X6R8P6_HUMAN Loading...

SOSS complex subunit C

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs).

AlphaFold DB , UniProt , Accession X6R8P6, Species HUMAN (Homo sapiens, Human), Gene INIP, Length 74 aa.

						>X6R8P6_HUMAN|X6R8P6|INIP
MQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.5	Low	49.9	Very low	231 Å²	231	144.4 Å²	144.4	100%	1.138	81%	0.809	S	S	*	*				0	105	0	-82.6	-92	-85.5	0	0	107.8
2	Q	46.9	Very low	50.1	Low	194 Å²	194	141.3 Å²	141.3	91%	0.907	82%	0.815	S	S	*	*			trans	158.1	74.9	169.9	-89.2	159.9	21.7	0	0	106.8
3	N	45.5	Very low	49.9	Very low	155 Å²	155	138.6 Å²	138.6	83%	0.829	81%	0.81	S	S	*	*				59.5	91	105	-162.2	38.4	0	0	0	114.2
4	Q	50.9	Low	50.5	Low	200 Å²	200	141 Å²	141	94%	0.935	82%	0.815	S	S	*	*			trans	-90.2	117	164.9	-66.1	-174.1	37.9	0	0	108.6
5	S	55.6	Low	50.7	Low	99 Å²	99	138.1 Å²	138.1	69%	0.692	81%	0.814	S	S	*	*			trans	-142.8	155.7	167.4	-169.7	0	0	0	0	109.8
6	S	50.5	Low	50.9	Low	99 Å²	99	138.7 Å²	138.7	69%	0.692	81%	0.812	S	S	*	*			trans	88.5	77.8	175.4	-58.1	0	0	0	0	116.8
7	T	55.4	Low	51.4	Low	101 Å²	101	137.6 Å²	137.6	62%	0.62	81%	0.814	S	S	*	*				38.3	103.6	127.3	54.6	0	0	0	0	118.1	H9	T7-H9 WeakPolarHBondContact CB-NE2 3.4Å; T7-H9 PolarHBondContact O-CE1 3.28Å; T7-H9 VanDerWaalsContact O-CE1 3.27Å; T7-H9 PolarHBondContact O-N 2.85Å; T7-H9 PolarHBondContact O-ND1 3.12Å; T7-H9 PolarHBondContact OG1-CE1 3.03Å; T7-H9 VanDerWaalsContact OG1-CE1 3.28Å; T7-H9 PolarHBondContact OG1-NE2 3.27Å
8	N	45.8	Very low	51.8	Low	167 Å²	167	142.3 Å²	142.3	89%	0.893	82%	0.815	S	S	*	*			trans	-64.7	110.4	157.1	-63.1	-41.4	0	0	0	109.7
9	H	51.9	Low	51.6	Low	145 Å²	145	140.5 Å²	140.5	67%	0.671	81%	0.809	S	S	*	*			trans	-116.3	109.2	159	-10.1	79.1	0	0	0	107.6	T7 G11	T7-H9 WeakPolarHBondContact CB-NE2 3.4Å; T7-H9 PolarHBondContact O-CE1 3.28Å; T7-H9 VanDerWaalsContact O-CE1 3.27Å; T7-H9 PolarHBondContact O-N 2.85Å; T7-H9 PolarHBondContact O-ND1 3.12Å; T7-H9 PolarHBondContact OG1-CE1 3.03Å; T7-H9 VanDerWaalsContact OG1-CE1 3.28Å; T7-H9 PolarHBondContact OG1-NE2 3.27Å; H9-G11 PolarHBondContact O-N 3.41Å
10	P	47.4	Very low	51.9	Low	133 Å²	133	138.3 Å²	138.3	86%	0.864	80%	0.803	S	S	*	*			trans	-84.1	104.3	169.6	32	-25.5	0	0	0	107.4
11	G	46.6	Very low	52.1	Low	64 Å²	64	138 Å²	138	66%	0.66	80%	0.797	S	S	*	*			trans	157	32	174	0	0	0	0	0	117.2	H9 S13	H9-G11 PolarHBondContact O-N 3.41Å; G11-S13 VanDerWaalsContact C-N 3.29Å; G11-S13 PolarHBondContact O-N 3.29Å
12	A	52	Low	52.4	Low	107 Å²	107	133 Å²	133	88%	0.884	78%	0.775	S	S	*	*			trans	-86.4	73	166.8	0	0	0	0	0	109.8
13	S	47.8	Very low	53.1	Low	107 Å²	107	130.6 Å²	130.6	75%	0.748	76%	0.762	S	S	*	*			trans	-97.8	113.5	161.6	33.2	0	0	0	0	108.4	G11 A15	G11-S13 VanDerWaalsContact C-N 3.29Å; G11-S13 PolarHBondContact O-N 3.29Å; S13-A15 PolarHBondContact O-N 3.49Å
14	I	57.9	Low	54.1	Low	172 Å²	172	127.9 Å²	127.9	88%	0.882	75%	0.747	S	S	*	*			trans	-56.5	105.4	177.7	-59.4	-176.6	0	0	0	108.7	L16	I14-L16 PolarHBondContact O-N 3.28Å
15	A	53.5	Low	55.2	Low	97 Å²	97	125.8 Å²	125.8	80%	0.802	74%	0.735	S	S	*	*			trans	-88.3	99.2	172.2	0	0	0	0	0	108.9	S13 S17	S13-A15 PolarHBondContact O-N 3.49Å; A15-S17 PolarHBondContact O-N 3.47Å
16	L	53.7	Low	56	Low	148 Å²	148	130.1 Å²	130.1	78%	0.775	74%	0.736	S	S	*	*			trans	-42.8	131.6	166.6	-172.4	68.4	0	0	0	110.9	I14 R18	I14-L16 PolarHBondContact O-N 3.28Å; L16-R18 PolarHBondContact O-N 3.26Å
