X6R9C8_HUMAN Loading...

Centromere protein P

AlphaFold DB , UniProt , Accession X6R9C8, Species HUMAN (Homo sapiens, Human), Gene CENPP, Length 102 aa.

						>X6R9C8_HUMAN|X6R9C8|CENPP
MQEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	79.8	Confident	88	Confident	68 Å²	68	77.9 Å²	77.9	34%	0.335	38%	0.383	S	S	.	.				0	-61.2	0	-72.3	-56	-179.3	0	0	112.3	E3 K4 Y5 M20 E86 L89 I93	M1-E3 PolarHBondContact O-N 2.7Å; M1-K4 PolarHBondContact O-N 3.29Å; M1-K4 VanDerWaalsContact O-N 3.08Å; M1-Y5 PolarHBondContact O-N 2.73Å; M1-M20 HydrophobicContact CB-SD 4.23Å; M1-E86 HydrophobicContact CE-CG 3.8Å; M1-L89 HydrophobicContact CE-CB 4.02Å; M1-I93 HydrophobicContact SD-CD1 4.08Å
2	Q	83.5	Confident	87.1	Confident	90 Å²	90	76.4 Å²	76.4	42%	0.421	39%	0.386	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.7	-45.3	178.2	-174.5	177.4	18.2	0	0	113.4	K4 Y5 P6 V9	Q2-K4 PolarHBondContact O-N 3.27Å; Q2-Y5 CarbonylContact O-C 3.59Å; Q2-Y5 PolarHBondContact O-N 3.36Å; Q2-Y5 VanDerWaalsContact O-N 3.17Å; Q2-P6 VanDerWaalsContact O-CA 3.24Å; Q2-P6 WeakPolarHBondContact O-CA 3.44Å; Q2-V9 HydrophobicContact CB-CG1 4.25Å
3	E	86.9	Confident	86.8	Confident	190 Å²	190	82.4 Å²	82.4	89%	0.888	41%	0.411	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.7	-33.2	176.4	-172.8	-178.7	170.1	0	0	113.1	M1	M1-E3 PolarHBondContact O-N 2.7Å
4	K	88.6	Confident	86.2	Confident	114 Å²	114	78.4 Å²	78.4	50%	0.496	40%	0.401	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.1	-26.7	179.1	-171.3	178	173.1	-167.4	0	112.4	M1 Q2 E90	M1-K4 PolarHBondContact O-N 3.29Å; M1-K4 VanDerWaalsContact O-N 3.08Å; Q2-K4 PolarHBondContact O-N 3.27Å; K4-E90 IonicContact NZ-OE1 2.74Å; K4-E90 PolarHBondContact NZ-OE1 3.41Å; K4-E90 IonicContact NZ-OE2 2.7Å; K4-E90 PolarHBondContact NZ-OE2 3.09Å
5	Y	88.9	Confident	85.6	Confident	50 Å²	50	81.9 Å²	81.9	20%	0.196	43%	0.432	C	S	.	.			trans	-139.3	62	-174.8	-62.8	-72.3	0	0	0	111.5	M1 Q2 D7 A8 V9 E90 I93	M1-Y5 PolarHBondContact O-N 2.73Å; Q2-Y5 CarbonylContact O-C 3.59Å; Q2-Y5 PolarHBondContact O-N 3.36Å; Q2-Y5 VanDerWaalsContact O-N 3.17Å; Y5-D7 VanDerWaalsContact C-N 3.25Å; Y5-D7 PolarHBondContact O-N 2.7Å; Y5-A8 PolarHBondContact O-N 3.06Å; Y5-V9 WeakPolarHBondContact O-CB 3.47Å; Y5-V9 PolarHBondContact O-N 3.49Å; Y5-E90 WeakPolarHBondContact CE2-OE2 3.32Å; Y5-E90 VanDerWaalsContact OH-CD 3.27Å; Y5-E90 PolarHBondContact OH-OE1 3.29Å; Y5-E90 PolarHBondContact OH-OE2 3.45Å; Y5-I93 HydrophobicContact CD1-CG2 3.79Å; Y5-I93 HydrophobicContact CD2-CD1 3.78Å; Y5-I93 HydrophobicContact CD2-CG2 3.95Å; Y5-I93 HydrophobicContact CE1-CG2 3.97Å; Y5-I93 HydrophobicContact CE2-CD1 4.07Å; Y5-I93 HydrophobicContact CE2-CG2 4.1Å; Y5-I93 HydrophobicContact CG-CG2 3.78Å
6	P	88.8	Confident	85.1	Confident	83 Å²	83	84.3 Å²	84.3	54%	0.539	46%	0.457	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.9	-28.3	-170.2	25.3	-34.9	0	0	0	113.6	Q2	Q2-P6 VanDerWaalsContact O-CA 3.24Å; Q2-P6 WeakPolarHBondContact O-CA 3.44Å
