X6R6Z1_HUMAN Loading...

Interleukin enhancer binding factor 2

AlphaFold DB , UniProt , Accession X6R6Z1, Species HUMAN (Homo sapiens, Human), Gene ILF2, Length 115 aa.

						>X6R6Z1_HUMAN|X6R6Z1|ILF2
MAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.5	Low	79	Confident	243 Å²	243	152.3 Å²	152.3	100%	1.197	83%	0.832	S	S	*	*				0	122.5	0	-75	175	177.6	0	0	107.6
2	A	76	Confident	80.2	Confident	101 Å²	101	149.9 Å²	149.9	84%	0.835	81%	0.811	S	S	*	*	P	Polyproline II helix	trans	-86.7	135.5	177.4	0	0	0	0	0	109.4
3	F	74.8	Confident	81.3	Confident	196 Å²	196	144 Å²	144	86%	0.86	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-62.6	139.2	178.2	-77.7	-87.2	0	0	0	110.9	R5	F3-R5 PolarHBondContact O-N 3.22Å
4	P	79.8	Confident	82.3	Confident	122 Å²	122	140.1 Å²	140.1	79%	0.792	77%	0.771	S	S	*	*	P	Polyproline II helix	trans	-57.7	129.2	173.2	-19.8	30.6	0	0	0	110	V6	P4-V6 PolarHBondContact O-N 3.11Å
5	R	78.3	Confident	83.1	Confident	241 Å²	241	139.3 Å²	139.3	91%	0.909	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-64.8	133.2	174.5	-72.3	-177.3	168.2	171.5	-3.7	109	F3 K7	F3-R5 PolarHBondContact O-N 3.22Å; R5-K7 PolarHBondContact O-N 2.64Å
6	V	83.2	Confident	83.9	Confident	138 Å²	138	134 Å²	134	84%	0.836	73%	0.734	S	S	*	*	P	Polyproline II helix	trans	-59	138	174.8	91.1	0	0	0	0	108.6	P4	P4-V6 PolarHBondContact O-N 3.11Å
7	K	80.8	Confident	84.7	Confident	188 Å²	188	133 Å²	133	82%	0.817	72%	0.723	S	S	*	*	P	Polyproline II helix	trans	-60.9	138.1	173.8	-71.4	-177.2	179.2	179.3	0	108.3	R5	R5-K7 PolarHBondContact O-N 2.64Å
8	P	80.4	Confident	85.4	Confident	118 Å²	118	128.8 Å²	128.8	77%	0.766	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-53.6	146	171.7	-21.5	31.6	0	0	0	110
9	A	81.9	Confident	86	Confident	90 Å²	90	127.1 Å²	127.1	74%	0.744	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-56.3	141.8	171.5	0	0	0	0	0	109.4
10	P	85.3	Confident	86.6	Confident	105 Å²	105	126.3 Å²	126.3	68%	0.682	69%	0.692	S	S	*	*	P	Polyproline II helix	trans	-55.4	147.4	172.4	-22.3	33.1	0	0	0	111.1	E12	P10-E12 PolarHBondContact O-N 2.81Å
11	D	89.1	Confident	87	Confident	133 Å²	133	126.4 Å²	126.4	71%	0.711	69%	0.686	S	S	*	*			trans	-72.7	113.5	169.1	-178.3	5	0	0	0	109.1	T13	D11-T13 VanDerWaalsContact OD1-CB 3.22Å; D11-T13 WeakPolarHBondContact OD1-CB 3.38Å; D11-T13 PolarHBondContact OD1-N 3.02Å; D11-T13 PolarHBondContact OD1-OG1 3.2Å
12	E	93.4	Very high	88.8	Confident	124 Å²	124	121.9 Å²	121.9	58%	0.579	66%	0.656	S	S	*	*			trans	-101.9	13.1	-178.1	-61.4	-171.3	152.3	0	0	112.7	P10 S14 F15 S16	P10-E12 PolarHBondContact O-N 2.81Å; E12-S14 PolarHBondContact O-N 2.78Å; E12-F15 PolarHBondContact O-N 3.21Å; E12-S16 WeakPolarHBondContact O-CB 3.35Å; E12-S16 PolarHBondContact O-N 3.48Å; E12-S16 PolarHBondContact O-OG 2.9Å
13	T	94.9	Very high	89.6	Confident	73 Å²	73	122.2 Å²	122.2	45%	0.448	64%	0.644	S	S	.	*	H	α-helix	trans	-58.7	-52.4	-176.1	-57	0	0	0	0	111.4	D11 F15 S16 E17	D11-T13 VanDerWaalsContact OD1-CB 3.22Å; D11-T13 WeakPolarHBondContact OD1-CB 3.38Å; D11-T13 PolarHBondContact OD1-N 3.02Å; D11-T13 PolarHBondContact OD1-OG1 3.2Å; T13-F15 VanDerWaalsContact C-N 3.28Å; T13-F15 PolarHBondContact O-N 3.3Å; T13-S16 WeakPolarHBondContact O-CB 3.48Å; T13-S16 PolarHBondContact O-N 3.28Å; T13-S16 VanDerWaalsContact O-N 3.15Å; T13-E17 HydrophobicContact CG2-CG 4.47Å; T13-E17 WeakPolarHBondContact O-CG 3.35Å; T13-E17 PolarHBondContact O-N 3.44Å
14	S	94.7	Very high	90.5	Very high	89 Å²	89	119.7 Å²	119.7	62%	0.622	63%	0.634	S	S	*	*	H	α-helix	trans	-63.7	-33	-179.1	-54.6	0	0	0	0	113.2	E12 A18	E12-S14 PolarHBondContact O-N 2.78Å; S14-A18 WeakPolarHBondContact O-CB 3.41Å; S14-A18 PolarHBondContact O-N 2.97Å
15	F	94.6	Very high	91.2	Very high	129 Å²	129	118 Å²	118	57%	0.566	62%	0.619	S	S	*	*	H	α-helix	trans	-68.5	-45.3	175.1	177.1	-112	0	0	0	110.8	E12 T13 E17 A18 L19	E12-F15 PolarHBondContact O-N 3.21Å; T13-F15 VanDerWaalsContact C-N 3.28Å; T13-F15 PolarHBondContact O-N 3.3Å; F15-E17 PolarHBondContact O-N 3.42Å; F15-A18 PolarHBondContact O-N 3.02Å; F15-L19 HydrophobicContact CD1-CD1 4.08Å; F15-L19 HydrophobicContact CE1-CD1 3.53Å; F15-L19 HydrophobicContact CE1-CG 4.25Å; F15-L19 HydrophobicContact CE2-CD1 4.4Å; F15-L19 HydrophobicContact CE2-CD2 4.34Å; F15-L19 HydrophobicContact CE2-CG 4.3Å; F15-L19 HydrophobicContact CZ-CD1 3.71Å; F15-L19 HydrophobicContact CZ-CD2 4.2Å; F15-L19 HydrophobicContact CZ-CG 4.08Å; F15-L19 WeakPolarHBondContact O-CG 3.34Å; F15-L19 PolarHBondContact O-N 3.08Å
16	S	96.1	Very high	92	Very high	54 Å²	54	109.9 Å²	109.9	38%	0.378	59%	0.593	S	S	.	*	H	α-helix	trans	-60.5	-44	176.4	-58.5	0	0	0	0	111.8	E12 T13 A18 L19 L20	E12-S16 WeakPolarHBondContact O-CB 3.35Å; E12-S16 PolarHBondContact O-N 3.48Å; E12-S16 PolarHBondContact O-OG 2.9Å; T13-S16 WeakPolarHBondContact O-CB 3.48Å; T13-S16 PolarHBondContact O-N 3.28Å; T13-S16 VanDerWaalsContact O-N 3.15Å; S16-A18 PolarHBondContact O-N 3.38Å; S16-L19 PolarHBondContact O-N 3.47Å; S16-L20 WeakPolarHBondContact O-CG 3.32Å; S16-L20 PolarHBondContact O-N 3.22Å
17	E	97.2	Very high	92.4	Very high	117 Å²	117	105.1 Å²	105.1	55%	0.547	57%	0.568	S	S	.	*	H	α-helix	trans	-60.4	-42.6	174.9	-72.3	174.9	168.2	0	0	112.2	T13 F15 L19 L20 K21	T13-E17 HydrophobicContact CG2-CG 4.47Å; T13-E17 WeakPolarHBondContact O-CG 3.35Å; T13-E17 PolarHBondContact O-N 3.44Å; F15-E17 PolarHBondContact O-N 3.42Å; E17-L19 PolarHBondContact O-N 3.44Å; E17-L20 PolarHBondContact O-N 3.48Å; E17-K21 WeakPolarHBondContact O-CB 3.46Å; E17-K21 PolarHBondContact O-N 2.92Å
18	A	97.3	Very high	93.1	Very high	57 Å²	57	97 Å²	97	47%	0.471	53%	0.534	S	S	.	.	H	α-helix	trans	-63.7	-39.7	177.2	0	0	0	0	0	112.2	S14 F15 S16 R22	S14-A18 WeakPolarHBondContact O-CB 3.41Å; S14-A18 PolarHBondContact O-N 2.97Å; F15-A18 PolarHBondContact O-N 3.02Å; S16-A18 PolarHBondContact O-N 3.38Å; A18-R22 WeakPolarHBondContact O-CB 3.34Å; A18-R22 PolarHBondContact O-N 2.98Å
19	L	97.5	Very high	93.7	Very high	97 Å²	97	95.2 Å²	95.2	51%	0.508	52%	0.519	S	S	.	.	H	α-helix	trans	-65.4	-44.3	175	-69.2	-179.6	0	0	0	112	F15 S16 E17 R22 N23	F15-L19 HydrophobicContact CD1-CD1 4.08Å; F15-L19 HydrophobicContact CE1-CD1 3.53Å; F15-L19 HydrophobicContact CE1-CG 4.25Å; F15-L19 HydrophobicContact CE2-CD1 4.4Å; F15-L19 HydrophobicContact CE2-CD2 4.34Å; F15-L19 HydrophobicContact CE2-CG 4.3Å; F15-L19 HydrophobicContact CZ-CD1 3.71Å; F15-L19 HydrophobicContact CZ-CD2 4.2Å; F15-L19 HydrophobicContact CZ-CG 4.08Å; F15-L19 WeakPolarHBondContact O-CG 3.34Å; F15-L19 PolarHBondContact O-N 3.08Å; S16-L19 PolarHBondContact O-N 3.47Å; E17-L19 PolarHBondContact O-N 3.44Å; L19-R22 PolarHBondContact O-N 3.38Å; L19-N23 WeakPolarHBondContact O-CB 3.25Å; L19-N23 PolarHBondContact O-N 3.34Å
20	L	96.8	Very high	94.3	Very high	110 Å²	110	95.8 Å²	95.8	58%	0.576	52%	0.517	S	S	*	.	H	α-helix	trans	-62.2	-45.1	177.4	-72.5	173.1	0	0	0	111.3	S16 E17 N23 Q24	S16-L20 WeakPolarHBondContact O-CG 3.32Å; S16-L20 PolarHBondContact O-N 3.22Å; E17-L20 PolarHBondContact O-N 3.48Å; L20-N23 WeakPolarHBondContact O-CB 3.39Å; L20-N23 PolarHBondContact O-N 3.48Å; L20-Q24 WeakPolarHBondContact O-CG 3.41Å; L20-Q24 PolarHBondContact O-N 2.75Å