17	S	59.8	Low	57.5	Low	121 Å²	121	129.4 Å²	129.4	85%	0.846	73%	0.725	S	S	*	*			trans	-42.9	105.7	178.7	-48.1	0	0	0	0	112.6	A15	A15-S17 PolarHBondContact O-N 3.47Å
18	R	58.3	Low	58.8	Low	221 Å²	221	130 Å²	130	83%	0.834	72%	0.72	S	S	*	*			trans	-107.4	137.2	165.3	-62.5	-178.8	106.3	-179.9	4.6	107.9	L16 S20	L16-R18 PolarHBondContact O-N 3.26Å; R18-S20 PolarHBondContact O-N 3.26Å
19	P	48.7	Very low	60.7	Low	109 Å²	109	124.9 Å²	124.9	71%	0.708	70%	0.701	S	S	*	*			trans	-57.8	134.8	179.2	23.4	-30.8	0	0	0	109.7	L21	P19-L21 PolarHBondContact O-N 3.26Å
20	S	57.6	Low	62.4	Low	96 Å²	96	123.7 Å²	123.7	67%	0.671	70%	0.696	S	S	*	*	S	Bend	trans	-64.6	19.6	-161.3	-45.6	0	0	0	0	117.3	R18 N22 K23	R18-S20 PolarHBondContact O-N 3.26Å; S20-N22 PolarHBondContact O-N 2.91Å; S20-K23 PolarHBondContact O-N 3.07Å
21	L	56.5	Low	64.2	Low	132 Å²	132	123.8 Å²	123.8	69%	0.691	69%	0.685	S	S	*	*	H	α-helix	trans	-64.6	-13.1	-175.9	-55.7	177.3	0	0	0	114.4	P19 F25	P19-L21 PolarHBondContact O-N 3.26Å; L21-F25 VanDerWaalsContact O-CD2 3.26Å; L21-F25 WeakPolarHBondContact O-CD2 3.34Å
22	N	58.2	Low	66.2	Low	125 Å²	125	127.6 Å²	127.6	67%	0.668	69%	0.686	S	S	*	*	H	α-helix	trans	-91.5	-16.2	-177	-149.2	-60.5	0	0	0	112.6	S20 R26	S20-N22 PolarHBondContact O-N 2.91Å; N22-R26 PolarHBondContact O-N 3.24Å
23	K	61.8	Low	67.9	Low	145 Å²	145	128 Å²	128	63%	0.63	67%	0.669	S	S	*	*	H	α-helix	trans	-70	-45.7	-175.7	-167.6	145.8	-179.6	179.8	0	110.6	S20 F25 R26 D27	S20-K23 PolarHBondContact O-N 3.07Å; K23-F25 PolarHBondContact O-N 3.01Å; K23-R26 PolarHBondContact O-N 3.13Å; K23-R26 VanDerWaalsContact O-N 3.07Å; K23-D27 VanDerWaalsContact CG-OD2 3.31Å; K23-D27 WeakPolarHBondContact CG-OD2 3.35Å; K23-D27 PolarHBondContact O-N 3.26Å
24	D	67.2	Low	69.9	Low	98 Å²	98	126.1 Å²	126.1	52%	0.524	65%	0.65	S	S	.	*	H	α-helix	trans	-57.9	-46.6	178.3	-52.9	-81.7	0	0	0	112.5	R26 D27 H28	D24-R26 VanDerWaalsContact C-N 3.28Å; D24-R26 PolarHBondContact O-N 3.49Å; D24-D27 PolarHBondContact O-N 2.85Å; D24-H28 VanDerWaalsContact C-CD2 3.45Å; D24-H28 WeakPolarHBondContact O-CB 3.36Å; D24-H28 PolarHBondContact O-CD2 3.42Å; D24-H28 PolarHBondContact O-N 3.25Å
25	F	72.1	Confident	71.4	Confident	156 Å²	156	120.2 Å²	120.2	68%	0.684	63%	0.627	S	S	*	*	H	α-helix	trans	-61.6	-35.8	177.4	-73.4	-82.8	0	0	0	113.1	L21 K23 A29	L21-F25 VanDerWaalsContact O-CD2 3.26Å; L21-F25 WeakPolarHBondContact O-CD2 3.34Å; K23-F25 PolarHBondContact O-N 3.01Å; F25-A29 WeakPolarHBondContact O-CB 3.11Å; F25-A29 PolarHBondContact O-N 2.77Å
26	R	73.8	Confident	73.3	Confident	190 Å²	190	118.4 Å²	118.4	72%	0.717	61%	0.612	S	S	*	*	H	α-helix	trans	-74	-42	179.9	-167.5	155.4	92.5	162.3	7.2	111.7	N22 K23 D24 H28 A29 E30	N22-R26 PolarHBondContact O-N 3.24Å; K23-R26 PolarHBondContact O-N 3.13Å; K23-R26 VanDerWaalsContact O-N 3.07Å; D24-R26 VanDerWaalsContact C-N 3.28Å; D24-R26 PolarHBondContact O-N 3.49Å; R26-H28 VanDerWaalsContact C-N 3.33Å; R26-A29 PolarHBondContact O-N 3.44Å; R26-E30 PolarHBondContact O-N 3.38Å
27	D	81	Confident	75.3	Confident	83 Å²	83	115 Å²	115	44%	0.444	59%	0.592	S	S	.	*	H	α-helix	trans	-60.9	-41.8	172	-79.6	-84.7	0	0	0	111.1	K23 D24 A29 E30 Q31	K23-D27 VanDerWaalsContact CG-OD2 3.31Å; K23-D27 WeakPolarHBondContact CG-OD2 3.35Å; K23-D27 PolarHBondContact O-N 3.26Å; D24-D27 PolarHBondContact O-N 2.85Å; D27-A29 PolarHBondContact O-N 2.97Å; D27-E30 PolarHBondContact O-N 2.97Å; D27-Q31 WeakPolarHBondContact O-CB 3.27Å; D27-Q31 PolarHBondContact O-N 3.39Å