7	D	88.4	Confident	85	Confident	139 Å²	139	79.6 Å²	79.6	74%	0.743	43%	0.432	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.9	-28.6	-179.2	-58.9	-47.9	0	0	0	112.9	Y5	Y5-D7 VanDerWaalsContact C-N 3.25Å; Y5-D7 PolarHBondContact O-N 2.7Å
8	A	89.8	Confident	85.1	Confident	11 Å²	11	79.3 Å²	79.3	9%	0.091	44%	0.436	C	S	.	.	T	Hydrogen-bonded Turn	trans	-97.7	-33.6	-175.3	0	0	0	0	0	113.2	Y5 I22 R23 C97	Y5-A8 PolarHBondContact O-N 3.06Å; A8-I22 CarbonylContact O-C 3.18Å; A8-I22 VanDerWaalsContact O-CA 3.28Å; A8-I22 WeakPolarHBondContact O-CA 3.35Å; A8-R23 VanDerWaalsContact CA-O 3.25Å; A8-R23 WeakPolarHBondContact CA-O 3.47Å; A8-R23 WeakPolarHBondContact CB-O 3.37Å; A8-R23 PolarHBondContact O-N 3.17Å; A8-C97 HydrophobicContact CB-CB 4.48Å; A8-C97 WeakPolarHBondContact CB-SG 3.3Å
9	V	92.5	Very high	85.4	Confident	1 Å²	1	76.2 Å²	76.2	1%	0.006	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	133.9	-171.2	176.5	0	0	0	0	110.5	Q2 Y5 M20 G21 I22 I93	Q2-V9 HydrophobicContact CB-CG1 4.25Å; Y5-V9 WeakPolarHBondContact O-CB 3.47Å; Y5-V9 PolarHBondContact O-N 3.49Å; V9-M20 HydrophobicContact CG1-CE 4.46Å; V9-M20 HydrophobicContact CG1-CG 3.58Å; V9-M20 HydrophobicContact CG1-SD 3.33Å; V9-M20 WeakPolarHBondContact CG1-SD 3.3Å; V9-G21 WeakPolarHBondContact CA-O 3.37Å; V9-I22 HydrophobicContact CG2-CG1 4.43Å; V9-I93 HydrophobicContact CG2-CD1 3.68Å; V9-I93 HydrophobicContact CG2-CG1 4.01Å
10	Y	91.1	Very high	85.8	Confident	65 Å²	65	73 Å²	73	26%	0.255	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.9	152.1	175.1	75.1	-84.9	0	0	0	111.9	M20 G21 E31	Y10-M20 WeakPolarHBondContact O-CA 3.26Å; Y10-G21 PolarHBondContact N-O 3.15Å; Y10-G21 PolarHBondContact O-N 3.19Å; Y10-E31 VanDerWaalsContact CZ-OE1 3.31Å; Y10-E31 PolarHBondContact OH-OE1 3.44Å
11	L	89.7	Confident	86.2	Confident	46 Å²	46	69.5 Å²	69.5	24%	0.241	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	123.8	175.8	-63.5	178.7	0	0	0	109.1	E13 G14 M20 W36	L11-E13 VanDerWaalsContact C-N 3.28Å; L11-E13 PolarHBondContact O-N 3.13Å; L11-G14 WeakPolarHBondContact CD1-O 3.35Å; L11-M20 HydrophobicContact CD2-CB 3.95Å; L11-M20 HydrophobicContact CD2-CG 4.03Å; L11-W36 HydrophobicContact CD2-CH2 4.25Å
12	S	77.3	Confident	86.8	Confident	60 Å²	60	66.2 Å²	66.2	42%	0.42	37%	0.367	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61	-36.5	-174.7	-51.4	0	0	0	0	112.8	S19	S12-S19 PolarHBondContact OG-OG 3.17Å; S12-S19 VanDerWaalsContact OG-OG 3.12Å
13	E	83.4	Confident	87.2	Confident	154 Å²	154	68.2 Å²	68.2	72%	0.72	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	-127.6	25.2	-177	-59.1	-178.3	168.4	0	0	112.5	L11	L11-E13 VanDerWaalsContact C-N 3.28Å; L11-E13 PolarHBondContact O-N 3.13Å
14	G	78.6	Confident	87.2	Confident	26 Å²	26	59.7 Å²	59.7	27%	0.268	33%	0.332	S	S	.	.	G	3₁₀ helix	trans	74	-159.2	-177.4	0	0	0	0	0	113.9	L11 S16 S17	L11-G14 WeakPolarHBondContact CD1-O 3.35Å; G14-S16 PolarHBondContact O-N 3.07Å; G14-S16 VanDerWaalsContact O-N 3.11Å; G14-S17 WeakPolarHBondContact O-CB 3.32Å; G14-S17 PolarHBondContact O-N 3.19Å
