X6R584_HUMAN Loading...

C-X-C motif chemokine ligand 17

AlphaFold DB , UniProt , Accession X6R584, Species HUMAN (Homo sapiens, Human), Gene CXCL17, Length 62 aa.

						>X6R584_HUMAN|X6R584|CXCL17
MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKAMLLFQIGS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.9	Low	80.5	Confident	193 Å²	193	118.6 Å²	118.6	95%	0.951	63%	0.629	S	S	*	*				0	-42	0	-58.9	-166.4	-171.2	0	0	113.4	V3 L4 I5	M1-V3 VanDerWaalsContact C-N 3.32Å; M1-V3 PolarHBondContact O-N 3.4Å; M1-L4 WeakPolarHBondContact O-CB 3.49Å; M1-L4 PolarHBondContact O-N 3.43Å; M1-L4 VanDerWaalsContact O-N 3.11Å; M1-I5 WeakPolarHBondContact O-CG1 3.42Å; M1-I5 PolarHBondContact O-N 3.05Å; M1-I5 VanDerWaalsContact O-N 3.11Å
2	K	74.5	Confident	80.4	Confident	187 Å²	187	117 Å²	117	81%	0.813	62%	0.619	S	S	*	*	H	α-helix	trans	-51.2	-41.6	176.2	-79	158.5	154.5	166	0	115.1	I5 S6	K2-I5 PolarHBondContact O-N 3.26Å; K2-S6 PolarHBondContact O-N 3.06Å
3	V	79.9	Confident	80.1	Confident	110 Å²	110	112.9 Å²	112.9	67%	0.667	60%	0.604	S	S	*	*	H	α-helix	trans	-66.6	-41.2	178.2	-176.8	0	0	0	0	111.7	M1 I5 S6 S7	M1-V3 VanDerWaalsContact C-N 3.32Å; M1-V3 PolarHBondContact O-N 3.4Å; V3-I5 VanDerWaalsContact C-N 3.31Å; V3-I5 PolarHBondContact O-N 3.45Å; V3-S6 PolarHBondContact O-N 3.31Å; V3-S7 WeakPolarHBondContact O-CB 3.42Å; V3-S7 PolarHBondContact O-N 2.86Å; V3-S7 PolarHBondContact O-OG 3.48Å; V3-S7 VanDerWaalsContact O-OG 3.13Å
4	L	83.3	Confident	79.7	Confident	127 Å²	127	113.4 Å²	113.4	67%	0.665	61%	0.606	S	S	*	*	H	α-helix	trans	-64.5	-37.8	177.6	-60.7	176.8	0	0	0	111.7	M1 S7 L8	M1-L4 WeakPolarHBondContact O-CB 3.49Å; M1-L4 PolarHBondContact O-N 3.43Å; M1-L4 VanDerWaalsContact O-N 3.11Å; L4-S7 PolarHBondContact O-N 3.11Å; L4-L8 VanDerWaalsContact O-CB 3.26Å; L4-L8 WeakPolarHBondContact O-CB 3.47Å; L4-L8 PolarHBondContact O-N 2.86Å
5	I	85.9	Confident	79.2	Confident	99 Å²	99	113.9 Å²	113.9	51%	0.508	61%	0.605	S	S	.	*	H	α-helix	trans	-64.6	-45.8	175.5	-62.7	163.4	0	0	0	109.7	M1 K2 V3 S7 L8 L9	M1-I5 WeakPolarHBondContact O-CG1 3.42Å; M1-I5 PolarHBondContact O-N 3.05Å; M1-I5 VanDerWaalsContact O-N 3.11Å; K2-I5 PolarHBondContact O-N 3.26Å; V3-I5 VanDerWaalsContact C-N 3.31Å; V3-I5 PolarHBondContact O-N 3.45Å; I5-S7 PolarHBondContact O-N 3.13Å; I5-L8 PolarHBondContact O-N 3.23Å; I5-L9 HydrophobicContact CG2-CD1 3.89Å; I5-L9 HydrophobicContact CG2-CG 4.34Å; I5-L9 WeakPolarHBondContact O-CB 3.49Å; I5-L9 VanDerWaalsContact O-CG 3.22Å; I5-L9 WeakPolarHBondContact O-CG 3.23Å; I5-L9 PolarHBondContact O-N 2.91Å