28	H	82.9	Confident	77	Confident	113 Å²	113	110.5 Å²	110.5	52%	0.523	56%	0.558	S	S	.	*	H	α-helix	trans	-62.9	-43	174.2	-69.5	-49.5	0	0	0	112.7	D24 R26 Q31 Q32	D24-H28 VanDerWaalsContact C-CD2 3.45Å; D24-H28 WeakPolarHBondContact O-CB 3.36Å; D24-H28 PolarHBondContact O-CD2 3.42Å; D24-H28 PolarHBondContact O-N 3.25Å; R26-H28 VanDerWaalsContact C-N 3.33Å; H28-Q31 PolarHBondContact O-N 3.38Å; H28-Q32 WeakPolarHBondContact O-CB 3.13Å; H28-Q32 WeakPolarHBondContact O-CG 3.3Å; H28-Q32 PolarHBondContact O-N 3.47Å
29	A	86.3	Confident	78.8	Confident	61 Å²	61	106.1 Å²	106.1	50%	0.504	55%	0.545	S	S	.	.	H	α-helix	trans	-64.2	-41	178.3	0	0	0	0	0	112	F25 R26 D27 Q32 H33	F25-A29 WeakPolarHBondContact O-CB 3.11Å; F25-A29 PolarHBondContact O-N 2.77Å; R26-A29 PolarHBondContact O-N 3.44Å; D27-A29 PolarHBondContact O-N 2.97Å; A29-Q32 PolarHBondContact O-N 2.95Å; A29-H33 WeakPolarHBondContact O-CB 3.35Å; A29-H33 PolarHBondContact O-N 3.35Å
30	E	86.7	Confident	81.1	Confident	119 Å²	119	103.6 Å²	103.6	56%	0.556	53%	0.533	S	S	*	.	H	α-helix	trans	-63.1	-47	174.8	-174.3	-175.4	145	0	0	111.4	R26 D27 Q32 H33 I34	R26-E30 PolarHBondContact O-N 3.38Å; D27-E30 PolarHBondContact O-N 2.97Å; E30-Q32 VanDerWaalsContact C-N 3.3Å; E30-Q32 PolarHBondContact O-N 2.98Å; E30-H33 WeakPolarHBondContact O-CA 3.36Å; E30-H33 WeakPolarHBondContact O-CB 3.34Å; E30-H33 PolarHBondContact O-N 3.43Å; E30-I34 HydrophobicContact CG-CD1 4.03Å; E30-I34 WeakPolarHBondContact O-CG1 3.45Å; E30-I34 PolarHBondContact O-N 3.22Å
31	Q	85	Confident	82.9	Confident	136 Å²	136	100.1 Å²	100.1	64%	0.636	51%	0.51	S	S	*	.	H	α-helix	trans	-63.5	-38.2	-180	-168.5	156.2	28.6	0	0	112.1	D27 H28 H33 A35	D27-Q31 WeakPolarHBondContact O-CB 3.27Å; D27-Q31 PolarHBondContact O-N 3.39Å; H28-Q31 PolarHBondContact O-N 3.38Å; Q31-H33 VanDerWaalsContact C-N 3.34Å; Q31-A35 VanDerWaalsContact O-CB 3.31Å; Q31-A35 WeakPolarHBondContact O-CB 3.5Å; Q31-A35 PolarHBondContact O-N 3Å
32	Q	88.9	Confident	84.9	Confident	143 Å²	143	95.7 Å²	95.7	67%	0.668	49%	0.487	S	S	*	.	H	α-helix	trans	-62.4	-41.6	171.6	-71.7	-73.7	-53.3	0	0	111.8	H28 A29 E30 A35 A36	H28-Q32 WeakPolarHBondContact O-CB 3.13Å; H28-Q32 WeakPolarHBondContact O-CG 3.3Å; H28-Q32 PolarHBondContact O-N 3.47Å; A29-Q32 PolarHBondContact O-N 2.95Å; E30-Q32 VanDerWaalsContact C-N 3.3Å; E30-Q32 PolarHBondContact O-N 2.98Å; Q32-A35 PolarHBondContact O-N 3.34Å; Q32-A36 WeakPolarHBondContact O-CB 3.39Å; Q32-A36 PolarHBondContact O-N 3.37Å
33	H	88.7	Confident	86.8	Confident	117 Å²	117	95.3 Å²	95.3	54%	0.542	48%	0.481	S	S	.	.	H	α-helix	trans	-63.6	-46	178.9	-172.2	65.2	0	0	0	111.9	A29 E30 Q31 A36 Q37	A29-H33 WeakPolarHBondContact O-CB 3.35Å; A29-H33 PolarHBondContact O-N 3.35Å; E30-H33 WeakPolarHBondContact O-CA 3.36Å; E30-H33 WeakPolarHBondContact O-CB 3.34Å; E30-H33 PolarHBondContact O-N 3.43Å; Q31-H33 VanDerWaalsContact C-N 3.34Å; H33-A36 PolarHBondContact O-N 3.33Å; H33-Q37 PolarHBondContact CD2-NE2 3.1Å; H33-Q37 PolarHBondContact NE2-NE2 3.01Å; H33-Q37 WeakPolarHBondContact O-CG 3.42Å; H33-Q37 PolarHBondContact O-N 2.95Å; H33-Q37 VanDerWaalsContact O-N 3.1Å