15	P	76	Confident	86.8	Confident	132 Å²	132	59.1 Å²	59.1	86%	0.857	35%	0.349	S	S	*	.	G	3₁₀ helix	trans	-61.5	-23.6	-169	-25.3	34.8	0	0	0	115.5
16	S	78.2	Confident	86.5	Confident	120 Å²	120	60.7 Å²	60.7	84%	0.839	37%	0.367	S	S	*	.	G	3₁₀ helix	trans	-92.7	3.4	179	-56.8	0	0	0	0	113.7	G14	G14-S16 PolarHBondContact O-N 3.07Å; G14-S16 VanDerWaalsContact O-N 3.11Å
17	S	83.8	Confident	86.1	Confident	5 Å²	5	62.1 Å²	62.1	4%	0.035	36%	0.361	C	S	.	.			trans	-56.7	151.2	178.7	-172.4	0	0	0	0	111.6	G14 S19 W36	G14-S17 WeakPolarHBondContact O-CB 3.32Å; G14-S17 PolarHBondContact O-N 3.19Å; S17-S19 WeakPolarHBondContact CB-O 3.14Å; S17-S19 PolarHBondContact OG-N 3.24Å; S17-S19 VanDerWaalsContact OG-N 3.09Å; S17-S19 PolarHBondContact OG-O 3.3Å; S17-S19 PolarHBondContact OG-OG 2.88Å; S17-W36 WeakPolarHBondContact O-CZ2 3.28Å; S17-W36 PolarHBondContact O-NE1 2.82Å
18	C	86.8	Confident	85.7	Confident	74 Å²	74	60.9 Å²	60.9	50%	0.5	36%	0.361	S	S	.	.	S	Bend	trans	-98.4	6.6	167.5	64	0	0	0	0	112.6	V35 W36	C18-V35 WeakPolarHBondContact O-CA 3.27Å; C18-W36 VanDerWaalsContact O-CD2 3.29Å; C18-W36 PolarHBondContact O-N 3.03Å
19	S	91.5	Very high	85.4	Confident	19 Å²	19	62.9 Å²	62.9	13%	0.133	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.1	152.4	179.7	64	0	0	0	0	113.4	S12 S17 I34 W36	S12-S19 PolarHBondContact OG-OG 3.17Å; S12-S19 VanDerWaalsContact OG-OG 3.12Å; S17-S19 WeakPolarHBondContact CB-O 3.14Å; S17-S19 PolarHBondContact OG-N 3.24Å; S17-S19 VanDerWaalsContact OG-N 3.09Å; S17-S19 PolarHBondContact OG-O 3.3Å; S17-S19 PolarHBondContact OG-OG 2.88Å; S19-I34 CarbonylContact C-O 3.6Å; S19-I34 WeakPolarHBondContact CA-O 3.43Å; S19-W36 VanDerWaalsContact CA-CZ3 3.49Å; S19-W36 WeakPolarHBondContact O-CH2 3.41Å
20	M	92.9	Very high	85.2	Confident	12 Å²	12	65.1 Å²	65.1	6%	0.059	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.9	127.2	175.8	179.2	177.3	72.7	0	0	108.9	M1 V9 Y10 L11 I34 W36 L89	M1-M20 HydrophobicContact CB-SD 4.23Å; V9-M20 HydrophobicContact CG1-CE 4.46Å; V9-M20 HydrophobicContact CG1-CG 3.58Å; V9-M20 HydrophobicContact CG1-SD 3.33Å; V9-M20 WeakPolarHBondContact CG1-SD 3.3Å; Y10-M20 WeakPolarHBondContact O-CA 3.26Å; L11-M20 HydrophobicContact CD2-CB 3.95Å; L11-M20 HydrophobicContact CD2-CG 4.03Å; M20-I34 HydrophobicContact CE-CD1 3.52Å; M20-I34 PolarHBondContact N-O 3.04Å; M20-I34 PolarHBondContact O-N 2.93Å; M20-W36 HydrophobicContact CB-CH2 3.9Å; M20-W36 HydrophobicContact CB-CZ3 3.59Å; M20-W36 VanDerWaalsContact N-CZ3 3.32Å; M20-L89 HydrophobicContact CE-CD1 4.3Å; M20-L89 HydrophobicContact CE-CD2 4.04Å
21	G	93.1	Very high	85.3	Confident	0 Å²	0	63 Å²	63	0%	0	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92	142	173.5	0	0	0	0	0	111.3	V9 Y10 L32	V9-G21 WeakPolarHBondContact CA-O 3.37Å; Y10-G21 PolarHBondContact N-O 3.15Å; Y10-G21 PolarHBondContact O-N 3.19Å; G21-L32 CarbonylContact C-O 3.5Å