21	K	96.6	Very high	94.6	Very high	130 Å²	130	94.2 Å²	94.2	57%	0.565	51%	0.513	S	S	*	.	H	α-helix	trans	-60.5	-46.4	175.2	-177.3	173.5	-179.4	175	0	111.4	E17 N23 Q24 D25	E17-K21 WeakPolarHBondContact O-CB 3.46Å; E17-K21 PolarHBondContact O-N 2.92Å; K21-N23 VanDerWaalsContact C-N 3.28Å; K21-N23 PolarHBondContact O-N 3.49Å; K21-Q24 WeakPolarHBondContact O-CB 3.31Å; K21-Q24 PolarHBondContact O-N 3.41Å; K21-Q24 VanDerWaalsContact O-N 3.15Å; K21-D25 WeakPolarHBondContact O-CB 3.46Å; K21-D25 PolarHBondContact O-N 3.47Å
22	R	96.5	Very high	94.8	Very high	148 Å²	148	89 Å²	89	56%	0.558	48%	0.484	S	S	*	.	H	α-helix	trans	-62.4	-36.2	179	-173.8	57.8	173.9	151.8	0.8	112.3	A18 L19 L26	A18-R22 WeakPolarHBondContact O-CB 3.34Å; A18-R22 PolarHBondContact O-N 2.98Å; L19-R22 PolarHBondContact O-N 3.38Å; R22-L26 HydrophobicContact CG-CD1 4.11Å; R22-L26 WeakPolarHBondContact O-CB 3.35Å; R22-L26 VanDerWaalsContact O-CG 3.22Å; R22-L26 WeakPolarHBondContact O-CG 3.16Å; R22-L26 PolarHBondContact O-N 3.28Å
23	N	93.4	Very high	94.8	Very high	108 Å²	108	88.2 Å²	88.2	58%	0.578	48%	0.481	S	S	*	.	H	α-helix	trans	-63.4	-49.5	173.3	-175.9	-21.2	0	0	0	110.8	L19 L20 K21 D25 L26 A27	L19-N23 WeakPolarHBondContact O-CB 3.25Å; L19-N23 PolarHBondContact O-N 3.34Å; L20-N23 WeakPolarHBondContact O-CB 3.39Å; L20-N23 PolarHBondContact O-N 3.48Å; K21-N23 VanDerWaalsContact C-N 3.28Å; K21-N23 PolarHBondContact O-N 3.49Å; N23-D25 VanDerWaalsContact C-N 3.31Å; N23-D25 PolarHBondContact O-N 2.9Å; N23-L26 PolarHBondContact O-N 2.97Å; N23-L26 VanDerWaalsContact O-N 3.07Å; N23-A27 WeakPolarHBondContact O-CB 3.49Å; N23-A27 PolarHBondContact O-N 2.71Å
24	Q	93.7	Very high	94.7	Very high	143 Å²	143	87.5 Å²	87.5	67%	0.668	48%	0.482	S	S	*	.	H	α-helix	trans	-58.5	-42	176.8	-70.4	172.5	-2.2	0	0	112.5	L20 K21 L26 A27	L20-Q24 WeakPolarHBondContact O-CG 3.41Å; L20-Q24 PolarHBondContact O-N 2.75Å; K21-Q24 WeakPolarHBondContact O-CB 3.31Å; K21-Q24 PolarHBondContact O-N 3.41Å; K21-Q24 VanDerWaalsContact O-N 3.15Å; Q24-L26 PolarHBondContact O-N 2.77Å; Q24-A27 PolarHBondContact O-N 3.03Å
25	D	94.3	Very high	94.6	Very high	87 Å²	87	86.4 Å²	86.4	47%	0.465	47%	0.474	S	S	.	.	H	α-helix	trans	-66.6	-23.5	178.5	-67.2	-19.7	0	0	0	112.9	K21 N23 T77	K21-D25 WeakPolarHBondContact O-CB 3.46Å; K21-D25 PolarHBondContact O-N 3.47Å; N23-D25 VanDerWaalsContact C-N 3.31Å; N23-D25 PolarHBondContact O-N 2.9Å; D25-T77 VanDerWaalsContact O-CG2 3.31Å; D25-T77 WeakPolarHBondContact O-CG2 3.45Å
26	L	94.7	Very high	94.6	Very high	70 Å²	70	80.8 Å²	80.8	37%	0.366	45%	0.45	S	S	.	.	H	α-helix	trans	-97.6	-23.3	179.6	-70	174.7	0	0	0	112.8	R22 N23 Q24 T76 T77	R22-L26 HydrophobicContact CG-CD1 4.11Å; R22-L26 WeakPolarHBondContact O-CB 3.35Å; R22-L26 VanDerWaalsContact O-CG 3.22Å; R22-L26 WeakPolarHBondContact O-CG 3.16Å; R22-L26 PolarHBondContact O-N 3.28Å; N23-L26 PolarHBondContact O-N 2.97Å; N23-L26 VanDerWaalsContact O-N 3.07Å; Q24-L26 PolarHBondContact O-N 2.77Å; L26-T76 CarbonylContact O-C 3.59Å; L26-T76 VanDerWaalsContact O-CA 3.23Å; L26-T76 WeakPolarHBondContact O-CA 3.33Å; L26-T77 PolarHBondContact O-N 2.95Å
27	A	92.2	Very high	94.5	Very high	38 Å²	38	82.5 Å²	82.5	31%	0.314	46%	0.455	S	S	.	.	S	Bend	trans	-70.5	138.5	-179.1	0	0	0	0	0	110.8	N23 Q24 N29	N23-A27 WeakPolarHBondContact O-CB 3.49Å; N23-A27 PolarHBondContact O-N 2.71Å; Q24-A27 PolarHBondContact O-N 3.03Å; A27-N29 PolarHBondContact O-N 2.92Å
28	P	94.4	Very high	94.3	Very high	17 Å²	17	79.6 Å²	79.6	11%	0.11	45%	0.447	C	S	.	.	P	Polyproline II helix	trans	-60.6	137.6	174.1	-16.9	28.2	0	0	0	110.1	E32 Q33 M75	P28-E32 WeakPolarHBondContact CA-OE2 3.39Å; P28-E32 HydrophobicContact CB-CB 4.16Å; P28-Q33 HydrophobicContact CB-CG 4.02Å; P28-Q33 PolarHBondContact O-NE2 3.45Å; P28-M75 WeakPolarHBondContact CD-O 3.47Å; P28-M75 HydrophobicContact CG-CB 3.69Å; P28-M75 WeakPolarHBondContact CG-O 3.37Å
29	N	93.8	Very high	94.1	Very high	81 Å²	81	80.1 Å²	80.1	43%	0.433	44%	0.442	S	S	.	.	P	Polyproline II helix	trans	-72.4	166.8	177.4	70.8	56.4	0	0	0	111.4	A27 A31 E32 Q33	A27-N29 PolarHBondContact O-N 2.92Å; N29-A31 PolarHBondContact O-N 3.48Å; N29-A31 WeakPolarHBondContact OD1-CA 3.48Å; N29-A31 WeakPolarHBondContact OD1-CB 3.39Å; N29-A31 PolarHBondContact OD1-N 3.39Å; N29-E32 PolarHBondContact N-OE2 3.23Å; N29-E32 WeakPolarHBondContact ND2-CG 3.36Å; N29-E32 PolarHBondContact ND2-OE2 3.5Å; N29-E32 WeakPolarHBondContact O-CB 3.36Å; N29-E32 PolarHBondContact O-N 3.44Å; N29-E32 VanDerWaalsContact O-N 3.16Å; N29-E32 WeakPolarHBondContact OD1-CG 3.32Å; N29-E32 PolarHBondContact OD1-N 3.06Å; N29-Q33 WeakPolarHBondContact O-CG 3.5Å; N29-Q33 PolarHBondContact O-N 3.49Å
30	S	92.9	Very high	94	Very high	102 Å²	102	75.8 Å²	75.8	71%	0.713	42%	0.419	S	S	*	.	H	α-helix	trans	-60.8	-31.4	-176.1	-54.7	0	0	0	0	113.9	A34	S30-A34 VanDerWaalsContact O-CB 3.3Å; S30-A34 WeakPolarHBondContact O-CB 3.24Å; S30-A34 PolarHBondContact O-N 2.92Å
31	A	93.5	Very high	93.9	Very high	72 Å²	72	73.6 Å²	73.6	60%	0.595	41%	0.41	S	S	*	.	H	α-helix	trans	-71.3	-41	177.7	0	0	0	0	0	111.3	N29 A34 S35	N29-A31 PolarHBondContact O-N 3.48Å; N29-A31 WeakPolarHBondContact OD1-CA 3.48Å; N29-A31 WeakPolarHBondContact OD1-CB 3.39Å; N29-A31 PolarHBondContact OD1-N 3.39Å; A31-A34 PolarHBondContact O-N 2.87Å; A31-S35 PolarHBondContact O-N 3.38Å; A31-S35 PolarHBondContact O-OG 2.85Å
32	E	93	Very high	93.8	Very high	24 Å²	24	69.5 Å²	69.5	11%	0.112	39%	0.393	C	S	.	.	H	α-helix	trans	-62.2	-42.5	174.4	-67.5	-177.2	123.9	0	0	112.1	P28 N29 S35 I36 T77 G78 N80	P28-E32 WeakPolarHBondContact CA-OE2 3.39Å; P28-E32 HydrophobicContact CB-CB 4.16Å; N29-E32 PolarHBondContact N-OE2 3.23Å; N29-E32 WeakPolarHBondContact ND2-CG 3.36Å; N29-E32 PolarHBondContact ND2-OE2 3.5Å; N29-E32 WeakPolarHBondContact O-CB 3.36Å; N29-E32 PolarHBondContact O-N 3.44Å; N29-E32 VanDerWaalsContact O-N 3.16Å; N29-E32 WeakPolarHBondContact OD1-CG 3.32Å; N29-E32 PolarHBondContact OD1-N 3.06Å; E32-S35 PolarHBondContact O-OG 3.39Å; E32-I36 WeakPolarHBondContact O-CB 3.4Å; E32-I36 WeakPolarHBondContact O-CG1 3.34Å; E32-I36 PolarHBondContact O-N 2.8Å; E32-T77 PolarHBondContact OE2-OG1 3.32Å; E32-G78 PolarHBondContact OE1-N 3.39Å; E32-N80 WeakPolarHBondContact CB-OD1 3.31Å; E32-N80 VanDerWaalsContact CG-ND2 3.26Å; E32-N80 WeakPolarHBondContact CG-ND2 3.29Å; E32-N80 PolarHBondContact OE1-ND2 2.98Å; E32-N80 PolarHBondContact OE1-OD1 3.07Å
33	Q	91.9	Very high	93.7	Very high	107 Å²	107	64 Å²	64	50%	0.5	37%	0.374	S	S	.	.	H	α-helix	trans	-64.9	-44	176.7	-66.6	180	14.7	0	0	111.5	P28 N29 L37	P28-Q33 HydrophobicContact CB-CG 4.02Å; P28-Q33 PolarHBondContact O-NE2 3.45Å; N29-Q33 WeakPolarHBondContact O-CG 3.5Å; N29-Q33 PolarHBondContact O-N 3.49Å; Q33-L37 VanDerWaalsContact O-CB 3.26Å; Q33-L37 WeakPolarHBondContact O-CB 3.38Å; Q33-L37 PolarHBondContact O-N 3.29Å
34	A	93.8	Very high	93.8	Very high	58 Å²	58	59.6 Å²	59.6	48%	0.479	35%	0.351	S	S	.	.	H	α-helix	trans	-66.2	-41.1	-178.8	0	0	0	0	0	112.5	S30 A31 L37 S38	S30-A34 VanDerWaalsContact O-CB 3.3Å; S30-A34 WeakPolarHBondContact O-CB 3.24Å; S30-A34 PolarHBondContact O-N 2.92Å; A31-A34 PolarHBondContact O-N 2.87Å; A34-L37 PolarHBondContact O-N 3.21Å; A34-S38 WeakPolarHBondContact O-CB 3.43Å; A34-S38 PolarHBondContact O-N 2.96Å