34	I	88.5	Confident	88.5	Confident	66 Å²	66	94.2 Å²	94.2	34%	0.338	48%	0.478	S	S	.	.	H	α-helix	trans	-62	-47	176.4	-65.2	166.5	0	0	0	110.4	E30 A36 Q37 Q38	E30-I34 HydrophobicContact CG-CD1 4.03Å; E30-I34 WeakPolarHBondContact O-CG1 3.45Å; E30-I34 PolarHBondContact O-N 3.22Å; I34-A36 VanDerWaalsContact C-N 3.31Å; I34-A36 PolarHBondContact O-N 3.04Å; I34-Q37 PolarHBondContact O-N 3.02Å; I34-Q38 HydrophobicContact CG2-CG 4.36Å; I34-Q38 WeakPolarHBondContact O-CG 3.5Å; I34-Q38 PolarHBondContact O-N 3.35Å
35	A	90.1	Very high	90	Very high	48 Å²	48	90 Å²	90	40%	0.397	46%	0.457	S	S	.	.	H	α-helix	trans	-59.7	-40.6	178.3	0	0	0	0	0	112.4	Q31 Q32 K39	Q31-A35 VanDerWaalsContact O-CB 3.31Å; Q31-A35 WeakPolarHBondContact O-CB 3.5Å; Q31-A35 PolarHBondContact O-N 3Å; Q32-A35 PolarHBondContact O-N 3.34Å; A35-K39 WeakPolarHBondContact O-CB 3.37Å; A35-K39 PolarHBondContact O-N 3.22Å
36	A	94.3	Very high	91.2	Very high	59 Å²	59	87.5 Å²	87.5	49%	0.488	45%	0.447	S	S	.	.	H	α-helix	trans	-63.9	-42.5	176.8	0	0	0	0	0	112.1	Q32 H33 I34 K39 A40	Q32-A36 WeakPolarHBondContact O-CB 3.39Å; Q32-A36 PolarHBondContact O-N 3.37Å; H33-A36 PolarHBondContact O-N 3.33Å; I34-A36 VanDerWaalsContact C-N 3.31Å; I34-A36 PolarHBondContact O-N 3.04Å; A36-K39 PolarHBondContact O-N 2.93Å; A36-A40 PolarHBondContact O-N 3.36Å
37	Q	94.1	Very high	92.4	Very high	78 Å²	78	82.2 Å²	82.2	36%	0.364	44%	0.444	S	S	.	.	H	α-helix	trans	-64.4	-46.6	177.1	-71.7	-173.3	43.5	0	0	112.1	H33 I34 K39 A40 A41 L63	H33-Q37 PolarHBondContact CD2-NE2 3.1Å; H33-Q37 PolarHBondContact NE2-NE2 3.01Å; H33-Q37 WeakPolarHBondContact O-CG 3.42Å; H33-Q37 PolarHBondContact O-N 2.95Å; H33-Q37 VanDerWaalsContact O-N 3.1Å; I34-Q37 PolarHBondContact O-N 3.02Å; Q37-K39 VanDerWaalsContact C-N 3.29Å; Q37-K39 PolarHBondContact O-N 2.84Å; Q37-A40 PolarHBondContact O-N 3.15Å; Q37-A41 PolarHBondContact O-N 3.01Å; Q37-L63 HydrophobicContact CB-CD1 4.03Å; Q37-L63 HydrophobicContact CB-CD2 4.37Å
38	Q	96	Very high	93.2	Very high	26 Å²	26	85.1 Å²	85.1	12%	0.121	45%	0.454	C	S	.	.	H	α-helix	trans	-59.4	-41.4	177.1	-71.2	175.8	-14.2	0	0	111.5	I34 A41 L42 T55 Q56 L63	I34-Q38 HydrophobicContact CG2-CG 4.36Å; I34-Q38 WeakPolarHBondContact O-CG 3.5Å; I34-Q38 PolarHBondContact O-N 3.35Å; Q38-A41 PolarHBondContact O-N 3.44Å; Q38-L42 WeakPolarHBondContact O-CB 3.45Å; Q38-L42 PolarHBondContact O-N 3.41Å; Q38-T55 HydrophobicContact CB-CG2 3.7Å; Q38-Q56 PolarHBondContact NE2-O 3.37Å; Q38-L63 HydrophobicContact CG-CB 4.41Å; Q38-L63 HydrophobicContact CG-CD2 4.41Å
39	K	96.4	Very high	93.9	Very high	129 Å²	129	82.4 Å²	82.4	56%	0.561	45%	0.448	S	S	*	.	H	α-helix	trans	-61.4	-46.1	175.4	-177.5	179	179.3	-179	0	112.2	A35 A36 Q37 L42 Q43	A35-K39 WeakPolarHBondContact O-CB 3.37Å; A35-K39 PolarHBondContact O-N 3.22Å; A36-K39 PolarHBondContact O-N 2.93Å; Q37-K39 VanDerWaalsContact C-N 3.29Å; Q37-K39 PolarHBondContact O-N 2.84Å; K39-L42 PolarHBondContact O-N 3Å; K39-Q43 WeakPolarHBondContact O-CG 3.45Å; K39-Q43 PolarHBondContact O-N 3.48Å
40	A	97.1	Very high	94.3	Very high	56 Å²	56	85.4 Å²	85.4	46%	0.463	47%	0.465	S	S	.	.	H	α-helix	trans	-62.4	-44.4	178.8	0	0	0	0	0	111.7	A36 Q37 L42 Q43 H44	A36-A40 PolarHBondContact O-N 3.36Å; Q37-A40 PolarHBondContact O-N 3.15Å; A40-L42 PolarHBondContact O-N 2.99Å; A40-Q43 PolarHBondContact O-N 3.4Å; A40-H44 PolarHBondContact O-N 2.94Å