22	I	93.4	Very high	85.4	Confident	0 Å²	0	61.5 Å²	61.5	0%	0	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	124.9	168.7	-46.4	172.4	0	0	0	107.5	A8 V9 L32 I34 L92 I93 L96	A8-I22 CarbonylContact O-C 3.18Å; A8-I22 VanDerWaalsContact O-CA 3.28Å; A8-I22 WeakPolarHBondContact O-CA 3.35Å; V9-I22 HydrophobicContact CG2-CG1 4.43Å; I22-L32 HydrophobicContact CB-CB 4.31Å; I22-L32 PolarHBondContact N-O 3.37Å; I22-L32 PolarHBondContact O-N 2.92Å; I22-I34 HydrophobicContact CD1-CD1 3.41Å; I22-I34 VanDerWaalsContact CD1-CD1 3.41Å; I22-I34 HydrophobicContact CG1-CD1 4Å; I22-L92 HydrophobicContact CD1-CB 4.37Å; I22-I93 HydrophobicContact CD1-CG1 3.67Å; I22-I93 HydrophobicContact CG1-CG1 4.27Å; I22-I93 HydrophobicContact CG2-CG1 4.02Å; I22-L96 HydrophobicContact CB-CD2 4.23Å; I22-L96 HydrophobicContact CG2-CD2 3.84Å; I22-L96 WeakPolarHBondContact O-CD2 3.39Å
23	R	91.7	Very high	86.2	Confident	132 Å²	132	59.8 Å²	59.8	50%	0.498	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	154.2	177.6	64.6	-175.8	-175.8	-173.7	0.9	109.8	A8	A8-R23 VanDerWaalsContact CA-O 3.25Å; A8-R23 WeakPolarHBondContact CA-O 3.47Å; A8-R23 WeakPolarHBondContact CB-O 3.37Å; A8-R23 PolarHBondContact O-N 3.17Å
24	S	86.2	Confident	86.8	Confident	11 Å²	11	52.6 Å²	52.6	8%	0.077	33%	0.33	C	S	.	.			trans	-112	135.5	170.6	177.4	0	0	0	0	110.3	S26 R27 L96	S24-S26 PolarHBondContact O-N 3.14Å; S24-S26 PolarHBondContact OG-N 2.9Å; S24-S26 PolarHBondContact OG-OG 2.8Å; S24-R27 CarbonylContact O-C 3.51Å; S24-R27 PolarHBondContact O-N 2.86Å; S24-L96 VanDerWaalsContact CB-O 3.26Å; S24-L96 WeakPolarHBondContact CB-O 3.33Å; S24-L96 PolarHBondContact OG-O 3.11Å
25	A	81.4	Confident	87.4	Confident	102 Å²	102	53.4 Å²	53.4	84%	0.843	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.7	-29.6	173.3	0	0	0	0	0	112	R27	A25-R27 VanDerWaalsContact C-N 3.3Å; A25-R27 PolarHBondContact O-N 2.85Å
26	S	81.6	Confident	88.1	Confident	82 Å²	82	51.4 Å²	51.4	57%	0.573	31%	0.305	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.8	-16.7	178.9	64.5	0	0	0	0	113.7	S24	S24-S26 PolarHBondContact O-N 3.14Å; S24-S26 PolarHBondContact OG-N 2.9Å; S24-S26 PolarHBondContact OG-OG 2.8Å
27	R	80.6	Confident	88.6	Confident	114 Å²	114	53 Å²	53	43%	0.43	29%	0.292	S	S	.	.	S	Bend	trans	-130.8	68.5	-175.4	-63.5	179.5	-179.3	-179.1	1.5	110.8	S24 A25 G29 F30 E100	S24-R27 CarbonylContact O-C 3.51Å; S24-R27 PolarHBondContact O-N 2.86Å; A25-R27 VanDerWaalsContact C-N 3.3Å; A25-R27 PolarHBondContact O-N 2.85Å; R27-G29 PolarHBondContact O-N 3.49Å; R27-F30 HydrophobicContact CB-CB 4.24Å; R27-F30 PolarHBondContact O-N 2.77Å; R27-F30 VanDerWaalsContact O-N 3.17Å; R27-E100 IonicContact NH2-OE1 3.58Å; R27-E100 PolarHBondContact NH2-OE1 3.32Å