35	S	92.8	Very high	93.8	Very high	65 Å²	65	56.6 Å²	56.6	46%	0.455	34%	0.339	S	S	.	.	H	α-helix	trans	-65.3	-45.4	179.4	61.6	0	0	0	0	111.8	A31 E32 S38 L39	A31-S35 PolarHBondContact O-N 3.38Å; A31-S35 PolarHBondContact O-OG 2.85Å; E32-S35 PolarHBondContact O-OG 3.39Å; S35-S38 PolarHBondContact O-N 2.96Å; S35-L39 PolarHBondContact O-N 3.26Å
36	I	94.1	Very high	93.8	Very high	11 Å²	11	52.6 Å²	52.6	6%	0.056	32%	0.318	C	S	.	.	H	α-helix	trans	-62	-47.6	175.8	-75.5	-95.2	0	0	0	111.5	E32 S38 L39 V40 Y70 M75 N80 A82	E32-I36 WeakPolarHBondContact O-CB 3.4Å; E32-I36 WeakPolarHBondContact O-CG1 3.34Å; E32-I36 PolarHBondContact O-N 2.8Å; I36-S38 VanDerWaalsContact C-N 3.29Å; I36-S38 PolarHBondContact O-N 3.5Å; I36-L39 PolarHBondContact O-N 2.96Å; I36-V40 HydrophobicContact CG2-CG2 4.3Å; I36-V40 WeakPolarHBondContact O-CB 3.38Å; I36-V40 VanDerWaalsContact O-CG2 3.26Å; I36-V40 WeakPolarHBondContact O-CG2 3.4Å; I36-V40 PolarHBondContact O-N 3.04Å; I36-Y70 HydrophobicContact CG2-CD2 3.36Å; I36-Y70 HydrophobicContact CG2-CE2 3.45Å; I36-Y70 VanDerWaalsContact CG2-CE2 3.45Å; I36-Y70 HydrophobicContact CG2-CG 4.27Å; I36-M75 HydrophobicContact CB-CE 4.41Å; I36-M75 HydrophobicContact CD1-CE 3.96Å; I36-M75 HydrophobicContact CG1-CE 3.91Å; I36-M75 HydrophobicContact CG2-CE 4.2Å; I36-M75 HydrophobicContact CG2-SD 4.22Å; I36-N80 HydrophobicContact CD1-CB 3.79Å; I36-N80 WeakPolarHBondContact CD1-O 3.4Å; I36-N80 HydrophobicContact CG1-CB 3.76Å; I36-A82 HydrophobicContact CD1-CB 4.49Å; I36-A82 HydrophobicContact CG2-CB 4.12Å
37	L	94.1	Very high	93.8	Very high	91 Å²	91	49.5 Å²	49.5	48%	0.476	30%	0.302	S	S	.	.	H	α-helix	trans	-57.7	-46.1	178.2	175.8	61.4	0	0	0	110.7	Q33 A34 V40 T41 Y70	Q33-L37 VanDerWaalsContact O-CB 3.26Å; Q33-L37 WeakPolarHBondContact O-CB 3.38Å; Q33-L37 PolarHBondContact O-N 3.29Å; A34-L37 PolarHBondContact O-N 3.21Å; L37-V40 PolarHBondContact O-N 3.38Å; L37-T41 WeakPolarHBondContact O-CB 3.37Å; L37-T41 PolarHBondContact O-N 3.33Å; L37-T41 PolarHBondContact O-OG1 3.06Å; L37-Y70 WeakPolarHBondContact CD1-OH 3.45Å
38	S	93.4	Very high	94	Very high	56 Å²	56	51.1 Å²	51.1	39%	0.392	31%	0.305	S	S	.	.	H	α-helix	trans	-58.2	-51.2	178.6	-170.2	0	0	0	0	111.7	A34 S35 I36 V40 T41 K42	A34-S38 WeakPolarHBondContact O-CB 3.43Å; A34-S38 PolarHBondContact O-N 2.96Å; S35-S38 PolarHBondContact O-N 2.96Å; I36-S38 VanDerWaalsContact C-N 3.29Å; I36-S38 PolarHBondContact O-N 3.5Å; S38-V40 PolarHBondContact O-N 3.49Å; S38-T41 PolarHBondContact O-N 3.41Å; S38-K42 WeakPolarHBondContact O-CG 3.3Å; S38-K42 PolarHBondContact O-N 3.34Å
39	L	93.4	Very high	93.9	Very high	68 Å²	68	55 Å²	55	36%	0.356	33%	0.325	S	S	.	.	H	α-helix	trans	-61.1	-46.6	180	179.7	61	0	0	0	111.9	S35 I36 T41 K42 I43 E115	S35-L39 PolarHBondContact O-N 3.26Å; I36-L39 PolarHBondContact O-N 2.96Å; L39-T41 VanDerWaalsContact C-N 3.31Å; L39-T41 PolarHBondContact O-N 2.97Å; L39-K42 PolarHBondContact O-N 3.33Å; L39-I43 HydrophobicContact CD1-CD1 3.86Å; L39-I43 HydrophobicContact CD1-CG1 4.28Å; L39-I43 HydrophobicContact CG-CD1 3.88Å; L39-I43 WeakPolarHBondContact O-CG1 3.5Å; L39-I43 PolarHBondContact O-N 2.97Å; L39-E115 WeakPolarHBondContact CD1-OE2 3.22Å
40	V	95.1	Very high	93.9	Very high	5 Å²	5	51.9 Å²	51.9	3%	0.03	31%	0.308	C	S	.	.	H	α-helix	trans	-62.3	-40.1	178.9	172.3	0	0	0	0	111.2	I36 L37 S38 N44 Q66 Y70 A82 L84	I36-V40 HydrophobicContact CG2-CG2 4.3Å; I36-V40 WeakPolarHBondContact O-CB 3.38Å; I36-V40 VanDerWaalsContact O-CG2 3.26Å; I36-V40 WeakPolarHBondContact O-CG2 3.4Å; I36-V40 PolarHBondContact O-N 3.04Å; L37-V40 PolarHBondContact O-N 3.38Å; S38-V40 PolarHBondContact O-N 3.49Å; V40-N44 WeakPolarHBondContact CG1-ND2 3.42Å; V40-N44 WeakPolarHBondContact O-CB 3.34Å; V40-N44 PolarHBondContact O-N 2.95Å; V40-N44 PolarHBondContact O-ND2 3.28Å; V40-Q66 HydrophobicContact CG1-CG 4.23Å; V40-Y70 HydrophobicContact CB-CE1 4.21Å; V40-Y70 HydrophobicContact CG1-CE1 3.68Å; V40-Y70 HydrophobicContact CG2-CD1 4.36Å; V40-Y70 HydrophobicContact CG2-CE1 4.02Å; V40-A82 HydrophobicContact CG2-CB 3.32Å; V40-L84 HydrophobicContact CG1-CD2 4.39Å
41	T	94.5	Very high	94	Very high	64 Å²	64	49.5 Å²	49.5	39%	0.393	29%	0.287	S	S	.	.	H	α-helix	trans	-64.5	-45.4	176	-65.6	0	0	0	0	111.5	L37 S38 L39 I43 N44 N45	L37-T41 WeakPolarHBondContact O-CB 3.37Å; L37-T41 PolarHBondContact O-N 3.33Å; L37-T41 PolarHBondContact O-OG1 3.06Å; S38-T41 PolarHBondContact O-N 3.41Å; L39-T41 VanDerWaalsContact C-N 3.31Å; L39-T41 PolarHBondContact O-N 2.97Å; T41-I43 PolarHBondContact O-N 3.33Å; T41-N44 PolarHBondContact O-N 3.23Å; T41-N45 WeakPolarHBondContact O-CB 3.49Å; T41-N45 PolarHBondContact O-N 3.09Å; T41-N45 PolarHBondContact O-ND2 3.44Å
42	K	94.1	Very high	94	Very high	44 Å²	44	52 Å²	52	19%	0.191	29%	0.294	C	S	.	.	H	α-helix	trans	-59.5	-47.7	177.2	-68.5	177	-169.5	178.2	0	111.5	S38 L39 N45 V46 L108 D112 E115	S38-K42 WeakPolarHBondContact O-CG 3.3Å; S38-K42 PolarHBondContact O-N 3.34Å; L39-K42 PolarHBondContact O-N 3.33Å; K42-N45 PolarHBondContact O-N 2.9Å; K42-V46 WeakPolarHBondContact O-CG2 3.26Å; K42-V46 PolarHBondContact O-N 3.45Å; K42-V46 VanDerWaalsContact O-N 3.09Å; K42-L108 HydrophobicContact CB-CD2 3.64Å; K42-D112 IonicContact NZ-OD2 3.19Å; K42-D112 PolarHBondContact NZ-OD2 3Å; K42-E115 IonicContact NZ-OE1 2.78Å; K42-E115 PolarHBondContact NZ-OE1 2.77Å
43	I	94.9	Very high	94	Very high	34 Å²	34	54.3 Å²	54.3	17%	0.174	32%	0.317	C	S	.	.	H	α-helix	trans	-62.7	-45.7	178.7	-67.9	167.2	0	0	0	111.3	L39 T41 N45 V46 I47 L84 V104 L108	L39-I43 HydrophobicContact CD1-CD1 3.86Å; L39-I43 HydrophobicContact CD1-CG1 4.28Å; L39-I43 HydrophobicContact CG-CD1 3.88Å; L39-I43 WeakPolarHBondContact O-CG1 3.5Å; L39-I43 PolarHBondContact O-N 2.97Å; T41-I43 PolarHBondContact O-N 3.33Å; I43-N45 VanDerWaalsContact C-N 3.33Å; I43-N45 PolarHBondContact O-N 3.42Å; I43-V46 PolarHBondContact O-N 3.3Å; I43-I47 HydrophobicContact CG2-CD1 3.69Å; I43-I47 HydrophobicContact CG2-CG1 4.38Å; I43-I47 WeakPolarHBondContact O-CG1 3.42Å; I43-I47 PolarHBondContact O-N 3.11Å; I43-L84 HydrophobicContact CB-CD1 4.15Å; I43-L84 HydrophobicContact CG2-CD1 3.47Å; I43-L84 VanDerWaalsContact CG2-CD1 3.47Å; I43-V104 HydrophobicContact CG2-CG1 4.38Å; I43-L108 HydrophobicContact CG1-CD1 3.88Å; I43-L108 HydrophobicContact CG1-CD2 4.41Å
44	N	94.9	Very high	93.8	Very high	15 Å²	15	51.9 Å²	51.9	8%	0.08	31%	0.311	C	S	.	.	H	α-helix	trans	-60.5	-44	177.9	-80.2	-60.2	0	0	0	111.3	V40 T41 V46 I47 D48 Q66	V40-N44 WeakPolarHBondContact CG1-ND2 3.42Å; V40-N44 WeakPolarHBondContact O-CB 3.34Å; V40-N44 PolarHBondContact O-N 2.95Å; V40-N44 PolarHBondContact O-ND2 3.28Å; T41-N44 PolarHBondContact O-N 3.23Å; N44-V46 VanDerWaalsContact C-N 3.3Å; N44-V46 PolarHBondContact O-N 3.04Å; N44-I47 PolarHBondContact O-N 3Å; N44-I47 VanDerWaalsContact O-N 3.11Å; N44-D48 WeakPolarHBondContact O-CB 3.26Å; N44-D48 VanDerWaalsContact O-CG 3.28Å; N44-D48 PolarHBondContact O-N 3.4Å; N44-Q66 PolarHBondContact ND2-NE2 3.06Å