6	S	85.6	Confident	78.7	Confident	64 Å²	64	112.8 Å²	112.8	45%	0.448	60%	0.599	S	S	.	*	H	α-helix	trans	-61.9	-43.3	176.2	-166.6	0	0	0	0	112.2	K2 V3 L9 L10	K2-S6 PolarHBondContact O-N 3.06Å; V3-S6 PolarHBondContact O-N 3.31Å; S6-L9 PolarHBondContact O-N 3.43Å; S6-L10 WeakPolarHBondContact O-CB 3.22Å; S6-L10 WeakPolarHBondContact O-CD1 3.26Å; S6-L10 WeakPolarHBondContact O-CG 3.38Å; S6-L10 PolarHBondContact O-N 3.11Å
7	S	81.8	Confident	78	Confident	66 Å²	66	114.4 Å²	114.4	46%	0.462	60%	0.604	S	S	.	*	H	α-helix	trans	-63.2	-42	176.4	-65.5	0	0	0	0	111.9	V3 L4 I5 L10 L11	V3-S7 WeakPolarHBondContact O-CB 3.42Å; V3-S7 PolarHBondContact O-N 2.86Å; V3-S7 PolarHBondContact O-OG 3.48Å; V3-S7 VanDerWaalsContact O-OG 3.13Å; L4-S7 PolarHBondContact O-N 3.11Å; I5-S7 PolarHBondContact O-N 3.13Å; S7-L10 PolarHBondContact O-N 2.97Å; S7-L11 VanDerWaalsContact O-CB 3.24Å; S7-L11 WeakPolarHBondContact O-CB 3.26Å; S7-L11 PolarHBondContact O-N 2.88Å
8	L	83.3	Confident	77.1	Confident	114 Å²	114	110.8 Å²	110.8	60%	0.597	59%	0.589	S	S	*	*	H	α-helix	trans	-66.2	-42.9	178.3	-171.9	70.7	0	0	0	111.5	L4 I5 L10 L11 L12	L4-L8 VanDerWaalsContact O-CB 3.26Å; L4-L8 WeakPolarHBondContact O-CB 3.47Å; L4-L8 PolarHBondContact O-N 2.86Å; I5-L8 PolarHBondContact O-N 3.23Å; L8-L10 VanDerWaalsContact C-N 3.26Å; L8-L10 PolarHBondContact O-N 3.36Å; L8-L11 PolarHBondContact O-N 3.39Å; L8-L12 VanDerWaalsContact O-CB 3.24Å; L8-L12 WeakPolarHBondContact O-CB 3.49Å; L8-L12 PolarHBondContact O-N 3.34Å
9	L	85.8	Confident	76.3	Confident	117 Å²	117	112.1 Å²	112.1	61%	0.613	59%	0.594	S	S	*	*	H	α-helix	trans	-65.8	-27.7	177.1	-71.5	174.1	0	0	0	112.9	I5 S6 P13	I5-L9 HydrophobicContact CG2-CD1 3.89Å; I5-L9 HydrophobicContact CG2-CG 4.34Å; I5-L9 WeakPolarHBondContact O-CB 3.49Å; I5-L9 VanDerWaalsContact O-CG 3.22Å; I5-L9 WeakPolarHBondContact O-CG 3.23Å; I5-L9 PolarHBondContact O-N 2.91Å; S6-L9 PolarHBondContact O-N 3.43Å; L9-P13 WeakPolarHBondContact O-CD 2.88Å; L9-P13 VanDerWaalsContact O-CG 3.23Å; L9-P13 WeakPolarHBondContact O-CG 3.3Å