28	P	80.1	Confident	88.8	Confident	113 Å²	113	58.5 Å²	58.5	73%	0.734	32%	0.32	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.9	136	-178.2	25.6	-33.7	0	0	0	111.1	F30	P28-F30 VanDerWaalsContact C-N 3.3Å; P28-F30 PolarHBondContact O-N 3.14Å
29	G	84.4	Confident	88.7	Confident	52 Å²	52	58.3 Å²	58.3	54%	0.536	31%	0.312	S	S	.	.	T	Hydrogen-bonded Turn	trans	86.6	-9.6	-178.1	0	0	0	0	0	114.9	R27 P57	R27-G29 PolarHBondContact O-N 3.49Å; G29-P57 WeakPolarHBondContact O-CD 3.49Å
30	F	88.1	Confident	88.6	Confident	49 Å²	49	63 Å²	63	22%	0.215	33%	0.334	C	S	.	.			trans	-94	126.5	167.8	-161.4	-76.5	0	0	0	110.1	R27 P28 L32 V56 I69 L96	R27-F30 HydrophobicContact CB-CB 4.24Å; R27-F30 PolarHBondContact O-N 2.77Å; R27-F30 VanDerWaalsContact O-N 3.17Å; P28-F30 VanDerWaalsContact C-N 3.3Å; P28-F30 PolarHBondContact O-N 3.14Å; F30-L32 HydrophobicContact CE1-CD2 3.81Å; F30-L32 HydrophobicContact CE1-CG 4.12Å; F30-L32 HydrophobicContact CZ-CD2 4.5Å; F30-V56 HydrophobicContact CD2-CB 4.12Å; F30-V56 HydrophobicContact CD2-CG1 3.48Å; F30-V56 VanDerWaalsContact CD2-CG1 3.48Å; F30-V56 HydrophobicContact CE1-CG1 4.4Å; F30-V56 HydrophobicContact CE2-CB 4.17Å; F30-V56 HydrophobicContact CE2-CG1 3.21Å; F30-V56 HydrophobicContact CG-CG1 4.2Å; F30-V56 HydrophobicContact CZ-CG1 3.72Å; F30-I69 HydrophobicContact CE2-CD1 3.72Å; F30-I69 HydrophobicContact CZ-CD1 3.77Å; F30-L96 HydrophobicContact CD1-CD1 3.53Å; F30-L96 HydrophobicContact CE1-CD1 3.76Å
31	E	91.8	Very high	88.5	Confident	20 Å²	20	65.1 Å²	65.1	9%	0.093	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-147.3	136.1	-173.5	-171.3	-173.7	164.4	0	0	110.9	Y10 V33 K55	Y10-E31 VanDerWaalsContact CZ-OE1 3.31Å; Y10-E31 PolarHBondContact OH-OE1 3.44Å; E31-V33 HydrophobicContact CG-CG2 4.16Å; E31-K55 HydrophobicContact CB-CB 4.16Å; E31-K55 HydrophobicContact CB-CD 4.46Å; E31-K55 PolarHBondContact N-O 3.48Å; E31-K55 PolarHBondContact O-N 2.84Å; E31-K55 WeakPolarHBondContact OE2-CD 3.47Å; E31-K55 IonicContact OE2-NZ 2.7Å; E31-K55 PolarHBondContact OE2-NZ 2.44Å
32	L	93.2	Very high	88.5	Confident	15 Å²	15	74.7 Å²	74.7	8%	0.079	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	119.5	174	-64.7	-175.6	0	0	0	108.3	G21 I22 F30 L52 T54 L92 L96	G21-L32 CarbonylContact C-O 3.5Å; I22-L32 HydrophobicContact CB-CB 4.31Å; I22-L32 PolarHBondContact N-O 3.37Å; I22-L32 PolarHBondContact O-N 2.92Å; F30-L32 HydrophobicContact CE1-CD2 3.81Å; F30-L32 HydrophobicContact CE1-CG 4.12Å; F30-L32 HydrophobicContact CZ-CD2 4.5Å; L32-L52 HydrophobicContact CB-CD1 3.84Å; L32-L52 HydrophobicContact CD2-CD1 4.23Å; L32-L52 HydrophobicContact CD2-CD2 4.47Å; L32-L52 HydrophobicContact CG-CD1 4.49Å; L32-T54 HydrophobicContact CD2-CG2 3.76Å; L32-L92 HydrophobicContact CD1-CD2 4.14Å; L32-L96 HydrophobicContact CB-CD2 4.43Å; L32-L96 HydrophobicContact CD1-CB 4.46Å; L32-L96 HydrophobicContact CD1-CD2 4.06Å; L32-L96 HydrophobicContact CG-CD2 4Å