45	N	94.4	Very high	93.6	Very high	79 Å²	79	52.7 Å²	52.7	42%	0.422	33%	0.325	S	S	.	.	H	α-helix	trans	-59.6	-40.9	177.6	-69.4	-19.2	0	0	0	112.3	T41 K42 I43 N49	T41-N45 WeakPolarHBondContact O-CB 3.49Å; T41-N45 PolarHBondContact O-N 3.09Å; T41-N45 PolarHBondContact O-ND2 3.44Å; K42-N45 PolarHBondContact O-N 2.9Å; I43-N45 VanDerWaalsContact C-N 3.33Å; I43-N45 PolarHBondContact O-N 3.42Å; N45-N49 WeakPolarHBondContact O-CB 3.23Å; N45-N49 PolarHBondContact O-N 3.06Å; N45-N49 PolarHBondContact O-ND2 3.24Å
46	V	94.3	Very high	93.3	Very high	3 Å²	3	56.7 Å²	56.7	2%	0.018	35%	0.347	C	S	.	.	H	α-helix	trans	-62.1	-46.9	175	171.4	0	0	0	0	110.7	K42 I43 N44 N49 L50 V104 L108	K42-V46 WeakPolarHBondContact O-CG2 3.26Å; K42-V46 PolarHBondContact O-N 3.45Å; K42-V46 VanDerWaalsContact O-N 3.09Å; I43-V46 PolarHBondContact O-N 3.3Å; N44-V46 VanDerWaalsContact C-N 3.3Å; N44-V46 PolarHBondContact O-N 3.04Å; V46-N49 PolarHBondContact O-N 3.04Å; V46-L50 HydrophobicContact CG1-CD1 4.26Å; V46-L50 WeakPolarHBondContact O-CG 3.44Å; V46-L50 PolarHBondContact O-N 3.22Å; V46-V104 HydrophobicContact CG1-CB 4.45Å; V46-V104 HydrophobicContact CG1-CG1 4.47Å; V46-V104 HydrophobicContact CG1-CG2 4.18Å; V46-L108 HydrophobicContact CG2-CD2 4.11Å; V46-L108 HydrophobicContact CG2-CG 4.32Å
47	I	95.2	Very high	93.1	Very high	6 Å²	6	57.4 Å²	57.4	3%	0.031	35%	0.35	C	S	.	.	H	α-helix	trans	-66.9	-43.6	-178.8	-65.2	169.5	0	0	0	111.4	I43 N44 N49 L50 I51 I61 V64 V86 V104	I43-I47 HydrophobicContact CG2-CD1 3.69Å; I43-I47 HydrophobicContact CG2-CG1 4.38Å; I43-I47 WeakPolarHBondContact O-CG1 3.42Å; I43-I47 PolarHBondContact O-N 3.11Å; N44-I47 PolarHBondContact O-N 3Å; N44-I47 VanDerWaalsContact O-N 3.11Å; I47-N49 VanDerWaalsContact C-N 3.3Å; I47-N49 PolarHBondContact O-N 3.11Å; I47-L50 CarbonylContact O-C 3.35Å; I47-L50 WeakPolarHBondContact O-CA 3.48Å; I47-L50 WeakPolarHBondContact O-CB 3.41Å; I47-L50 PolarHBondContact O-N 3.22Å; I47-I51 HydrophobicContact CG2-CD1 4.03Å; I47-I51 HydrophobicContact CG2-CG1 4.45Å; I47-I51 WeakPolarHBondContact O-CG1 3.37Å; I47-I51 PolarHBondContact O-N 3.01Å; I47-I61 HydrophobicContact CG2-CD1 4.14Å; I47-I61 HydrophobicContact CG2-CG2 4.26Å; I47-V64 HydrophobicContact CD1-CG2 4.08Å; I47-V64 HydrophobicContact CG2-CB 3.87Å; I47-V64 HydrophobicContact CG2-CG1 3.98Å; I47-V64 HydrophobicContact CG2-CG2 4.41Å; I47-V86 HydrophobicContact CD1-CG2 3.98Å; I47-V104 HydrophobicContact CG1-CG2 4.24Å
48	D	94.6	Very high	92.8	Very high	71 Å²	71	61.5 Å²	61.5	38%	0.38	37%	0.366	S	S	.	.	H	α-helix	trans	-60.7	-40.5	177.3	-72.2	-24.8	0	0	0	111.3	N44 L50 I51 V52	N44-D48 WeakPolarHBondContact O-CB 3.26Å; N44-D48 VanDerWaalsContact O-CG 3.28Å; N44-D48 PolarHBondContact O-N 3.4Å; D48-L50 VanDerWaalsContact C-N 3.34Å; D48-L50 PolarHBondContact O-N 3.16Å; D48-I51 WeakPolarHBondContact O-CB 3.36Å; D48-I51 PolarHBondContact O-N 3.23Å; D48-V52 WeakPolarHBondContact O-CG2 3.39Å; D48-V52 PolarHBondContact O-N 2.98Å
49	N	94.1	Very high	92.8	Very high	99 Å²	99	59.3 Å²	59.3	53%	0.529	35%	0.35	S	S	.	.	H	α-helix	trans	-63.7	-39.1	173.3	-74.4	-29.8	0	0	0	112.1	N45 V46 I47 I51 V52 A53	N45-N49 WeakPolarHBondContact O-CB 3.23Å; N45-N49 PolarHBondContact O-N 3.06Å; N45-N49 PolarHBondContact O-ND2 3.24Å; V46-N49 PolarHBondContact O-N 3.04Å; I47-N49 VanDerWaalsContact C-N 3.3Å; I47-N49 PolarHBondContact O-N 3.11Å; N49-I51 VanDerWaalsContact C-N 3.32Å; N49-V52 PolarHBondContact O-N 3.38Å; N49-A53 CarbonylContact O-C 3.46Å; N49-A53 WeakPolarHBondContact O-CA 3.42Å; N49-A53 PolarHBondContact O-N 3.03Å
50	L	93.8	Very high	92.6	Very high	16 Å²	16	61.5 Å²	61.5	8%	0.084	36%	0.359	C	S	.	.	H	α-helix	trans	-67.9	-30.6	175	-68.3	172.8	0	0	0	112.5	V46 I47 D48 P54 F57 I61 L100 K103	V46-L50 HydrophobicContact CG1-CD1 4.26Å; V46-L50 WeakPolarHBondContact O-CG 3.44Å; V46-L50 PolarHBondContact O-N 3.22Å; I47-L50 CarbonylContact O-C 3.35Å; I47-L50 WeakPolarHBondContact O-CA 3.48Å; I47-L50 WeakPolarHBondContact O-CB 3.41Å; I47-L50 PolarHBondContact O-N 3.22Å; D48-L50 VanDerWaalsContact C-N 3.34Å; D48-L50 PolarHBondContact O-N 3.16Å; L50-P54 WeakPolarHBondContact O-CA 3.36Å; L50-P54 WeakPolarHBondContact O-CB 3.46Å; L50-F57 HydrophobicContact CD1-CD1 4.39Å; L50-F57 HydrophobicContact CD1-CE1 4.22Å; L50-F57 HydrophobicContact CD2-CB 4.35Å; L50-F57 HydrophobicContact CD2-CD1 3.94Å; L50-F57 HydrophobicContact CD2-CG 4.26Å; L50-I61 HydrophobicContact CB-CD1 3.96Å; L50-I61 HydrophobicContact CD1-CD1 4.44Å; L50-L100 HydrophobicContact CD1-CD1 4.13Å; L50-K103 HydrophobicContact CD1-CG 4.08Å; L50-K103 HydrophobicContact CD2-CG 4.06Å
51	I	94.1	Very high	92.6	Very high	52 Å²	52	61.6 Å²	61.6	27%	0.267	36%	0.359	S	S	.	.	H	α-helix	trans	-67.7	-46.2	174.3	-68.7	164.5	0	0	0	110.6	I47 D48 N49 I61	I47-I51 HydrophobicContact CG2-CD1 4.03Å; I47-I51 HydrophobicContact CG2-CG1 4.45Å; I47-I51 WeakPolarHBondContact O-CG1 3.37Å; I47-I51 PolarHBondContact O-N 3.01Å; D48-I51 WeakPolarHBondContact O-CB 3.36Å; D48-I51 PolarHBondContact O-N 3.23Å; N49-I51 VanDerWaalsContact C-N 3.32Å; I51-I61 HydrophobicContact CD1-CB 4.45Å; I51-I61 HydrophobicContact CD1-CG2 3.78Å; I51-I61 HydrophobicContact CG1-CB 3.62Å; I51-I61 HydrophobicContact CG1-CG2 3.51Å
52	V	93.8	Very high	92.7	Very high	124 Å²	124	63.7 Å²	63.7	75%	0.752	36%	0.364	S	S	*	.	H	α-helix	trans	-82.6	-39.8	-173.9	178.9	0	0	0	0	112.4	D48 N49	D48-V52 WeakPolarHBondContact O-CG2 3.39Å; D48-V52 PolarHBondContact O-N 2.98Å; N49-V52 PolarHBondContact O-N 3.38Å
53	A	92.8	Very high	92.7	Very high	72 Å²	72	64.4 Å²	64.4	60%	0.595	37%	0.368	S	S	*	.			trans	-138.7	72.3	-173.5	0	0	0	0	0	111.3	N49 G55	N49-A53 CarbonylContact O-C 3.46Å; N49-A53 WeakPolarHBondContact O-CA 3.42Å; N49-A53 PolarHBondContact O-N 3.03Å; A53-G55 PolarHBondContact O-N 2.97Å
54	P	88.1	Confident	92.7	Very high	57 Å²	57	64 Å²	64	37%	0.37	37%	0.367	S	S	.	.			trans	-66.4	-21.7	-176.1	23.6	-32.9	0	0	0	114.1	L50 T56 F57	L50-P54 WeakPolarHBondContact O-CA 3.36Å; L50-P54 WeakPolarHBondContact O-CB 3.46Å; P54-T56 PolarHBondContact O-N 3.49Å; P54-F57 WeakPolarHBondContact O-CB 3.47Å; P54-F57 PolarHBondContact O-N 3.4Å
55	G	88.9	Confident	92.7	Very high	75 Å²	75	69.6 Å²	69.6	77%	0.773	39%	0.387	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.7	-119.9	-176.9	0	0	0	0	0	111.6	A53	A53-G55 PolarHBondContact O-N 2.97Å
56	T	87.4	Confident	92.8	Very high	148 Å²	148	69 Å²	69	91%	0.908	38%	0.382	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.4	1.4	176.1	56.4	0	0	0	0	113.6	P54 E58	P54-T56 PolarHBondContact O-N 3.49Å; T56-E58 PolarHBondContact O-N 2.92Å
57	F	90.2	Very high	92.8	Very high	27 Å²	27	71.4 Å²	71.4	12%	0.118	40%	0.397	C	S	.	.			trans	-78	115.6	179.8	-172.3	-117.5	0	0	0	110.3	L50 P54 V59 A99 L100 K103	L50-F57 HydrophobicContact CD1-CD1 4.39Å; L50-F57 HydrophobicContact CD1-CE1 4.22Å; L50-F57 HydrophobicContact CD2-CB 4.35Å; L50-F57 HydrophobicContact CD2-CD1 3.94Å; L50-F57 HydrophobicContact CD2-CG 4.26Å; P54-F57 WeakPolarHBondContact O-CB 3.47Å; P54-F57 PolarHBondContact O-N 3.4Å; F57-V59 HydrophobicContact CD1-CB 4.25Å; F57-V59 HydrophobicContact CE1-CB 3.53Å; F57-V59 HydrophobicContact CE1-CG1 4.39Å; F57-V59 HydrophobicContact CE1-CG2 4.19Å; F57-V59 HydrophobicContact CE2-CB 4.36Å; F57-V59 HydrophobicContact CE2-CG2 4.13Å; F57-V59 HydrophobicContact CZ-CB 3.56Å; F57-V59 HydrophobicContact CZ-CG1 4.46Å; F57-V59 HydrophobicContact CZ-CG2 3.7Å; F57-V59 PolarHBondContact O-N 3.35Å; F57-A99 HydrophobicContact CE2-CB 4.25Å; F57-L100 HydrophobicContact CE1-CD1 3.94Å; F57-L100 HydrophobicContact CZ-CB 4.03Å; F57-L100 HydrophobicContact CZ-CD1 3.9Å; F57-K103 HydrophobicContact CD2-CB 4.11Å; F57-K103 HydrophobicContact CD2-CD 4.2Å; F57-K103 HydrophobicContact CD2-CG 3.92Å; F57-K103 HydrophobicContact CE2-CB 3.72Å; F57-K103 HydrophobicContact CE2-CG 4.03Å; F57-K103 HydrophobicContact CG-CG 4.33Å; F57-K103 HydrophobicContact CZ-CB 4.18Å