41	A	96.4	Very high	94.8	Very high	23 Å²	23	81.1 Å²	81.1	19%	0.19	45%	0.453	C	S	.	.	H	α-helix	trans	-60.9	-43.4	176	0	0	0	0	0	112	Q37 Q38 H44 A45 L63 I64	Q37-A41 PolarHBondContact O-N 3.01Å; Q38-A41 PolarHBondContact O-N 3.44Å; A41-H44 PolarHBondContact O-N 3.21Å; A41-A45 PolarHBondContact O-N 3.04Å; A41-L63 HydrophobicContact CB-CB 3.85Å; A41-L63 HydrophobicContact CB-CD1 4.06Å; A41-I64 HydrophobicContact CB-CG2 3.92Å
42	L	97.8	Very high	95.4	Very high	38 Å²	38	81.5 Å²	81.5	20%	0.199	45%	0.45	C	S	.	.	H	α-helix	trans	-62.8	-44.2	178.4	-171.3	68.3	0	0	0	112.1	Q38 K39 A40 A45 H46 F53 T55 I64	Q38-L42 WeakPolarHBondContact O-CB 3.45Å; Q38-L42 PolarHBondContact O-N 3.41Å; K39-L42 PolarHBondContact O-N 3Å; A40-L42 PolarHBondContact O-N 2.99Å; L42-A45 PolarHBondContact O-N 3.29Å; L42-H46 PolarHBondContact O-N 2.96Å; L42-F53 HydrophobicContact CD1-CB 3.53Å; L42-F53 WeakPolarHBondContact CD1-O 3.41Å; L42-T55 HydrophobicContact CD2-CG2 4.29Å; L42-I64 HydrophobicContact CB-CG2 4.09Å; L42-I64 HydrophobicContact CD1-CG2 4.24Å
43	Q	97.9	Very high	95.8	Very high	118 Å²	118	76.7 Å²	76.7	55%	0.551	43%	0.427	S	S	*	.	H	α-helix	trans	-61.8	-43.5	176.1	-73.5	177.8	-19.8	0	0	112	K39 A40 H46 A47	K39-Q43 WeakPolarHBondContact O-CG 3.45Å; K39-Q43 PolarHBondContact O-N 3.48Å; A40-Q43 PolarHBondContact O-N 3.4Å; Q43-H46 PolarHBondContact O-N 2.99Å; Q43-A47 WeakPolarHBondContact O-CB 3.39Å; Q43-A47 PolarHBondContact O-N 2.98Å
44	H	98.1	Very high	96.2	Very high	122 Å²	122	75.2 Å²	75.2	57%	0.565	42%	0.422	S	S	*	.	H	α-helix	trans	-62	-44.5	176.4	-174.3	-84.8	0	0	0	111.4	A40 A41 H46 A47 H48	A40-H44 PolarHBondContact O-N 2.94Å; A41-H44 PolarHBondContact O-N 3.21Å; H44-H46 PolarHBondContact O-N 2.95Å; H44-A47 PolarHBondContact O-N 3.4Å; H44-H48 AromaticContact CD2-CD2 3.83Å; H44-H48 AromaticContact CE1-CD2 3.63Å; H44-H48 AromaticContact ND1-CD2 3.89Å; H44-H48 AromaticContact NE2-CD2 3.61Å; H44-H48 AromaticContact NE2-NE2 3.71Å; H44-H48 WeakPolarHBondContact O-CB 3.35Å; H44-H48 PolarHBondContact O-CD2 3.01Å; H44-H48 VanDerWaalsContact O-CD2 3.24Å; H44-H48 PolarHBondContact O-N 3.5Å; H44-H48 VanDerWaalsContact O-N 3.13Å
45	A	97.9	Very high	96.6	Very high	10 Å²	10	75.4 Å²	75.4	8%	0.083	43%	0.426	C	S	.	.	H	α-helix	trans	-62	-44.7	177.9	0	0	0	0	0	112.5	A41 L42 A47 H48 S49 F53 I64	A41-A45 PolarHBondContact O-N 3.04Å; L42-A45 PolarHBondContact O-N 3.29Å; A45-A47 VanDerWaalsContact C-N 3.31Å; A45-A47 PolarHBondContact O-N 2.98Å; A45-H48 PolarHBondContact O-N 3.47Å; A45-S49 WeakPolarHBondContact O-CB 3.31Å; A45-S49 PolarHBondContact O-N 3.38Å; A45-F53 HydrophobicContact CB-CB 4.43Å; A45-F53 HydrophobicContact CB-CD1 4.05Å; A45-F53 HydrophobicContact CB-CD2 3.69Å; A45-F53 HydrophobicContact CB-CE1 4.2Å; A45-F53 HydrophobicContact CB-CE2 3.87Å; A45-F53 HydrophobicContact CB-CG 3.79Å; A45-F53 HydrophobicContact CB-CZ 4.12Å; A45-I64 HydrophobicContact CB-CD1 3.41Å; A45-I64 VanDerWaalsContact CB-CD1 3.41Å
46	H	97.5	Very high	96.7	Very high	103 Å²	103	75.5 Å²	75.5	48%	0.477	42%	0.419	S	S	.	.	H	α-helix	trans	-64.7	-32.8	176.1	-67.3	163.3	0	0	0	113.4	L42 Q43 H44 H48	L42-H46 PolarHBondContact O-N 2.96Å; Q43-H46 PolarHBondContact O-N 2.99Å; H44-H46 PolarHBondContact O-N 2.95Å; H46-H48 VanDerWaalsContact C-N 3.32Å