10	L	82.6	Confident	75.5	Confident	125 Å²	125	110.2 Å²	110.2	65%	0.654	59%	0.586	S	S	*	*	H	α-helix	trans	-83	-37.7	174.3	-78.6	162.1	0	0	0	112.5	S6 S7 L8	S6-L10 WeakPolarHBondContact O-CB 3.22Å; S6-L10 WeakPolarHBondContact O-CD1 3.26Å; S6-L10 WeakPolarHBondContact O-CG 3.38Å; S6-L10 PolarHBondContact O-N 3.11Å; S7-L10 PolarHBondContact O-N 2.97Å; L8-L10 VanDerWaalsContact C-N 3.26Å; L8-L10 PolarHBondContact O-N 3.36Å
11	L	81	Confident	74.6	Confident	103 Å²	103	107.5 Å²	107.5	54%	0.539	58%	0.577	S	S	.	*	H	α-helix	trans	-72.9	-35.5	-178.1	-167.1	73.5	0	0	0	112.1	S7 L8 L14 M15	S7-L11 VanDerWaalsContact O-CB 3.24Å; S7-L11 WeakPolarHBondContact O-CB 3.26Å; S7-L11 PolarHBondContact O-N 2.88Å; L8-L11 PolarHBondContact O-N 3.39Å; L11-L14 PolarHBondContact O-N 3.47Å; L11-M15 PolarHBondContact O-N 3.38Å
12	L	78.8	Confident	74.3	Confident	99 Å²	99	102.6 Å²	102.6	52%	0.518	56%	0.561	S	S	.	*	H	α-helix	trans	-63.3	-49.6	-175.9	-177.2	70.3	0	0	0	112.8	L8 L14 M15 L16	L8-L12 VanDerWaalsContact O-CB 3.24Å; L8-L12 WeakPolarHBondContact O-CB 3.49Å; L8-L12 PolarHBondContact O-N 3.34Å; L12-L14 VanDerWaalsContact C-N 3.29Å; L12-L14 PolarHBondContact O-N 3.23Å; L12-M15 PolarHBondContact O-N 3.46Å; L12-L16 HydrophobicContact CG-CD1 4.35Å; L12-L16 VanDerWaalsContact O-CG 3.28Å; L12-L16 WeakPolarHBondContact O-CG 3.3Å; L12-L16 PolarHBondContact O-N 3.07Å
13	P	77.6	Confident	73.4	Confident	64 Å²	64	97.7 Å²	97.7	42%	0.416	55%	0.55	S	S	.	*	H	α-helix	trans	-59.4	-38.1	173.2	-23.3	32.8	0	0	0	113.1	L9 L16 M17	L9-P13 WeakPolarHBondContact O-CD 2.88Å; L9-P13 VanDerWaalsContact O-CG 3.23Å; L9-P13 WeakPolarHBondContact O-CG 3.3Å; P13-L16 PolarHBondContact O-N 3.47Å; P13-M17 VanDerWaalsContact O-CG 3.3Å; P13-M17 WeakPolarHBondContact O-CG 3.28Å; P13-M17 PolarHBondContact O-N 3.32Å
14	L	73.9	Confident	71.9	Confident	120 Å²	120	98.9 Å²	98.9	63%	0.628	55%	0.552	S	S	*	*	H	α-helix	trans	-65	-44.3	-179.3	-174.6	66	0	0	0	111.8	L11 L12 M17 S18	L11-L14 PolarHBondContact O-N 3.47Å; L12-L14 VanDerWaalsContact C-N 3.29Å; L12-L14 PolarHBondContact O-N 3.23Å; L14-M17 PolarHBondContact O-N 3.06Å; L14-S18 WeakPolarHBondContact O-CB 3.24Å; L14-S18 PolarHBondContact O-N 3.39Å; L14-S18 VanDerWaalsContact O-N 3.07Å
15	M	72.7	Confident	70.7	Confident	120 Å²	120	97.1 Å²	97.1	59%	0.591	54%	0.543	S	S	*	.	H	α-helix	trans	-62.8	-41.8	174.1	-77.8	-80.4	-81.2	0	0	111.8	L11 L12 S18 M19	L11-M15 PolarHBondContact O-N 3.38Å; L12-M15 PolarHBondContact O-N 3.46Å; M15-S18 PolarHBondContact O-N 2.99Å; M15-M19 WeakPolarHBondContact O-CB 3.24Å; M15-M19 PolarHBondContact O-N 3.38Å