58	E	87.4	Confident	92.8	Very high	177 Å²	177	72.4 Å²	72.4	83%	0.827	41%	0.409	S	S	*	.			trans	-79.4	-17.2	-170.6	-62.2	-173.4	162.5	0	0	114.2	T56 Q60	T56-E58 PolarHBondContact O-N 2.92Å; E58-Q60 PolarHBondContact O-N 3.48Å
59	V	91.9	Very high	92.7	Very high	10 Å²	10	70.9 Å²	70.9	6%	0.061	40%	0.403	C	S	.	.			trans	-77.7	115.6	-177.5	-177.7	0	0	0	0	109.9	F57 I61 L88 A96 A99	F57-V59 HydrophobicContact CD1-CB 4.25Å; F57-V59 HydrophobicContact CE1-CB 3.53Å; F57-V59 HydrophobicContact CE1-CG1 4.39Å; F57-V59 HydrophobicContact CE1-CG2 4.19Å; F57-V59 HydrophobicContact CE2-CB 4.36Å; F57-V59 HydrophobicContact CE2-CG2 4.13Å; F57-V59 HydrophobicContact CZ-CB 3.56Å; F57-V59 HydrophobicContact CZ-CG1 4.46Å; F57-V59 HydrophobicContact CZ-CG2 3.7Å; F57-V59 PolarHBondContact O-N 3.35Å; V59-I61 PolarHBondContact O-N 3.43Å; V59-L88 HydrophobicContact CG1-CD1 4.01Å; V59-L88 HydrophobicContact CG1-CD2 3.68Å; V59-L88 HydrophobicContact CG1-CG 4.46Å; V59-A96 HydrophobicContact CG1-CB 4.28Å; V59-A96 HydrophobicContact CG2-CB 3.92Å; V59-A99 HydrophobicContact CG2-CB 4.36Å
60	Q	90.8	Very high	92.7	Very high	114 Å²	114	68.2 Å²	68.2	53%	0.533	39%	0.386	S	S	.	.			trans	-85.9	111.2	179.8	-63.4	-174.8	2.1	0	0	111.2	E58 L88 K89	E58-Q60 PolarHBondContact O-N 3.48Å; Q60-L88 WeakPolarHBondContact O-CA 3.4Å; Q60-K89 HydrophobicContact CB-CB 4.03Å; Q60-K89 HydrophobicContact CB-CD 4.31Å; Q60-K89 HydrophobicContact CB-CG 4.4Å; Q60-K89 PolarHBondContact O-N 3.24Å
61	I	95.4	Very high	92.8	Very high	6 Å²	6	73.7 Å²	73.7	3%	0.031	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.1	134.9	177.3	-51.9	171.6	0	0	0	108.8	I47 L50 I51 V59 V86 L88 L100	I47-I61 HydrophobicContact CG2-CD1 4.14Å; I47-I61 HydrophobicContact CG2-CG2 4.26Å; L50-I61 HydrophobicContact CB-CD1 3.96Å; L50-I61 HydrophobicContact CD1-CD1 4.44Å; I51-I61 HydrophobicContact CD1-CB 4.45Å; I51-I61 HydrophobicContact CD1-CG2 3.78Å; I51-I61 HydrophobicContact CG1-CB 3.62Å; I51-I61 HydrophobicContact CG1-CG2 3.51Å; V59-I61 PolarHBondContact O-N 3.43Å; I61-V86 HydrophobicContact CG1-CG1 4.42Å; I61-V86 HydrophobicContact CG2-CG1 3.61Å; I61-L88 HydrophobicContact CB-CD2 4.44Å; I61-L88 HydrophobicContact CG1-CD2 3.92Å; I61-L100 HydrophobicContact CD1-CD1 3.67Å
62	E	94.8	Very high	92.7	Very high	108 Å²	108	79 Å²	79	51%	0.505	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	-54.3	175.2	-172.7	170.1	179.9	0	0	111	I87 K89	E62-I87 HydrophobicContact CB-CG2 4.11Å; E62-I87 WeakPolarHBondContact CB-O 3.16Å; E62-I87 PolarHBondContact N-O 3.24Å; E62-K89 HydrophobicContact CB-CG 3.74Å; E62-K89 HydrophobicContact CG-CG 4.32Å
63	E	94.1	Very high	92.6	Very high	59 Å²	59	76.4 Å²	76.4	28%	0.276	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.3	165.3	-179.5	62.7	174	150.4	0	0	111.3	R65 I87	E63-R65 IonicContact OE1-CZ 2.64Å; E63-R65 IonicContact OE1-NE 2.77Å; E63-R65 PolarHBondContact OE1-NE 2.82Å; E63-R65 IonicContact OE1-NH2 3.2Å; E63-R65 PolarHBondContact OE1-NH2 3.04Å; E63-R65 IonicContact OE2-CZ 3.24Å; E63-R65 IonicContact OE2-NE 2.75Å; E63-R65 PolarHBondContact OE2-NE 3.04Å; E63-R65 IonicContact OE2-NH2 3.46Å; E63-R65 PolarHBondContact OE2-NH2 2.92Å; E63-I87 HydrophobicContact CG-CB 3.84Å; E63-I87 HydrophobicContact CG-CD1 3.7Å; E63-I87 HydrophobicContact CG-CG1 4.14Å; E63-I87 HydrophobicContact CG-CG2 4.48Å; E63-I87 PolarHBondContact N-O 2.64Å; E63-I87 PolarHBondContact O-N 2.96Å; E63-I87 VanDerWaalsContact OE1-CD1 3.29Å; E63-I87 WeakPolarHBondContact OE1-CD1 3.34Å
64	V	95.3	Very high	92.6	Very high	25 Å²	25	77.1 Å²	77.1	15%	0.152	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	138.6	170.4	62.1	0	0	0	0	110.1	I47 L84 V85 V86	I47-V64 HydrophobicContact CD1-CG2 4.08Å; I47-V64 HydrophobicContact CG2-CB 3.87Å; I47-V64 HydrophobicContact CG2-CG1 3.98Å; I47-V64 HydrophobicContact CG2-CG2 4.41Å; V64-L84 HydrophobicContact CG2-CB 4.37Å; V64-L84 HydrophobicContact CG2-CD2 4.31Å; V64-V85 CarbonylContact C-O 3.58Å; V64-V85 WeakPolarHBondContact CA-O 3.23Å; V64-V86 HydrophobicContact CG2-CG2 4.18Å
65	R	96.1	Very high	92.9	Very high	134 Å²	134	75.6 Å²	75.6	51%	0.506	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	125.4	179.9	-62.8	-176	-179.1	179.6	4.5	110.9	E63 V67 V85	E63-R65 IonicContact OE1-CZ 2.64Å; E63-R65 IonicContact OE1-NE 2.77Å; E63-R65 PolarHBondContact OE1-NE 2.82Å; E63-R65 IonicContact OE1-NH2 3.2Å; E63-R65 PolarHBondContact OE1-NH2 3.04Å; E63-R65 IonicContact OE2-CZ 3.24Å; E63-R65 IonicContact OE2-NE 2.75Å; E63-R65 PolarHBondContact OE2-NE 3.04Å; E63-R65 IonicContact OE2-NH2 3.46Å; E63-R65 PolarHBondContact OE2-NH2 2.92Å; R65-V67 HydrophobicContact CB-CG1 4.44Å; R65-V85 PolarHBondContact N-O 2.84Å; R65-V85 PolarHBondContact O-N 2.83Å
66	Q	94.8	Very high	93.1	Very high	66 Å²	66	74.9 Å²	74.9	31%	0.308	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.1	128.9	167.1	-66.2	168.6	16	0	0	109.7	V40 N44 Y70 K71 L84	V40-Q66 HydrophobicContact CG1-CG 4.23Å; N44-Q66 PolarHBondContact ND2-NE2 3.06Å; Q66-Y70 HydrophobicContact CG-CE1 4.38Å; Q66-K71 HydrophobicContact CB-CB 4.36Å; Q66-K71 HydrophobicContact CB-CD 4.14Å; Q66-K71 WeakPolarHBondContact O-CG 3.26Å; Q66-L84 HydrophobicContact CB-CD2 4.24Å; Q66-L84 HydrophobicContact CG-CD2 3.47Å; Q66-L84 VanDerWaalsContact CG-CD2 3.47Å
67	V	95.6	Very high	93.3	Very high	54 Å²	54	70.4 Å²	70.4	33%	0.327	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.8	-167.1	-180	-57.8	0	0	0	0	110.7	R65 K71 D83 V85	R65-V67 HydrophobicContact CB-CG1 4.44Å; V67-K71 WeakPolarHBondContact O-CB 3.47Å; V67-K71 PolarHBondContact O-N 3.31Å; V67-D83 HydrophobicContact CG2-CB 3.74Å; V67-D83 PolarHBondContact N-O 2.92Å; V67-V85 HydrophobicContact CB-CG2 4.5Å; V67-V85 HydrophobicContact CG1-CG2 3.98Å; V67-V85 HydrophobicContact CG2-CG2 3.69Å
68	G	94.9	Very high	93.4	Very high	27 Å²	27	71.9 Å²	71.9	28%	0.278	39%	0.39	S	S	.	.	H	α-helix	trans	72.2	-162.2	172.9	0	0	0	0	0	114.3	Y70 K71 K72	G68-Y70 VanDerWaalsContact C-N 3.33Å; G68-K71 PolarHBondContact O-N 2.96Å; G68-K72 WeakPolarHBondContact O-CG 3.46Å; G68-K72 PolarHBondContact O-N 2.78Å
69	S	93.3	Very high	93.5	Very high	38 Å²	38	69.4 Å²	69.4	27%	0.266	38%	0.379	S	S	.	.	H	α-helix	trans	-64.2	-38	-177.7	52.7	0	0	0	0	112.1	K72 G73 T74	S69-K72 CarbonylContact O-C 3.58Å; S69-K72 PolarHBondContact O-N 3.4Å; S69-G73 PolarHBondContact O-N 2.87Å; S69-T74 PolarHBondContact O-N 2.9Å