47	A	98.1	Very high	96.3	Very high	78 Å²	78	79.6 Å²	79.6	65%	0.645	43%	0.433	S	S	*	.	H	α-helix	trans	-72.4	-27.2	177.6	0	0	0	0	0	112.7	Q43 H44 A45	Q43-A47 WeakPolarHBondContact O-CB 3.39Å; Q43-A47 PolarHBondContact O-N 2.98Å; H44-A47 PolarHBondContact O-N 3.4Å; A45-A47 VanDerWaalsContact C-N 3.31Å; A45-A47 PolarHBondContact O-N 2.98Å
48	H	98.3	Very high	95.8	Very high	144 Å²	144	77.4 Å²	77.4	67%	0.667	43%	0.425	S	S	*	.	H	α-helix	trans	-111.9	-7.2	-172.2	-73.8	-79.6	0	0	0	114.6	H44 A45 H46	H44-H48 AromaticContact CD2-CD2 3.83Å; H44-H48 AromaticContact CE1-CD2 3.63Å; H44-H48 AromaticContact ND1-CD2 3.89Å; H44-H48 AromaticContact NE2-CD2 3.61Å; H44-H48 AromaticContact NE2-NE2 3.71Å; H44-H48 WeakPolarHBondContact O-CB 3.35Å; H44-H48 PolarHBondContact O-CD2 3.01Å; H44-H48 VanDerWaalsContact O-CD2 3.24Å; H44-H48 PolarHBondContact O-N 3.5Å; H44-H48 VanDerWaalsContact O-N 3.13Å; A45-H48 PolarHBondContact O-N 3.47Å; H46-H48 VanDerWaalsContact C-N 3.32Å
49	S	97.1	Very high	95.3	Very high	56 Å²	56	81.1 Å²	81.1	39%	0.392	46%	0.461	S	S	.	.			trans	-144.9	147.2	-177.3	-175.6	0	0	0	0	111.2	A45 G51	A45-S49 WeakPolarHBondContact O-CB 3.31Å; A45-S49 PolarHBondContact O-N 3.38Å; S49-G51 VanDerWaalsContact C-N 3.26Å; S49-G51 PolarHBondContact OG-N 3.26Å; S49-G51 VanDerWaalsContact OG-N 3.12Å
50	S	96.4	Very high	94.9	Very high	124 Å²	124	84 Å²	84	87%	0.867	47%	0.474	S	S	*	.	S	Bend	trans	-84.4	1.9	169.3	54.3	0	0	0	0	113.4
51	G	97.1	Very high	94.5	Very high	30 Å²	30	84 Å²	84	31%	0.309	48%	0.479	S	S	.	.	S	Bend	trans	-70	161.7	176.2	0	0	0	0	0	112.9	S49 F53	S49-G51 VanDerWaalsContact C-N 3.26Å; S49-G51 PolarHBondContact OG-N 3.26Å; S49-G51 VanDerWaalsContact OG-N 3.12Å; G51-F53 VanDerWaalsContact O-CD2 3.27Å; G51-F53 WeakPolarHBondContact O-CD2 3.44Å; G51-F53 WeakPolarHBondContact O-CE2 3.18Å
52	Y	97.4	Very high	94.4	Very high	143 Å²	143	87.2 Å²	87.2	56%	0.561	49%	0.493	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94	133.4	172.8	-62.6	-92.3	0	0	0	109.5	P66 V67 P69	Y52-P66 CarbonylContact O-C 3.58Å; Y52-P66 WeakPolarHBondContact O-CA 3.26Å; Y52-V67 PolarHBondContact O-N 3.36Å; Y52-P69 HydrophobicContact CD1-CG 3.75Å; Y52-P69 VanDerWaalsContact CD2-CD 3.43Å; Y52-P69 HydrophobicContact CD2-CG 3.32Å; Y52-P69 HydrophobicContact CE1-CG 3.67Å; Y52-P69 HydrophobicContact CE2-CG 3.24Å; Y52-P69 HydrophobicContact CG-CG 3.57Å; Y52-P69 VanDerWaalsContact CZ-CG 3.41Å
53	F	97.3	Very high	94.3	Very high	42 Å²	42	87.8 Å²	87.8	18%	0.184	50%	0.496	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130	148.9	-178.3	-61.5	-91.1	0	0	0	110.1	L42 A45 G51 I64 L65 P66	L42-F53 HydrophobicContact CD1-CB 3.53Å; L42-F53 WeakPolarHBondContact CD1-O 3.41Å; A45-F53 HydrophobicContact CB-CB 4.43Å; A45-F53 HydrophobicContact CB-CD1 4.05Å; A45-F53 HydrophobicContact CB-CD2 3.69Å; A45-F53 HydrophobicContact CB-CE1 4.2Å; A45-F53 HydrophobicContact CB-CE2 3.87Å; A45-F53 HydrophobicContact CB-CG 3.79Å; A45-F53 HydrophobicContact CB-CZ 4.12Å; G51-F53 VanDerWaalsContact O-CD2 3.27Å; G51-F53 WeakPolarHBondContact O-CD2 3.44Å; G51-F53 WeakPolarHBondContact O-CE2 3.18Å; F53-I64 HydrophobicContact CB-CD1 4.36Å; F53-I64 HydrophobicContact CD1-CD1 3.83Å; F53-I64 HydrophobicContact CD1-CG1 4.46Å; F53-I64 HydrophobicContact CE1-CD1 4.47Å; F53-I64 HydrophobicContact CG-CD1 4.25Å; F53-L65 VanDerWaalsContact CA-O 3.3Å; F53-L65 WeakPolarHBondContact CA-O 3.42Å; F53-P66 HydrophobicContact CD1-CB 4.22Å; F53-P66 HydrophobicContact CE1-CB 3.97Å