33	V	94.4	Very high	88.5	Confident	24 Å²	24	82 Å²	82	15%	0.145	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	113.7	-180	-176	0	0	0	0	108.9	E31 V35 L53	E31-V33 HydrophobicContact CG-CG2 4.16Å; V33-V35 HydrophobicContact CG1-CG1 4.26Å; V33-L53 HydrophobicContact CB-CB 4.25Å; V33-L53 PolarHBondContact N-O 2.85Å; V33-L53 PolarHBondContact O-N 3.38Å
34	I	94.1	Very high	88.4	Confident	2 Å²	2	78.1 Å²	78.1	1%	0.01	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	127	173.6	-63.3	140.3	0	0	0	107.8	S19 M20 I22 W36 L50 D51 L52 F76 L89	S19-I34 CarbonylContact C-O 3.6Å; S19-I34 WeakPolarHBondContact CA-O 3.43Å; M20-I34 HydrophobicContact CE-CD1 3.52Å; M20-I34 PolarHBondContact N-O 3.04Å; M20-I34 PolarHBondContact O-N 2.93Å; I22-I34 HydrophobicContact CD1-CD1 3.41Å; I22-I34 VanDerWaalsContact CD1-CD1 3.41Å; I22-I34 HydrophobicContact CG1-CD1 4Å; I34-W36 HydrophobicContact CG2-CE3 4.35Å; I34-L50 HydrophobicContact CG2-CD2 4.27Å; I34-D51 WeakPolarHBondContact CA-O 3.47Å; I34-L52 HydrophobicContact CG1-CD1 4.24Å; I34-F76 HydrophobicContact CG1-CZ 4.26Å; I34-F76 HydrophobicContact CG2-CE1 4.41Å; I34-F76 HydrophobicContact CG2-CZ 4.32Å; I34-L89 HydrophobicContact CD1-CD2 3.22Å; I34-L89 HydrophobicContact CG1-CD2 4.05Å; I34-L89 HydrophobicContact CG2-CD2 4.4Å
35	V	93.1	Very high	88.7	Confident	43 Å²	43	83.5 Å²	83.5	26%	0.261	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	139.3	175.1	-65	0	0	0	0	108.9	C18 V33 L50 D51 L53	C18-V35 WeakPolarHBondContact O-CA 3.27Å; V33-V35 HydrophobicContact CG1-CG1 4.26Å; V35-L50 CarbonylContact O-C 3.53Å; V35-L50 WeakPolarHBondContact O-CA 3.47Å; V35-D51 HydrophobicContact CG2-CB 3.83Å; V35-D51 PolarHBondContact N-O 2.86Å; V35-D51 PolarHBondContact O-N 3.41Å; V35-L53 HydrophobicContact CG1-CD1 4.03Å
36	W	90.8	Very high	89	Confident	90 Å²	90	82.8 Å²	82.8	34%	0.341	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	144.8	174.3	58.4	91.5	0	0	0	111.6	L11 S17 C18 S19 M20 I34 K49 L50	L11-W36 HydrophobicContact CD2-CH2 4.25Å; S17-W36 WeakPolarHBondContact O-CZ2 3.28Å; S17-W36 PolarHBondContact O-NE1 2.82Å; C18-W36 VanDerWaalsContact O-CD2 3.29Å; C18-W36 PolarHBondContact O-N 3.03Å; S19-W36 VanDerWaalsContact CA-CZ3 3.49Å; S19-W36 WeakPolarHBondContact O-CH2 3.41Å; M20-W36 HydrophobicContact CB-CH2 3.9Å; M20-W36 HydrophobicContact CB-CZ3 3.59Å; M20-W36 VanDerWaalsContact N-CZ3 3.32Å; I34-W36 HydrophobicContact CG2-CE3 4.35Å; W36-K49 CarbonylContact C-O 3.57Å; W36-K49 VanDerWaalsContact CA-O 3.29Å; W36-K49 WeakPolarHBondContact CA-O 3.42Å; W36-L50 HydrophobicContact CB-CG 4.22Å
37	R	87.8	Confident	89.1	Confident	153 Å²	153	82.6 Å²	82.6	58%	0.577	43%	0.427	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-135.5	145.4	170.5	63.3	-178.9	-66.9	177.9	-1.3	109.7	Q39 K49	R37-Q39 HydrophobicContact CG-CG 4.11Å; R37-K49 HydrophobicContact CG-CB 3.95Å; R37-K49 PolarHBondContact N-O 3.33Å; R37-K49 PolarHBondContact O-N 2.84Å
38	I	87	Confident	89.2	Confident	121 Å²	121	81.3 Å²	81.3	62%	0.621	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.4	126.8	167.9	-58.7	178.2	0	0	0	106.8	V46	I38-V46 HydrophobicContact CG2-CG1 3.37Å
