	147.6 Å²	147.6	78%	0.779	82%	0.816	S	S	*	*			trans	91	82	159.8	-16.8	0	0	0	0	118.5
123	R	31.6	Very low	33.2	Very low	229 Å²	229	152.6 Å²	152.6	86%	0.864	83%	0.826	S	S	*	*				8.1	133.1	123.8	-145.3	-173.6	-113.2	-148.3	-1.2	118.2
124	V	34.1	Very low	33.4	Very low	130 Å²	130	151.9 Å²	151.9	79%	0.788	82%	0.823	S	S	*	*			trans	131.6	141	135.4	178.4	0	0	0	0	113.4
125	P	42.8	Very low	33.5	Very low	98 Å²	98	148.9 Å²	148.9	64%	0.636	82%	0.82	S	S	*	*			trans	-114.3	171.3	-150.3	42.6	-30.4	0	0	0	115.7
126	I	35.8	Very low	33.9	Very low	143 Å²	143	152 Å²	152	73%	0.733	83%	0.826	S	S	*	*			trans	56.4	123.5	155	-59.6	153.7	0	0	0	117.7
127	Q	34.2	Very low	33.7	Very low	196 Å²	196	145.6 Å²	145.6	92%	0.916	82%	0.821	S	S	*	*				-155.8	133.9	125.9	-110.2	177.3	15	0	0	112.1
128	N	35.7	Very low	33.5	Very low	154 Å²	154	149.6 Å²	149.6	82%	0.824	84%	0.837	S	S	*	*			trans	-73.4	152.1	175.4	-63.1	-31.1	0	0	0	110.8
129	S	34.8	Very low	33.6	Very low	194 Å²	194	149.5 Å²	149.5	100%	1.357	84%	0.841	S	S	*	*			trans	-146.5	0	147.2	62.9	0	0	0	0	108.8

Retrieved 129 of 129 residues in 33.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).