16	L	70.9	Confident	69	Low	97 Å²	97	98 Å²	98	51%	0.508	56%	0.556	S	S	.	*	H	α-helix	trans	-63.5	-45	178	-70.7	172.2	0	0	0	111.8	L12 P13 S18 M19 V20	L12-L16 HydrophobicContact CG-CD1 4.35Å; L12-L16 VanDerWaalsContact O-CG 3.28Å; L12-L16 WeakPolarHBondContact O-CG 3.3Å; L12-L16 PolarHBondContact O-N 3.07Å; P13-L16 PolarHBondContact O-N 3.47Å; L16-S18 VanDerWaalsContact C-N 3.34Å; L16-S18 PolarHBondContact O-N 3.37Å; L16-M19 PolarHBondContact O-N 2.92Å; L16-V20 WeakPolarHBondContact O-CB 3.31Å; L16-V20 WeakPolarHBondContact O-CG2 3.33Å; L16-V20 PolarHBondContact O-N 2.87Å
17	M	67.1	Low	67.4	Low	139 Å²	139	97.7 Å²	97.7	69%	0.685	56%	0.562	S	S	*	*	H	α-helix	trans	-63.5	-40	177.1	-68.2	-62	174	0	0	112	P13 L14 S21	P13-M17 VanDerWaalsContact O-CG 3.3Å; P13-M17 WeakPolarHBondContact O-CG 3.28Å; P13-M17 PolarHBondContact O-N 3.32Å; L14-M17 PolarHBondContact O-N 3.06Å; M17-S21 VanDerWaalsContact O-CB 3.31Å; M17-S21 WeakPolarHBondContact O-CB 3.46Å; M17-S21 PolarHBondContact O-N 3.37Å
18	S	60.6	Low	65.9	Low	50 Å²	50	100.3 Å²	100.3	35%	0.35	58%	0.575	S	S	.	*	H	α-helix	trans	-64	-45.8	175.8	-171.6	0	0	0	0	112.1	L14 M15 L16 S21 S22	L14-S18 WeakPolarHBondContact O-CB 3.24Å; L14-S18 PolarHBondContact O-N 3.39Å; L14-S18 VanDerWaalsContact O-N 3.07Å; M15-S18 PolarHBondContact O-N 2.99Å; L16-S18 VanDerWaalsContact C-N 3.34Å; L16-S18 PolarHBondContact O-N 3.37Å; S18-S21 PolarHBondContact O-N 2.86Å; S18-S22 WeakPolarHBondContact O-CB 3.49Å; S18-S22 PolarHBondContact O-N 3.36Å
19	M	63	Low	64.2	Low	136 Å²	136	99.3 Å²	99.3	67%	0.67	58%	0.584	S	S	*	*	H	α-helix	trans	-67.6	-40	178.9	-172.8	173.3	168	0	0	112.1	M15 L16 S22 S23	M15-M19 WeakPolarHBondContact O-CB 3.24Å; M15-M19 PolarHBondContact O-N 3.38Å; L16-M19 PolarHBondContact O-N 2.92Å; M19-S22 PolarHBondContact O-N 3.28Å; M19-S23 VanDerWaalsContact O-CB 3.32Å; M19-S23 WeakPolarHBondContact O-CB 3.22Å; M19-S23 PolarHBondContact O-N 2.74Å; M19-S23 PolarHBondContact O-OG 2.9Å
20	V	58.9	Low	62.4	Low	73 Å²	73	105.7 Å²	105.7	44%	0.442	60%	0.6	S	S	.	*	H	α-helix	trans	-64	-43.9	174.7	169.5	0	0	0	0	110.4	L16 S22 S23 L24	L16-V20 WeakPolarHBondContact O-CB 3.31Å; L16-V20 WeakPolarHBondContact O-CG2 3.33Å; L16-V20 PolarHBondContact O-N 2.87Å; V20-S22 VanDerWaalsContact C-N 3.32Å; V20-S22 PolarHBondContact O-N 2.86Å; V20-S23 WeakPolarHBondContact CA-OG 3.35Å; V20-S23 PolarHBondContact O-N 2.93Å; V20-S23 PolarHBondContact O-OG 2.93Å; V20-L24 HydrophobicContact CG1-CD1 3.6Å; V20-L24 WeakPolarHBondContact O-CB 3.35Å; V20-L24 PolarHBondContact O-N 3.33Å