54	I	96.2	Very high	94.2	Very high	87 Å²	87	84 Å²	84	45%	0.446	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	155.7	171.4	60.2	171	0	0	0	109.6	I64 L65 V67	I54-I64 CarbonylContact O-C 3.51Å; I54-I64 WeakPolarHBondContact O-CA 3.39Å; I54-I64 WeakPolarHBondContact O-CB 3.42Å; I54-L65 HydrophobicContact CG1-CB 4.29Å; I54-L65 PolarHBondContact N-O 3.36Å; I54-L65 PolarHBondContact O-N 3.31Å; I54-V67 HydrophobicContact CD1-CG1 3.73Å; I54-V67 HydrophobicContact CG1-CG1 3.72Å; I54-V67 HydrophobicContact CG2-CG2 3.95Å
55	T	96.4	Very high	94.1	Very high	69 Å²	69	81.2 Å²	81.2	42%	0.423	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.2	147	172.7	57.2	0	0	0	0	110.8	Q38 L42	Q38-T55 HydrophobicContact CB-CG2 3.7Å; L42-T55 HydrophobicContact CD2-CG2 4.29Å
56	Q	92.9	Very high	94	Very high	50 Å²	50	85.4 Å²	85.4	23%	0.234	50%	0.495	C	S	.	.			trans	-134.8	134.3	176.1	-169.6	-167	-3.6	0	0	110.5	Q38 S58 L63 L65	Q38-Q56 PolarHBondContact NE2-O 3.37Å; Q56-S58 PolarHBondContact O-N 3.07Å; Q56-L63 PolarHBondContact N-O 3.07Å; Q56-L65 HydrophobicContact CB-CD1 3.93Å; Q56-L65 HydrophobicContact CB-CG 4.07Å; Q56-L65 HydrophobicContact CG-CD1 3.67Å; Q56-L65 HydrophobicContact CG-CG 4.21Å; Q56-L65 VanDerWaalsContact OE1-CD2 3.3Å
57	D	85.4	Confident	94	Very high	146 Å²	146	83 Å²	83	78%	0.781	49%	0.487	S	S	*	.			trans	-80	88.6	163.7	61.2	-44.2	0	0	0	109.8
58	S	85.4	Confident	93.9	Very high	31 Å²	31	86.8 Å²	86.8	22%	0.217	50%	0.495	C	S	.	.			trans	-112.6	129.8	177.1	-172.4	0	0	0	0	112	Q56 F60 G61 N62	Q56-S58 PolarHBondContact O-N 3.07Å; S58-F60 PolarHBondContact O-N 3.32Å; S58-F60 PolarHBondContact OG-N 2.86Å; S58-G61 PolarHBondContact O-N 2.93Å; S58-N62 WeakPolarHBondContact CB-O 3.31Å
59	A	84.8	Confident	93.6	Very high	104 Å²	104	82.8 Å²	82.8	86%	0.86	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.3	-12.5	171.2	0	0	0	0	0	113.5
60	F	87.8	Confident	93.3	Very high	190 Å²	190	91.6 Å²	91.6	83%	0.833	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.6	7.1	-178.6	-60.5	-78.1	0	0	0	113.5	S58	S58-F60 PolarHBondContact O-N 3.32Å; S58-F60 PolarHBondContact OG-N 2.86Å
61	G	88.3	Confident	93	Very high	56 Å²	56	93.1 Å²	93.1	58%	0.577	51%	0.505	S	S	*	.	S	Bend	trans	84.9	5.6	179.4	0	0	0	0	0	115	S58 L63	S58-G61 PolarHBondContact O-N 2.93Å; G61-L63 PolarHBondContact O-N 2.86Å
62	N	94.3	Very high	92.6	Very high	90 Å²	90	99 Å²	99	48%	0.481	53%	0.529	S	S	.	.			trans	-76.9	107.5	170.8	-65.8	-26.5	0	0	0	109.8	S58	S58-N62 WeakPolarHBondContact CB-O 3.31Å
63	L	95.2	Very high	91.9	Very high	51 Å²	51	98 Å²	98	27%	0.267	54%	0.54	S	S	.	.			trans	-84.8	-23.3	-176.9	-60	177.7	0	0	0	113.2	Q37 Q38 A41 Q56 G61	Q37-L63 HydrophobicContact CB-CD1 4.03Å; Q37-L63 HydrophobicContact CB-CD2 4.37Å; Q38-L63 HydrophobicContact CG-CB 4.41Å; Q38-L63 HydrophobicContact CG-CD2 4.41Å; A41-L63 HydrophobicContact CB-CB 3.85Å; A41-L63 HydrophobicContact CB-CD1 4.06Å; Q56-L63 PolarHBondContact N-O 3.07Å; G61-L63 PolarHBondContact O-N 2.86Å