70	Y	93.9	Very high	93.3	Very high	43 Å²	43	71.8 Å²	71.8	17%	0.169	39%	0.391	C	S	.	.	H	α-helix	trans	-57.1	-52.9	176.1	171.7	-106.6	0	0	0	111.5	I36 L37 V40 Q66 G68 K72 G73 M75 A82	I36-Y70 HydrophobicContact CG2-CD2 3.36Å; I36-Y70 HydrophobicContact CG2-CE2 3.45Å; I36-Y70 VanDerWaalsContact CG2-CE2 3.45Å; I36-Y70 HydrophobicContact CG2-CG 4.27Å; L37-Y70 WeakPolarHBondContact CD1-OH 3.45Å; V40-Y70 HydrophobicContact CB-CE1 4.21Å; V40-Y70 HydrophobicContact CG1-CE1 3.68Å; V40-Y70 HydrophobicContact CG2-CD1 4.36Å; V40-Y70 HydrophobicContact CG2-CE1 4.02Å; Q66-Y70 HydrophobicContact CG-CE1 4.38Å; G68-Y70 VanDerWaalsContact C-N 3.33Å; Y70-K72 PolarHBondContact O-N 3.16Å; Y70-G73 PolarHBondContact O-N 3.07Å; Y70-M75 HydrophobicContact CD2-SD 3.69Å; Y70-M75 HydrophobicContact CG-SD 4.24Å; Y70-A82 HydrophobicContact CD1-CB 3.9Å; Y70-A82 HydrophobicContact CD2-CB 4.21Å; Y70-A82 HydrophobicContact CG-CB 3.64Å
71	K	94.2	Very high	93.4	Very high	132 Å²	132	70.5 Å²	70.5	57%	0.574	39%	0.39	S	S	*	.	H	α-helix	trans	-63	-32.1	179.4	-178.2	57.9	177.8	176	0	112.9	Q66 V67 G68	Q66-K71 HydrophobicContact CB-CB 4.36Å; Q66-K71 HydrophobicContact CB-CD 4.14Å; Q66-K71 WeakPolarHBondContact O-CG 3.26Å; V67-K71 WeakPolarHBondContact O-CB 3.47Å; V67-K71 PolarHBondContact O-N 3.31Å; G68-K71 PolarHBondContact O-N 2.96Å
72	K	93.5	Very high	93.3	Very high	162 Å²	162	71.5 Å²	71.5	70%	0.704	40%	0.4	S	S	*	.	H	α-helix	trans	-85.2	-8.7	-177.7	-69.1	-179.3	179.5	-178.9	0	113.9	G68 S69 Y70 T74	G68-K72 WeakPolarHBondContact O-CG 3.46Å; G68-K72 PolarHBondContact O-N 2.78Å; S69-K72 CarbonylContact O-C 3.58Å; S69-K72 PolarHBondContact O-N 3.4Å; Y70-K72 PolarHBondContact O-N 3.16Å; K72-T74 HydrophobicContact CB-CG2 4.04Å; K72-T74 PolarHBondContact O-N 2.97Å
73	G	90.7	Very high	93.3	Very high	70 Å²	70	69.9 Å²	69.9	72%	0.722	39%	0.394	S	S	*	.	T	Hydrogen-bonded Turn	trans	66.4	24.3	-173	0	0	0	0	0	113.2	S69 Y70	S69-G73 PolarHBondContact O-N 2.87Å; Y70-G73 PolarHBondContact O-N 3.07Å
74	T	92.6	Very high	93.4	Very high	88 Å²	88	69.4 Å²	69.4	54%	0.54	39%	0.394	S	S	.	.			trans	-111.5	25.2	-178.9	66.4	0	0	0	0	111.8	S69 K72	S69-T74 PolarHBondContact O-N 2.9Å; K72-T74 HydrophobicContact CB-CG2 4.04Å; K72-T74 PolarHBondContact O-N 2.97Å
75	M	94.2	Very high	93.4	Very high	24 Å²	24	71.4 Å²	71.4	12%	0.118	41%	0.406	C	S	.	.			trans	-65.5	151.2	169.2	-71.2	173	56.6	0	0	109.7	P28 I36 Y70	P28-M75 WeakPolarHBondContact CD-O 3.47Å; P28-M75 HydrophobicContact CG-CB 3.69Å; P28-M75 WeakPolarHBondContact CG-O 3.37Å; I36-M75 HydrophobicContact CB-CE 4.41Å; I36-M75 HydrophobicContact CD1-CE 3.96Å; I36-M75 HydrophobicContact CG1-CE 3.91Å; I36-M75 HydrophobicContact CG2-CE 4.2Å; I36-M75 HydrophobicContact CG2-SD 4.22Å; Y70-M75 HydrophobicContact CD2-SD 3.69Å; Y70-M75 HydrophobicContact CG-SD 4.24Å
76	T	93.8	Very high	93.4	Very high	61 Å²	61	67.2 Å²	67.2	37%	0.374	40%	0.395	S	S	.	.			trans	-116	150.8	175.4	54	0	0	0	0	109.8	L26 H79	L26-T76 CarbonylContact O-C 3.59Å; L26-T76 VanDerWaalsContact O-CA 3.23Å; L26-T76 WeakPolarHBondContact O-CA 3.33Å; T76-H79 PolarHBondContact O-N 2.92Å
77	T	92.7	Very high	93.4	Very high	53 Å²	53	66.3 Å²	66.3	33%	0.325	39%	0.392	S	S	.	.	T	Hydrogen-bonded Turn	trans	-53.8	145.4	176.3	-167.6	0	0	0	0	112	D25 L26 E32 H79	D25-T77 VanDerWaalsContact O-CG2 3.31Å; D25-T77 WeakPolarHBondContact O-CG2 3.45Å; L26-T77 PolarHBondContact O-N 2.95Å; E32-T77 PolarHBondContact OE2-OG1 3.32Å; T77-H79 PolarHBondContact O-N 2.85Å; T77-H79 VanDerWaalsContact O-N 3.16Å; T77-H79 PolarHBondContact O-ND1 3.23Å
78	G	91.1	Very high	93.4	Very high	58 Å²	58	64.7 Å²	64.7	60%	0.598	38%	0.381	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.2	-4.3	-174.5	0	0	0	0	0	115.1	E32	E32-G78 PolarHBondContact OE1-N 3.39Å
79	H	90.9	Very high	93.4	Very high	126 Å²	126	69.7 Å²	69.7	58%	0.583	40%	0.395	S	S	*	.			trans	-120	67.1	178.4	-63.7	76.7	0	0	0	110.2	T76 T77 V81	T76-H79 PolarHBondContact O-N 2.92Å; T77-H79 PolarHBondContact O-N 2.85Å; T77-H79 VanDerWaalsContact O-N 3.16Å; T77-H79 PolarHBondContact O-ND1 3.23Å; H79-V81 VanDerWaalsContact C-N 3.32Å; H79-V81 PolarHBondContact O-N 3.02Å
80	N	87.3	Confident	93.2	Very high	60 Å²	60	71.6 Å²	71.6	32%	0.321	40%	0.402	S	S	.	.			trans	-86.1	78.5	-178.1	-56.6	-29.7	0	0	0	108.6	E32 I36	E32-N80 WeakPolarHBondContact CB-OD1 3.31Å; E32-N80 VanDerWaalsContact CG-ND2 3.26Å; E32-N80 WeakPolarHBondContact CG-ND2 3.29Å; E32-N80 PolarHBondContact OE1-ND2 2.98Å; E32-N80 PolarHBondContact OE1-OD1 3.07Å; I36-N80 HydrophobicContact CD1-CB 3.79Å; I36-N80 WeakPolarHBondContact CD1-O 3.4Å; I36-N80 HydrophobicContact CG1-CB 3.76Å
81	V	91.4	Very high	93.2	Very high	86 Å²	86	76.5 Å²	76.5	52%	0.521	43%	0.43	S	S	.	.			trans	-130.8	137.9	175.7	-177.9	0	0	0	0	109.1	H79	H79-V81 VanDerWaalsContact C-N 3.32Å; H79-V81 PolarHBondContact O-N 3.02Å
82	A	94.4	Very high	93.2	Very high	28 Å²	28	74.2 Å²	74.2	23%	0.231	43%	0.429	C	S	.	.			trans	-124.7	137.2	172.9	0	0	0	0	0	110	I36 V40 Y70	I36-A82 HydrophobicContact CD1-CB 4.49Å; I36-A82 HydrophobicContact CG2-CB 4.12Å; V40-A82 HydrophobicContact CG2-CB 3.32Å; Y70-A82 HydrophobicContact CD1-CB 3.9Å; Y70-A82 HydrophobicContact CD2-CB 4.21Å; Y70-A82 HydrophobicContact CG-CB 3.64Å
83	D	94.7	Very high	93.2	Very high	73 Å²	73	69.3 Å²	69.3	39%	0.39	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	130.2	-176.4	-57.5	-64.5	0	0	0	110.7	V67	V67-D83 HydrophobicContact CG2-CB 3.74Å; V67-D83 PolarHBondContact N-O 2.92Å
84	L	95.1	Very high	93.4	Very high	49 Å²	49	72.6 Å²	72.6	26%	0.257	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	131.6	175.6	-64.2	169	0	0	0	109.1	V40 I43 V64 Q66	V40-L84 HydrophobicContact CG1-CD2 4.39Å; I43-L84 HydrophobicContact CB-CD1 4.15Å; I43-L84 HydrophobicContact CG2-CD1 3.47Å; I43-L84 VanDerWaalsContact CG2-CD1 3.47Å; V64-L84 HydrophobicContact CG2-CB 4.37Å; V64-L84 HydrophobicContact CG2-CD2 4.31Å; Q66-L84 HydrophobicContact CB-CD2 4.24Å; Q66-L84 HydrophobicContact CG-CD2 3.47Å; Q66-L84 VanDerWaalsContact CG-CD2 3.47Å
85	V	95.9	Very high	93.5	Very high	67 Å²	67	74.5 Å²	74.5	41%	0.406	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	119.8	170.4	177.2	0	0	0	0	107.8	V64 R65 V67 I87	V64-V85 CarbonylContact C-O 3.58Å; V64-V85 WeakPolarHBondContact CA-O 3.23Å; R65-V85 PolarHBondContact N-O 2.84Å; R65-V85 PolarHBondContact O-N 2.83Å; V67-V85 HydrophobicContact CB-CG2 4.5Å; V67-V85 HydrophobicContact CG1-CG2 3.98Å; V67-V85 HydrophobicContact CG2-CG2 3.69Å; V85-I87 HydrophobicContact CG1-CG1 4.2Å
86	V	95.5	Very high	93.4	Very high	46 Å²	46	73.8 Å²	73.8	28%	0.279	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	123.4	173.9	-174	0	0	0	0	108.6	I47 I61 V64 L88 L100	I47-V86 HydrophobicContact CD1-CG2 3.98Å; I61-V86 HydrophobicContact CG1-CG1 4.42Å; I61-V86 HydrophobicContact CG2-CG1 3.61Å; V64-V86 HydrophobicContact CG2-CG2 4.18Å; V86-L88 HydrophobicContact CG1-CD2 4.12Å; V86-L100 HydrophobicContact CB-CD2 4.34Å; V86-L100 HydrophobicContact CG1-CD2 3.9Å; V86-L100 HydrophobicContact CG2-CD2 4.46Å