21	S	58	Low	60.7	Low	55 Å²	55	102.7 Å²	102.7	39%	0.385	60%	0.599	S	S	.	*	H	α-helix	trans	-61.2	-37.9	174.4	-172.5	0	0	0	0	112.9	M17 S18 M55	M17-S21 VanDerWaalsContact O-CB 3.31Å; M17-S21 WeakPolarHBondContact O-CB 3.46Å; M17-S21 PolarHBondContact O-N 3.37Å; S18-S21 PolarHBondContact O-N 2.86Å; S21-M55 WeakPolarHBondContact OG-CE 3.37Å
22	S	55.2	Low	59.2	Low	89 Å²	89	106.3 Å²	106.3	62%	0.622	61%	0.613	S	S	*	*	H	α-helix	trans	-71	-38.5	176	-175.1	0	0	0	0	112.2	S18 M19 V20	S18-S22 WeakPolarHBondContact O-CB 3.49Å; S18-S22 PolarHBondContact O-N 3.36Å; M19-S22 PolarHBondContact O-N 3.28Å; V20-S22 VanDerWaalsContact C-N 3.32Å; V20-S22 PolarHBondContact O-N 2.86Å
23	S	55.2	Low	57.5	Low	84 Å²	84	113.1 Å²	113.1	59%	0.587	63%	0.632	S	S	*	*	H	α-helix	trans	-75.8	-29.5	-178.9	74.5	0	0	0	0	113.8	M19 V20 N25	M19-S23 VanDerWaalsContact O-CB 3.32Å; M19-S23 WeakPolarHBondContact O-CB 3.22Å; M19-S23 PolarHBondContact O-N 2.74Å; M19-S23 PolarHBondContact O-OG 2.9Å; V20-S23 WeakPolarHBondContact CA-OG 3.35Å; V20-S23 PolarHBondContact O-N 2.93Å; V20-S23 PolarHBondContact O-OG 2.93Å; S23-N25 VanDerWaalsContact C-N 3.25Å; S23-N25 PolarHBondContact O-N 3.41Å
24	L	49.4	Very low	56.4	Low	136 Å²	136	117.6 Å²	117.6	71%	0.712	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.2	-9.6	178.4	-91.8	157.4	0	0	0	113.1	V20	V20-L24 HydrophobicContact CG1-CD1 3.6Å; V20-L24 WeakPolarHBondContact O-CB 3.35Å; V20-L24 PolarHBondContact O-N 3.33Å
25	N	57	Low	55	Low	89 Å²	89	123.1 Å²	123.1	48%	0.476	66%	0.664	S	S	.	*			trans	-154.5	86.1	175.8	-143.2	-42.1	0	0	0	116.4	S23 G27 V28	S23-N25 VanDerWaalsContact C-N 3.25Å; S23-N25 PolarHBondContact O-N 3.41Å; N25-G27 PolarHBondContact OD1-N 2.91Å; N25-V28 WeakPolarHBondContact OD1-CB 3.44Å; N25-V28 PolarHBondContact OD1-N 2.94Å
26	P	51.1	Low	53.9	Low	118 Å²	118	120.1 Å²	120.1	77%	0.766	66%	0.664	S	S	*	*	S	Bend	trans	-99.4	4.2	146	33.2	-28.9	0	0	0	112.1
27	G	51.3	Low	52.8	Low	57 Å²	57	125.6 Å²	125.6	59%	0.588	69%	0.687	S	S	*	*	S	Bend	trans	-96.6	-10.3	-167.3	0	0	0	0	0	116.4	N25	N25-G27 PolarHBondContact OD1-N 2.91Å