39	Q	84.9	Confident	89.5	Confident	70 Å²	70	80.5 Å²	80.5	33%	0.327	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	142	170.9	-61.5	-166.5	-66.6	0	0	108.7	R37 V46 F47 K49	R37-Q39 HydrophobicContact CG-CG 4.11Å; Q39-V46 CarbonylContact O-C 3.58Å; Q39-V46 WeakPolarHBondContact O-CA 3.28Å; Q39-F47 PolarHBondContact N-O 3.46Å; Q39-F47 PolarHBondContact O-N 3.48Å; Q39-K49 HydrophobicContact CG-CB 4.48Å
40	I	90.2	Very high	89.9	Confident	117 Å²	117	79.2 Å²	79.2	60%	0.6	40%	0.399	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118.6	126.8	173.4	-50.5	-178.7	0	0	0	105.5	K45 V46	I40-K45 WeakPolarHBondContact CA-O 3.41Å; I40-V46 HydrophobicContact CG1-CG2 4.28Å
41	D	90.4	Very high	90.1	Very high	58 Å²	58	79 Å²	79	31%	0.31	40%	0.4	S	S	.	.			trans	-81.8	179.5	174.8	72.1	6.9	0	0	0	111.7	D43 G44 K45 F47	D41-D43 PolarHBondContact O-N 2.83Å; D41-D43 WeakPolarHBondContact OD1-CA 3.35Å; D41-D43 PolarHBondContact OD1-N 3.43Å; D41-G44 PolarHBondContact O-N 2.83Å; D41-G44 PolarHBondContact OD1-N 3.26Å; D41-G44 VanDerWaalsContact OD1-N 3.1Å; D41-K45 PolarHBondContact N-O 2.85Å; D41-K45 WeakPolarHBondContact OD1-CA 3.26Å; D41-K45 VanDerWaalsContact OD1-CB 3.3Å; D41-K45 WeakPolarHBondContact OD1-CB 3.42Å; D41-K45 PolarHBondContact OD1-N 3.35Å; D41-K45 WeakPolarHBondContact OD2-CB 3.39Å; D41-F47 HydrophobicContact CB-CE2 4.13Å; D41-F47 VanDerWaalsContact OD2-CE2 3.29Å; D41-F47 WeakPolarHBondContact OD2-CE2 3.5Å
42	E	93.1	Very high	90.2	Very high	200 Å²	200	78.2 Å²	78.2	94%	0.935	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.8	-24.6	-179	-60.7	-175.5	164.3	0	0	112.7	G44	E42-G44 PolarHBondContact O-N 3.17Å
43	D	94.1	Very high	90.3	Very high	154 Å²	154	82.3 Å²	82.3	82%	0.824	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.3	2	176.1	-64	-47	0	0	0	112.6	D41 K45	D41-D43 PolarHBondContact O-N 2.83Å; D41-D43 WeakPolarHBondContact OD1-CA 3.35Å; D41-D43 PolarHBondContact OD1-N 3.43Å; D43-K45 VanDerWaalsContact C-N 3.28Å; D43-K45 PolarHBondContact O-N 2.96Å
44	G	89.9	Confident	90.2	Very high	50 Å²	50	83 Å²	83	52%	0.515	42%	0.423	S	S	.	.			trans	78	10.3	-177.8	0	0	0	0	0	113.8	D41 E42	D41-G44 PolarHBondContact O-N 2.83Å; D41-G44 PolarHBondContact OD1-N 3.26Å; D41-G44 VanDerWaalsContact OD1-N 3.1Å; E42-G44 PolarHBondContact O-N 3.17Å
45	K	90.9	Very high	90	Very high	124 Å²	124	88.8 Å²	88.8	54%	0.539	45%	0.448	S	S	.	.			trans	-77.8	130.4	178.8	-172.4	172.5	167.5	-163.5	0	110.3	I40 D41 D43 F47	I40-K45 WeakPolarHBondContact CA-O 3.41Å; D41-K45 PolarHBondContact N-O 2.85Å; D41-K45 WeakPolarHBondContact OD1-CA 3.26Å; D41-K45 VanDerWaalsContact OD1-CB 3.3Å; D41-K45 WeakPolarHBondContact OD1-CB 3.42Å; D41-K45 PolarHBondContact OD1-N 3.35Å; D41-K45 WeakPolarHBondContact OD2-CB 3.39Å; D43-K45 VanDerWaalsContact C-N 3.28Å; D43-K45 PolarHBondContact O-N 2.96Å; K45-F47 HydrophobicContact CB-CD2 4.47Å; K45-F47 