87	I	95.5	Very high	93.4	Very high	48 Å²	48	74.8 Å²	74.8	25%	0.246	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	123.6	179.4	-61.8	174.2	0	0	0	107.4	E62 E63 V85	E62-I87 HydrophobicContact CB-CG2 4.11Å; E62-I87 WeakPolarHBondContact CB-O 3.16Å; E62-I87 PolarHBondContact N-O 3.24Å; E63-I87 HydrophobicContact CG-CB 3.84Å; E63-I87 HydrophobicContact CG-CD1 3.7Å; E63-I87 HydrophobicContact CG-CG1 4.14Å; E63-I87 HydrophobicContact CG-CG2 4.48Å; E63-I87 PolarHBondContact N-O 2.64Å; E63-I87 PolarHBondContact O-N 2.96Å; E63-I87 VanDerWaalsContact OE1-CD1 3.29Å; E63-I87 WeakPolarHBondContact OE1-CD1 3.34Å; V85-I87 HydrophobicContact CG1-CG1 4.2Å
88	L	95.5	Very high	93.5	Very high	20 Å²	20	74.7 Å²	74.7	11%	0.105	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.2	145.1	178.9	-58	-176	0	0	0	110	V59 Q60 I61 V86 I90 P92 A96	V59-L88 HydrophobicContact CG1-CD1 4.01Å; V59-L88 HydrophobicContact CG1-CD2 3.68Å; V59-L88 HydrophobicContact CG1-CG 4.46Å; Q60-L88 WeakPolarHBondContact O-CA 3.4Å; I61-L88 HydrophobicContact CB-CD2 4.44Å; I61-L88 HydrophobicContact CG1-CD2 3.92Å; V86-L88 HydrophobicContact CG1-CD2 4.12Å; L88-I90 HydrophobicContact CB-CG1 4.35Å; L88-I90 WeakPolarHBondContact CB-O 3.43Å; L88-I90 PolarHBondContact O-N 3.45Å; L88-P92 HydrophobicContact CD1-CB 4.15Å; L88-P92 HydrophobicContact CD1-CG 4.33Å; L88-A96 HydrophobicContact CD1-CB 4.46Å
89	K	94.4	Very high	93.7	Very high	132 Å²	132	73.9 Å²	73.9	57%	0.574	41%	0.411	S	S	*	.	S	Bend	trans	-70	-15.9	173.1	-65.8	-173.1	-179.1	176.3	0	112.9	Q60 E62	Q60-K89 HydrophobicContact CB-CB 4.03Å; Q60-K89 HydrophobicContact CB-CD 4.31Å; Q60-K89 HydrophobicContact CB-CG 4.4Å; Q60-K89 PolarHBondContact O-N 3.24Å; E62-K89 HydrophobicContact CB-CG 3.74Å; E62-K89 HydrophobicContact CG-CG 4.32Å
90	I	90.2	Very high	93.8	Very high	78 Å²	78	68.8 Å²	68.8	40%	0.4	39%	0.389	S	S	.	.	S	Bend	trans	-113	163.6	179	62.9	169.4	0	0	0	109.9	L88 P92	L88-I90 HydrophobicContact CB-CG1 4.35Å; L88-I90 WeakPolarHBondContact CB-O 3.43Å; L88-I90 PolarHBondContact O-N 3.45Å; I90-P92 WeakPolarHBondContact O-CD 3.36Å
91	L	93.6	Very high	94.1	Very high	145 Å²	145	67.7 Å²	67.7	76%	0.759	39%	0.391	S	S	*	.			trans	-56.4	125.9	171.3	-174.3	72.8	0	0	0	109.6	T93	L91-T93 PolarHBondContact O-N 3.41Å; L91-T93 VanDerWaalsContact O-N 3.11Å
92	P	93.4	Very high	94.3	Very high	84 Å²	84	69.2 Å²	69.2	55%	0.545	40%	0.396	S	S	.	.			trans	-64.3	114.5	177.2	-21.9	33.4	0	0	0	110.8	L88 I90 V97	L88-P92 HydrophobicContact CD1-CB 4.15Å; L88-P92 HydrophobicContact CD1-CG 4.33Å; I90-P92 WeakPolarHBondContact O-CD 3.36Å; P92-V97 HydrophobicContact CB-CG2 4.43Å
93	T	95	Very high	94.3	Very high	59 Å²	59	70.9 Å²	70.9	36%	0.362	40%	0.399	S	S	.	.			trans	-101.2	160.6	170.4	82	0	0	0	0	110.4	L91 E95 A96 V97	L91-T93 PolarHBondContact O-N 3.41Å; L91-T93 VanDerWaalsContact O-N 3.11Å; T93-E95 VanDerWaalsContact CB-OE2 3.24Å; T93-E95 WeakPolarHBondContact CB-OE2 3.5Å; T93-E95 PolarHBondContact O-N 2.94Å; T93-E95 PolarHBondContact OG1-N 3.47Å; T93-E95 PolarHBondContact OG1-OE2 3.38Å; T93-A96 PolarHBondContact O-N 3.23Å; T93-A96 PolarHBondContact OG1-N 2.99Å; T93-V97 WeakPolarHBondContact O-CG2 3.4Å; T93-V97 PolarHBondContact O-N 2.99Å
94	L	94.9	Very high	94.2	Very high	139 Å²	139	68.3 Å²	68.3	73%	0.728	39%	0.386	S	S	*	.	H	α-helix	trans	-57.7	-41.1	178	-174.3	74.6	0	0	0	111.1	V97 A98	L94-V97 PolarHBondContact O-N 3.32Å; L94-A98 WeakPolarHBondContact O-CB 3.22Å; L94-A98 PolarHBondContact O-N 2.83Å
95	E	93.9	Very high	94.1	Very high	128 Å²	128	69.1 Å²	69.1	60%	0.598	39%	0.392	S	S	*	.	H	α-helix	trans	-66.3	-44.5	-179	-56.6	72.3	-155.6	0	0	111	T93 V97 A98 A99	T93-E95 VanDerWaalsContact CB-OE2 3.24Å; T93-E95 WeakPolarHBondContact CB-OE2 3.5Å; T93-E95 PolarHBondContact O-N 2.94Å; T93-E95 PolarHBondContact OG1-N 3.47Å; T93-E95 PolarHBondContact OG1-OE2 3.38Å; E95-V97 PolarHBondContact O-N 3.27Å; E95-A98 PolarHBondContact O-N 3.22Å; E95-A99 VanDerWaalsContact O-CB 3.25Å; E95-A99 WeakPolarHBondContact O-CB 3.45Å; E95-A99 PolarHBondContact O-N 3.19Å
96	A	92.7	Very high	94	Very high	9 Å²	9	71.4 Å²	71.4	7%	0.074	40%	0.398	C	S	.	.	H	α-helix	trans	-63.5	-42.3	177.8	0	0	0	0	0	111.6	V59 L88 T93 L100	V59-A96 HydrophobicContact CG1-CB 4.28Å; V59-A96 HydrophobicContact CG2-CB 3.92Å; L88-A96 HydrophobicContact CD1-CB 4.46Å; T93-A96 PolarHBondContact O-N 3.23Å; T93-A96 PolarHBondContact OG1-N 2.99Å; A96-L100 WeakPolarHBondContact O-CB 3.49Å; A96-L100 PolarHBondContact O-N 3.34Å
97	V	93.8	Very high	93.9	Very high	82 Å²	82	70.3 Å²	70.3	50%	0.497	39%	0.393	S	S	.	.	H	α-helix	trans	-66.4	-43.5	177.6	174.9	0	0	0	0	111.1	P92 T93 L94 E95 L100 G101	P92-V97 HydrophobicContact CB-CG2 4.43Å; T93-V97 WeakPolarHBondContact O-CG2 3.4Å; T93-V97 PolarHBondContact O-N 2.99Å; L94-V97 PolarHBondContact O-N 3.32Å; E95-V97 PolarHBondContact O-N 3.27Å; V97-L100 PolarHBondContact O-N 2.86Å; V97-G101 PolarHBondContact O-N 3.15Å
98	A	94.8	Very high	93.7	Very high	52 Å²	52	69 Å²	69	43%	0.43	39%	0.386	S	S	.	.	H	α-helix	trans	-64.6	-43.1	177	0	0	0	0	0	112.1	L94 E95 L100 G101 N102	L94-A98 WeakPolarHBondContact O-CB 3.22Å; L94-A98 PolarHBondContact O-N 2.83Å; E95-A98 PolarHBondContact O-N 3.22Å; A98-L100 VanDerWaalsContact C-N 3.34Å; A98-L100 PolarHBondContact O-N 3.25Å; A98-G101 PolarHBondContact O-N 2.82Å; A98-N102 PolarHBondContact O-N 3.07Å; A98-N102 PolarHBondContact O-ND2 3.4Å
99	A	94.1	Very high	93.4	Very high	40 Å²	40	75.5 Å²	75.5	33%	0.331	41%	0.409	S	S	.	.	H	α-helix	trans	-61.4	-42.5	176.1	0	0	0	0	0	111.6	F57 V59 E95 N102 K103	F57-A99 HydrophobicContact CE2-CB 4.25Å; V59-A99 HydrophobicContact CG2-CB 4.36Å; E95-A99 VanDerWaalsContact O-CB 3.25Å; E95-A99 WeakPolarHBondContact O-CB 3.45Å; E95-A99 PolarHBondContact O-N 3.19Å; A99-N102 PolarHBondContact O-N 3.18Å; A99-K103 WeakPolarHBondContact O-CB 3.4Å; A99-K103 PolarHBondContact O-N 2.93Å
100	L	94.4	Very high	93.1	Very high	20 Å²	20	73.3 Å²	73.3	11%	0.105	42%	0.416	C	S	.	.	H	α-helix	trans	-61.7	-48.3	174.6	179.2	62.9	0	0	0	112.1	L50 F57 I61 V86 A96 V97 A98 N102 K103 V104	L50-L100 HydrophobicContact CD1-CD1 4.13Å; F57-L100 HydrophobicContact CE1-CD1 3.94Å; F57-L100 HydrophobicContact CZ-CB 4.03Å; F57-L100 HydrophobicContact CZ-CD1 3.9Å; I61-L100 HydrophobicContact CD1-CD1 3.67Å; V86-L100 HydrophobicContact CB-CD2 4.34Å; V86-L100 HydrophobicContact CG1-CD2 3.9Å; V86-L100 HydrophobicContact CG2-CD2 4.46Å; A96-L100 WeakPolarHBondContact O-CB 3.49Å; A96-L100 PolarHBondContact O-N 3.34Å; V97-L100 PolarHBondContact O-N 2.86Å; A98-L100 VanDerWaalsContact C-N 3.34Å; A98-L100 PolarHBondContact O-N 3.25Å; L100-N102 VanDerWaalsContact C-N 3.34Å; L100-N102 PolarHBondContact O-N 3.36Å; L100-K103 PolarHBondContact O-N 3.32Å; L100-V104 HydrophobicContact CD1-CG2 4.11Å; L100-V104 HydrophobicContact CG-CG2 4.48Å; L100-V104 WeakPolarHBondContact O-CG2 3.35Å; L100-V104 PolarHBondContact O-N 3.48Å
101	G	93.8	Very high	92.8	Very high	37 Å²	37	75 Å²	75	38%	0.381	42%	0.422	S	S	.	.	H	α-helix	trans	-56.8	-47.7	177.4	0	0	0	0	0	112.1	V97 A98 K103 V104 V105	V97-G101 PolarHBondContact O-N 3.15Å; A98-G101 PolarHBondContact O-N 2.82Å; G101-K103 PolarHBondContact O-N 2.9Å; G101-V104 PolarHBondContact O-N 2.86Å; G101-V105 WeakPolarHBondContact O-CG2 3.48Å; G101-V105 PolarHBondContact O-N 3.35Å; G101-V105 VanDerWaalsContact O-N 3.08Å