28	V	50	Low	51.4	Low	121 Å²	121	122.8 Å²	122.8	73%	0.733	69%	0.686	S	S	*	*	S	Bend	trans	-118	42.7	-173.4	116.1	0	0	0	0	113	N25	N25-V28 WeakPolarHBondContact OD1-CB 3.44Å; N25-V28 PolarHBondContact OD1-N 2.94Å
29	A	47.4	Very low	50.7	Low	94 Å²	94	125.9 Å²	125.9	78%	0.777	71%	0.708	S	S	*	*			trans	-143.5	34.3	158.5	0	0	0	0	0	112.8	G31	A29-G31 PolarHBondContact O-N 3.3Å
30	R	48.9	Very low	50	Low	250 Å²	250	131 Å²	131	94%	0.943	72%	0.72	S	S	*	*			trans	-75.6	45	160.8	-74.4	-170.7	175.7	-177.8	-0.6	111.5
31	G	47.2	Very low	49.3	Very low	62 Å²	62	138.5 Å²	138.5	64%	0.639	74%	0.74	S	S	*	*	S	Bend	trans	-106.7	79.9	174.8	0	0	0	0	0	110.3	A29 R33	A29-G31 PolarHBondContact O-N 3.3Å; G31-R33 PolarHBondContact O-N 3.25Å
32	H	49.3	Very low	48.6	Very low	180 Å²	180	146.8 Å²	146.8	83%	0.833	76%	0.763	S	S	*	*			trans	40.7	75.3	150.1	-166.5	83.9	0	0	0	117.2
33	R	41.8	Very low	48.1	Very low	242 Å²	242	148 Å²	148	91%	0.913	76%	0.762	S	S	*	*			trans	-140.6	84.4	151.8	-80.6	-156.6	162.3	176.8	-3.4	111.3	G31 R35	G31-R33 PolarHBondContact O-N 3.25Å; R33-R35 PolarHBondContact O-N 3.41Å
34	D	54.7	Low	47.8	Very low	157 Å²	157	152.7 Å²	152.7	84%	0.84	77%	0.774	S	S	*	*			trans	-65.1	103.1	149.8	-164.2	-36.8	0	0	0	108
35	R	46.2	Very low	47.4	Very low	236 Å²	236	155.4 Å²	155.4	89%	0.891	78%	0.784	S	S	*	*			trans	-164.6	98.7	145.3	-141.8	156.4	77.7	-162.8	7.5	111.2	R33	R33-R35 PolarHBondContact O-N 3.41Å
36	G	48.9	Very low	46.7	Very low	57 Å²	57	155.3 Å²	155.3	59%	0.588	80%	0.803	S	S	*	*			trans	62.5	86.7	144	0	0	0	0	0	116.8	A38	G36-A38 PolarHBondContact O-N 2.85Å
37	Q	46.8	Very low	46.6	Very low	213 Å²	213	152.4 Å²	152.4	100%	0.995	80%	0.795	S	S	*	*	S	Bend		27.6	47.5	113.3	-154.2	177.5	-6.9	0	0	118.5
38	A	37.8	Very low	46.5	Very low	80 Å²	80	158.1 Å²	158.1	66%	0.661	81%	0.807	S	S	*	*			trans	-142.9	7.2	172.8	0	0	0	0	0	114.4	G36	G36-A38 PolarHBondContact O-N 2.85Å
39	S	47.5	Very low	46.3	Very low	115 Å²	115	158.6 Å²	158.6	80%	0.804	80%	0.801	S	S	*	*	S	Bend	trans	-115.3	45.3	176.3	-157.1	0	0	0	0	112.2
40	R	48.3	Very low	46.4	Very low	244 Å²	244	157.8 Å²	157.8	92%	0.921	79%	0.788	S	S	*	*	S	Bend	trans	-120.9	17	168.7	-75.5	-156.5	-168.4	-156.7	6	112.6
41	R	44.1	Very low	46.4	Very low	229 Å²	229	155 Å²	155	86%	0.864	79%	0.786	S	S	*	*	S	Bend	trans	-124.1	2.6	-175.2	-114.9	-164.3	-82.8	-148.5	0.4	116