64	I	96.6	Very high	90.8	Very high	37 Å²	37	109 Å²	109	19%	0.19	59%	0.592	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-141.6	156.3	-179.2	60.9	171.7	0	0	0	111	A41 L42 A45 F53 I54	A41-I64 HydrophobicContact CB-CG2 3.92Å; L42-I64 HydrophobicContact CB-CG2 4.09Å; L42-I64 HydrophobicContact CD1-CG2 4.24Å; A45-I64 HydrophobicContact CB-CD1 3.41Å; A45-I64 VanDerWaalsContact CB-CD1 3.41Å; F53-I64 HydrophobicContact CB-CD1 4.36Å; F53-I64 HydrophobicContact CD1-CD1 3.83Å; F53-I64 HydrophobicContact CD1-CG1 4.46Å; F53-I64 HydrophobicContact CE1-CD1 4.47Å; F53-I64 HydrophobicContact CG-CD1 4.25Å; I54-I64 CarbonylContact O-C 3.51Å; I54-I64 WeakPolarHBondContact O-CA 3.39Å; I54-I64 WeakPolarHBondContact O-CB 3.42Å
65	L	95.8	Very high	90.5	Very high	65 Å²	65	110.1 Å²	110.1	34%	0.34	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-122.2	136.3	173.7	-77.2	163.8	0	0	0	111	F53 I54 Q56	F53-L65 VanDerWaalsContact CA-O 3.3Å; F53-L65 WeakPolarHBondContact CA-O 3.42Å; I54-L65 HydrophobicContact CG1-CB 4.29Å; I54-L65 PolarHBondContact N-O 3.36Å; I54-L65 PolarHBondContact O-N 3.31Å; Q56-L65 HydrophobicContact CB-CD1 3.93Å; Q56-L65 HydrophobicContact CB-CG 4.07Å; Q56-L65 HydrophobicContact CG-CD1 3.67Å; Q56-L65 HydrophobicContact CG-CG 4.21Å; Q56-L65 VanDerWaalsContact OE1-CD2 3.3Å
66	P	95.9	Very high	90.2	Very high	98 Å²	98	112.3 Å²	112.3	64%	0.636	61%	0.608	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-68	137.7	164.7	30.1	-32.5	0	0	0	109.7	Y52 F53	Y52-P66 CarbonylContact O-C 3.58Å; Y52-P66 WeakPolarHBondContact O-CA 3.26Å; F53-P66 HydrophobicContact CD1-CB 4.22Å; F53-P66 HydrophobicContact CE1-CB 3.97Å
67	V	96.7	Very high	90.1	Very high	51 Å²	51	115.7 Å²	115.7	31%	0.309	63%	0.629	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-138.3	167.1	-178.9	-64.6	0	0	0	0	111.6	Y52 I54	Y52-V67 PolarHBondContact O-N 3.36Å; I54-V67 HydrophobicContact CD1-CG1 3.73Å; I54-V67 HydrophobicContact CG1-CG1 3.72Å; I54-V67 HydrophobicContact CG2-CG2 3.95Å
68	L	96.1	Very high	90.4	Very high	158 Å²	158	113.9 Å²	113.9	83%	0.827	62%	0.62	S	S	*	*	P	Polyproline II helix	trans	-101.2	137.7	166.8	-63.8	175.8	0	0	0	109.3
69	P	92.2	Very high	90.7	Very high	60 Å²	60	119.1 Å²	119.1	39%	0.39	65%	0.646	S	S	.	*	P	Polyproline II helix	trans	-56.9	141	171.7	-23.5	33.8	0	0	0	111.1	Y52	Y52-P69 HydrophobicContact CD1-CG 3.75Å; Y52-P69 VanDerWaalsContact CD2-CD 3.43Å; Y52-P69 HydrophobicContact CD2-CG 3.32Å; Y52-P69 HydrophobicContact CE1-CG 3.67Å; Y52-P69 HydrophobicContact CE2-CG 3.24Å; Y52-P69 HydrophobicContact CG-CG 3.57Å; Y52-P69 VanDerWaalsContact CZ-CG 3.41Å
70	R	91.9	Very high	91.1	Very high	241 Å²	241	120.1 Å²	120.1	91%	0.909	63%	0.631	S	S	*	*	P	Polyproline II helix	trans	-79.1	127.9	168.8	-61.5	-177.7	-177.5	-175.1	0.8	107.8
71	L	89.4	Confident	91.3	Very high	157 Å²	157	115.1 Å²	115.1	82%	0.822	62%	0.617	S	S	*	*	P	Polyproline II helix	trans	-98.1	128.9	170.9	-56.3	177.5	0	0	0	107.2
72	D	89	Confident	91.5	Very high	154 Å²	154	119.7 Å²	119.7	82%	0.824	62%	0.62	S	S	*	*	P	Polyproline II helix	trans	-68.9	134.6	170.1	-67	-62.9	0	0	0	108.9	E74	D72-E74 PolarHBondContact O-N 2.77Å
73	P	81.7	Confident	91.3	Very high	122 Å²	122	122.2 Å²	122.2	79%	0.792	63%	0.631	S	S	*	*	P	Polyproline II helix	trans	-67	130	170.6	26	-29.7	0	0	0	109.5
74	E	75.2	Confident	91	Very high	272 Å²	272	128.6 Å²	128.6	100%	1.271	67%	0.665	S	S	*	*			trans	-60	0	171.7	-89.7	-163.7	99.9	0	0	112.8	D72	D72-E74 PolarHBondContact O-N 2.77Å

Retrieved 74 of 74 residues in 61.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).