102	N	94.7	Very high	92.2	Very high	117 Å²	117	70 Å²	70	63%	0.626	40%	0.396	S	S	*	.	H	α-helix	trans	-62.1	-43.3	177.3	-71.1	-26.9	0	0	0	112.1	A98 A99 L100 V104 V105 E106	A98-N102 PolarHBondContact O-N 3.07Å; A98-N102 PolarHBondContact O-ND2 3.4Å; A99-N102 PolarHBondContact O-N 3.18Å; L100-N102 VanDerWaalsContact C-N 3.34Å; L100-N102 PolarHBondContact O-N 3.36Å; N102-V104 PolarHBondContact O-N 2.99Å; N102-V105 PolarHBondContact O-N 2.94Å; N102-E106 WeakPolarHBondContact O-CB 3.38Å; N102-E106 PolarHBondContact O-N 3.28Å
103	K	94.1	Very high	91.2	Very high	64 Å²	64	71.5 Å²	71.5	28%	0.278	41%	0.406	S	S	.	.	H	α-helix	trans	-64.9	-39.8	180	-171.2	70.3	-152.1	160.6	0	112.2	L50 F57 A99 L100 G101 E106 S107	L50-K103 HydrophobicContact CD1-CG 4.08Å; L50-K103 HydrophobicContact CD2-CG 4.06Å; F57-K103 HydrophobicContact CD2-CB 4.11Å; F57-K103 HydrophobicContact CD2-CD 4.2Å; F57-K103 HydrophobicContact CD2-CG 3.92Å; F57-K103 HydrophobicContact CE2-CB 3.72Å; F57-K103 HydrophobicContact CE2-CG 4.03Å; F57-K103 HydrophobicContact CG-CG 4.33Å; F57-K103 HydrophobicContact CZ-CB 4.18Å; A99-K103 WeakPolarHBondContact O-CB 3.4Å; A99-K103 PolarHBondContact O-N 2.93Å; L100-K103 PolarHBondContact O-N 3.32Å; G101-K103 PolarHBondContact O-N 2.9Å; K103-E106 IonicContact NZ-OE2 2.82Å; K103-E106 PolarHBondContact NZ-OE2 3.49Å; K103-S107 VanDerWaalsContact O-CB 3.31Å; K103-S107 WeakPolarHBondContact O-CB 3.35Å; K103-S107 PolarHBondContact O-N 3.01Å; K103-S107 PolarHBondContact O-OG 3.47Å
104	V	93.8	Very high	90	Very high	19 Å²	19	73.8 Å²	73.8	12%	0.115	42%	0.424	C	S	.	.	H	α-helix	trans	-63.6	-48.2	176.5	171.3	0	0	0	0	110.4	I43 V46 I47 L100 G101 N102 E106 S107 L108	I43-V104 HydrophobicContact CG2-CG1 4.38Å; V46-V104 HydrophobicContact CG1-CB 4.45Å; V46-V104 HydrophobicContact CG1-CG1 4.47Å; V46-V104 HydrophobicContact CG1-CG2 4.18Å; I47-V104 HydrophobicContact CG1-CG2 4.24Å; L100-V104 HydrophobicContact CD1-CG2 4.11Å; L100-V104 HydrophobicContact CG-CG2 4.48Å; L100-V104 WeakPolarHBondContact O-CG2 3.35Å; L100-V104 PolarHBondContact O-N 3.48Å; G101-V104 PolarHBondContact O-N 2.86Å; N102-V104 PolarHBondContact O-N 2.99Å; V104-E106 PolarHBondContact O-N 3.07Å; V104-S107 PolarHBondContact O-N 3.29Å; V104-L108 HydrophobicContact CG1-CD1 3.88Å; V104-L108 HydrophobicContact CG1-CG 4.38Å; V104-L108 WeakPolarHBondContact O-CB 3.43Å; V104-L108 WeakPolarHBondContact O-CG 3.44Å; V104-L108 PolarHBondContact O-N 3.47Å
105	V	93.3	Very high	88.3	Confident	66 Å²	66	72.9 Å²	72.9	40%	0.4	42%	0.416	S	S	.	.	H	α-helix	trans	-61.9	-44.6	178.5	173.1	0	0	0	0	111.8	G101 N102 S107 L108 R109	G101-V105 WeakPolarHBondContact O-CG2 3.48Å; G101-V105 PolarHBondContact O-N 3.35Å; G101-V105 VanDerWaalsContact O-N 3.08Å; N102-V105 PolarHBondContact O-N 2.94Å; V105-S107 VanDerWaalsContact C-N 3.35Å; V105-S107 PolarHBondContact O-N 3.29Å; V105-L108 PolarHBondContact O-N 2.96Å; V105-R109 WeakPolarHBondContact O-CG 3.39Å; V105-R109 PolarHBondContact O-N 3.29Å
106	E	93.3	Very high	88.1	Confident	114 Å²	114	70.1 Å²	70.1	53%	0.533	41%	0.407	S	S	.	.	H	α-helix	trans	-59.5	-46.4	176.4	-175.1	-167.8	-161.6	0	0	111.3	N102 K103 V104 R109 A110	N102-E106 WeakPolarHBondContact O-CB 3.38Å; N102-E106 PolarHBondContact O-N 3.28Å; K103-E106 IonicContact NZ-OE2 2.82Å; K103-E106 PolarHBondContact NZ-OE2 3.49Å; V104-E106 PolarHBondContact O-N 3.07Å; E106-R109 PolarHBondContact O-N 3.15Å; E106-A110 WeakPolarHBondContact O-CB 3.47Å; E106-A110 PolarHBondContact O-N 2.93Å
107	S	92.1	Very high	87.8	Confident	23 Å²	23	73.3 Å²	73.3	16%	0.161	43%	0.425	C	S	.	.	H	α-helix	trans	-68.3	-37.1	-178	-55.2	0	0	0	0	112.2	K103 V104 V105 Q111	K103-S107 VanDerWaalsContact O-CB 3.31Å; K103-S107 WeakPolarHBondContact O-CB 3.35Å; K103-S107 PolarHBondContact O-N 3.01Å; K103-S107 PolarHBondContact O-OG 3.47Å; V104-S107 PolarHBondContact O-N 3.29Å; V105-S107 VanDerWaalsContact C-N 3.35Å; V105-S107 PolarHBondContact O-N 3.29Å; S107-Q111 WeakPolarHBondContact O-CG 3.49Å; S107-Q111 PolarHBondContact O-N 3.23Å
108	L	91.3	Very high	87.5	Confident	20 Å²	20	72.8 Å²	72.8	11%	0.105	42%	0.42	C	S	.	.	H	α-helix	trans	-63.9	-50.5	174.3	-76.1	170.5	0	0	0	111.2	K42 I43 V46 V104 V105 A110 Q111 D112	K42-L108 HydrophobicContact CB-CD2 3.64Å; I43-L108 HydrophobicContact CG1-CD1 3.88Å; I43-L108 HydrophobicContact CG1-CD2 4.41Å; V46-L108 HydrophobicContact CG2-CD2 4.11Å; V46-L108 HydrophobicContact CG2-CG 4.32Å; V104-L108 HydrophobicContact CG1-CD1 3.88Å; V104-L108 HydrophobicContact CG1-CG 4.38Å; V104-L108 WeakPolarHBondContact O-CB 3.43Å; V104-L108 WeakPolarHBondContact O-CG 3.44Å; V104-L108 PolarHBondContact O-N 3.47Å; V105-L108 PolarHBondContact O-N 2.96Å; L108-A110 PolarHBondContact O-N 2.92Å; L108-Q111 PolarHBondContact O-N 2.89Å; L108-D112 PolarHBondContact O-N 2.61Å
109	R	90.4	Very high	87.1	Confident	158 Å²	158	74.1 Å²	74.1	60%	0.596	42%	0.42	S	S	*	.	H	α-helix	trans	-61.9	-32.3	179	-73.3	177.9	176.5	173.5	2	113.3	V105 E106 Q111 D112 P113	V105-R109 WeakPolarHBondContact O-CG 3.39Å; V105-R109 PolarHBondContact O-N 3.29Å; E106-R109 PolarHBondContact O-N 3.15Å; R109-Q111 VanDerWaalsContact C-N 3.35Å; R109-D112 CarbonylContact O-C 3.49Å; R109-P113 WeakPolarHBondContact O-CA 3.46Å
110	A	88.7	Confident	86.6	Confident	85 Å²	85	76.2 Å²	76.2	70%	0.702	43%	0.426	S	S	*	.	H	α-helix	trans	-69.3	-33.1	175.1	0	0	0	0	0	112.5	E106 L108	E106-A110 WeakPolarHBondContact O-CB 3.47Å; E106-A110 PolarHBondContact O-N 2.93Å; L108-A110 PolarHBondContact O-N 2.92Å
111	Q	83	Confident	86.1	Confident	113 Å²	113	79.9 Å²	79.9	53%	0.528	45%	0.447	S	S	.	.	H	α-helix	trans	-82.1	-35.9	177	-69.5	174.6	28.9	0	0	112.2	S107 L108 R109	S107-Q111 WeakPolarHBondContact O-CG 3.49Å; S107-Q111 PolarHBondContact O-N 3.23Å; L108-Q111 PolarHBondContact O-N 2.89Å; R109-Q111 VanDerWaalsContact C-N 3.35Å
112	D	80	Confident	85.5	Confident	40 Å²	40	83 Å²	83	21%	0.214	45%	0.452	C	S	.	.			trans	-143.8	96	-177	-166.3	-15.2	0	0	0	110.3	K42 L108 R109 S114 E115	K42-D112 IonicContact NZ-OD2 3.19Å; K42-D112 PolarHBondContact NZ-OD2 3Å; L108-D112 PolarHBondContact O-N 2.61Å; R109-D112 CarbonylContact O-C 3.49Å; D112-S114 PolarHBondContact O-N 3.3Å; D112-S114 VanDerWaalsContact O-N 3.11Å; D112-S114 PolarHBondContact OD1-N 3.47Å; D112-S114 PolarHBondContact OD1-OG 3.44Å; D112-E115 PolarHBondContact O-N 3.31Å
113	P	74.1	Confident	84.8	Confident	117 Å²	117	80.4 Å²	80.4	76%	0.76	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.6	-8.8	-178.3	-20.3	32	0	0	0	114.4	R109	R109-P113 WeakPolarHBondContact O-CA 3.46Å
114	S	70	Confident	84.1	Confident	107 Å²	107	81.8 Å²	81.8	75%	0.748	45%	0.452	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92	-6.6	-176.3	70.3	0	0	0	0	114.2	D112	D112-S114 PolarHBondContact O-N 3.3Å; D112-S114 VanDerWaalsContact O-N 3.11Å; D112-S114 PolarHBondContact OD1-N 3.47Å; D112-S114 PolarHBondContact OD1-OG 3.44Å
115	E	59	Low	83.2	Confident	119 Å²	119	87.5 Å²	87.5	56%	0.556	48%	0.482	S	S	*	.			trans	-94.7	0	172.4	-96.6	-167.4	-159	0	0	114.4	L39 K42 D112	L39-E115 WeakPolarHBondContact CD1-OE2 3.22Å; K42-E115 IonicContact NZ-OE1 2.78Å; K42-E115 PolarHBondContact NZ-OE1 2.77Å; D112-E115 PolarHBondContact O-N 3.31Å

Retrieved 115 of 115 residues in 46.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).