42	W	41.9	Very low	46.8	Very low	230 Å²	230	155.8 Å²	155.8	87%	0.871	78%	0.781	S	S	*	*	S	Bend	trans	-118.6	0.3	-179.6	-73	102.5	0	0	0	114.8
43	L	46.3	Very low	46.6	Very low	115 Å²	115	157 Å²	157	60%	0.602	78%	0.784	S	S	*	*	S	Bend	trans	-121.6	49.9	-179.2	-148.2	77.9	0	0	0	112.7	E49	L43-E49 HydrophobicContact CD1-CG 4.11Å; L43-E49 WeakPolarHBondContact CD1-OE2 2.97Å; L43-E49 HydrophobicContact CD2-CB 4.45Å; L43-E49 HydrophobicContact CD2-CG 4.27Å; L43-E49 WeakPolarHBondContact CD2-OE2 3.11Å; L43-E49 HydrophobicContact CG-CG 4.46Å
44	Q	48.8	Very low	47.1	Very low	181 Å²	181	149.6 Å²	149.6	85%	0.846	77%	0.774	S	S	*	*			trans	-129.6	3.9	170.7	-110.4	-170.2	92.7	0	0	114.2
45	E	40	Very low	46.8	Very low	194 Å²	194	147.1 Å²	147.1	91%	0.907	76%	0.759	S	S	*	*	S	Bend	trans	-106.7	81.5	-179.6	-147.4	93	137.1	0	0	110.2
46	G	43.2	Very low	46.8	Very low	86 Å²	86	141.6 Å²	141.6	89%	0.887	75%	0.746	S	S	*	*	S	Bend	trans	93.4	17.5	146.1	0	0	0	0	0	120.8
47	G	47.7	Very low	46.4	Very low	58 Å²	58	146 Å²	146	60%	0.598	76%	0.755	S	S	*	*			trans	-151.7	122.4	176.1	0	0	0	0	0	113	E49	G47-E49 VanDerWaalsContact C-N 3.29Å; G47-E49 PolarHBondContact O-N 3.3Å
48	Q	48.9	Very low	46.2	Very low	177 Å²	177	144.4 Å²	144.4	83%	0.827	75%	0.746	S	S	*	*			trans	-66.3	87.8	172.9	-160	179.1	102.9	0	0	108.4	C50	Q48-C50 VanDerWaalsContact C-N 3.25Å; Q48-C50 PolarHBondContact O-N 3.17Å
49	E	47.3	Very low	46.5	Very low	130 Å²	130	148.5 Å²	148.5	61%	0.607	75%	0.751	S	S	*	*			trans	-71.3	83	175.9	-59.9	-156.9	143.4	0	0	109.7	L43 G47 E51	L43-E49 HydrophobicContact CD1-CG 4.11Å; L43-E49 WeakPolarHBondContact CD1-OE2 2.97Å; L43-E49 HydrophobicContact CD2-CB 4.45Å; L43-E49 HydrophobicContact CD2-CG 4.27Å; L43-E49 WeakPolarHBondContact CD2-OE2 3.11Å; L43-E49 HydrophobicContact CG-CG 4.46Å; G47-E49 VanDerWaalsContact C-N 3.29Å; G47-E49 PolarHBondContact O-N 3.3Å; E49-E51 PolarHBondContact O-N 2.84Å
50	C	49.2	Very low	46.5	Very low	77 Å²	77	149.5 Å²	149.5	52%	0.52	75%	0.746	S	S	.	*			trans	-75.6	105.1	155.1	-78.9	0	0	0	0	107.1	Q48 C52	Q48-C50 VanDerWaalsContact C-N 3.25Å; Q48-C50 PolarHBondContact O-N 3.17Å; C50-C52 PolarHBondContact O-N 3.39Å
51	E	49.5	Very low	46.5	Very low	193 Å²	193	141 Å²	141	90%	0.902	73%	0.734	S	S	*	*			trans	-63.8	66.5	165.2	-68.9	-173.3	92.7	0	0	110.6	E49 K53	E49-E51 PolarHBondContact O-N 2.84Å; E51-K53 VanDerWaalsContact C-N 3.34Å
52	C	54.3	Low	46.5	Very low	77 Å²	77	138.4 Å²	138.4	52%	0.52	75%	0.751	S	S	.	*			trans	-101.2	29.9	172.2	-159.2	0	0	0	0	111	C50	C50-C52 PolarHBondContact O-N 3.39Å
53	K	46.2	Very low	46.8	Very low	206 Å²	206	133.9 Å²	133.9	90%	0.896	75%	0.745	S	S	*	*	S	Bend	trans	-114.7	13.5	-175.7	-152.6	174.7	175	-176.9	0	114.7	E51	E51-K53 VanDerWaalsContact C-N 3.34Å
54	A	51.1	Low	46.8	Very low	86 Å²	86	134.8 Å²	134.8	71%	0.711	75%	0.753	S	S	*	*	S	Bend	trans	-122.3	-10.8	173.3	0	0	0	0	0	114.8
55	M	48.5	Very low	46.7	Very low	106 Å²	106	132.3 Å²	132.3	52%	0.522	75%	0.748	S	S	.	*	S	Bend	trans	-107.2	-17.6	-169.7	-161.3	171.5	61.7	0	0	115.2	S21 L57 F58 Q59	S21-M55 WeakPolarHBondContact OG-CE 3.37Å; M55-L57 PolarHBondContact O-N 2.96Å; M55-F58 PolarHBondContact O-N 2.72Å; M55-Q59 PolarHBondContact O-N 3.25Å
56	L	46.9	Very low	47.1	Very low	119 Å²	119	128.6 Å²	128.6	62%	0.623	74%	0.738	S	S	*	*	H	α-helix	trans	-67.5	-25.8	174.6	-87.1	158.9	0	0	0	112.6	I60	L56-I60 VanDerWaalsContact O-CD1 3.26Å; L56-I60 WeakPolarHBondContact O-CD1 3.33Å; L56-I60 VanDerWaalsContact O-CG1 3.3Å; L56-I60 WeakPolarHBondContact O-CG1 3.32Å
57	L	39.9	Very low	47.3	Very low	149 Å²	149	131.3 Å²	131.3	78%	0.78	73%	0.729	S	S	*	*	H	α-helix	trans	-77.2	-22.5	174.9	-72.2	172.3	0	0	0	113.1	M55	M55-L57 PolarHBondContact O-N 2.96Å
58	F	43.8	Very low	47.3	Very low	180 Å²	180	136.2 Å²	136.2	79%	0.789	74%	0.738	S	S	*	*	H	α-helix	trans	-87.3	-25.5	-177	-142.3	-88.8	0	0	0	113.1	M55	M55-F58 PolarHBondContact O-N 2.72Å
59	Q	43.4	Very low	47.2	Very low	167 Å²	167	133.3 Å²	133.3	78%	0.78	73%	0.731	S	S	*	*	H	α-helix	trans	-85.4	-16.5	174.9	-85.2	-82.8	95.8	0	0	113.9	M55	M55-Q59 PolarHBondContact O-N 3.25Å
60	I	48	Very low	47.2	Very low	136 Å²	136	133.5 Å²	133.5	70%	0.697	74%	0.741	S	S	*	*	S	Bend	trans	-87.6	-12.5	176.1	-61.9	169.5	0	0	0	111.3	L56	L56-I60 VanDerWaalsContact O-CD1 3.26Å; L56-I60 WeakPolarHBondContact O-CD1 3.33Å; L56-I60 VanDerWaalsContact O-CG1 3.3Å; L56-I60 WeakPolarHBondContact O-CG1 3.32Å
61	G	47.5	Very low	47	Very low	64 Å²	64	138.3 Å²	138.3	66%	0.66	76%	0.759	S	S	*	*			trans	-101.2	39.8	178.5	0	0	0	0	0	114.2
62	S	44.8	Very low	46.8	Very low	176 Å²	176	133.3 Å²	133.3	100%	1.231	75%	0.746	S	S	*	*			trans	-75.6	0	156.4	-176.9	0	0	0	0	110.5

Retrieved 62 of 62 residues in 17 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).