HydrophobicContact CB-CE2 3.67Å; K45-F47 HydrophobicContact CB-CZ 4.05Å; K45-F47 HydrophobicContact CD-CE1 3.83Å; K45-F47 HydrophobicContact CD-CE2 3.76Å; K45-F47 HydrophobicContact CD-CZ 3.21Å; K45-F47 HydrophobicContact CG-CD2 4.24Å; K45-F47 HydrophobicContact CG-CE1 4.1Å; K45-F47 HydrophobicContact CG-CE2 3.51Å; K45-F47 HydrophobicContact CG-CZ 3.47Å; K45-F47 VanDerWaalsContact CG-CZ 3.47Å; K45-F47 VanDerWaalsContact O-CD2 3.31Å; K45-F47 WeakPolarHBondContact O-CD2 3.4Å; K45-F47 WeakPolarHBondContact O-CE2 3.44Å
46	V	88.4	Confident	89.8	Confident	87 Å²	87	88.2 Å²	88.2	53%	0.527	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	127.8	-176.8	-176.2	0	0	0	0	110.1	I38 Q39 I40	I38-V46 HydrophobicContact CG2-CG1 3.37Å; Q39-V46 CarbonylContact O-C 3.58Å; Q39-V46 WeakPolarHBondContact O-CA 3.28Å; I40-V46 HydrophobicContact CG1-CG2 4.28Å
47	F	83.4	Confident	89.7	Confident	78 Å²	78	86.6 Å²	86.6	34%	0.342	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	124.3	176.4	-56.7	-92.5	0	0	0	111	Q39 D41 K45 K49	Q39-F47 PolarHBondContact N-O 3.46Å; Q39-F47 PolarHBondContact O-N 3.48Å; D41-F47 HydrophobicContact CB-CE2 4.13Å; D41-F47 VanDerWaalsContact OD2-CE2 3.29Å; D41-F47 WeakPolarHBondContact OD2-CE2 3.5Å; K45-F47 HydrophobicContact CB-CD2 4.47Å; K45-F47 HydrophobicContact CB-CE2 3.67Å; K45-F47 HydrophobicContact CB-CZ 4.05Å; K45-F47 HydrophobicContact CD-CE1 3.83Å; K45-F47 HydrophobicContact CD-CE2 3.76Å; K45-F47 HydrophobicContact CD-CZ 3.21Å; K45-F47 HydrophobicContact CG-CD2 4.24Å; K45-F47 HydrophobicContact CG-CE1 4.1Å; K45-F47 HydrophobicContact CG-CE2 3.51Å; K45-F47 HydrophobicContact CG-CZ 3.47Å; K45-F47 VanDerWaalsContact CG-CZ 3.47Å; K45-F47 VanDerWaalsContact O-CD2 3.31Å; K45-F47 WeakPolarHBondContact O-CD2 3.4Å; K45-F47 WeakPolarHBondContact O-CE2 3.44Å; F47-K49 PolarHBondContact O-N 3.2Å
48	P	83.6	Confident	89.7	Confident	88 Å²	88	86.2 Å²	86.2	57%	0.571	45%	0.45	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75	123.8	167	30.9	-31	0	0	0	108.8	L50	P48-L50 HydrophobicContact CB-CD1 4.32Å
49	K	86.7	Confident	89.7	Confident	96 Å²	96	90.1 Å²	90.1	42%	0.417	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	119.7	170.5	-173.5	173.7	-176.6	177.9	0	108.9	W36 R37 Q39 F47	W36-K49 CarbonylContact C-O 3.57Å; W36-K49 VanDerWaalsContact CA-O 3.29Å; W36-K49 WeakPolarHBondContact CA-O 3.42Å; R37-K49 HydrophobicContact CG-CB 3.95Å; R37-K49 PolarHBondContact N-O 3.33Å; R37-K49 PolarHBondContact O-N 2.84Å; Q39-K49 HydrophobicContact CG-CB 4.48Å; F47-K49 PolarHBondContact O-N 3.2Å
50	L	91.6	Very high	89.7	Confident	24 Å²	24	88.5 Å²	88.5	13%	0.126	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	141.3	171.4	-74.4	75.3	0	0	0	108.9	I34 V35 W36 P48 F76 I85	I34-L50 HydrophobicContact CG2-CD2 4.27Å; V35-L50 CarbonylContact O-C 3.53Å; V35-L50 WeakPolarHBondContact O-CA 3.47Å; W36-L50 HydrophobicContact CB-CG 4.22Å; P48-L50 HydrophobicContact CB-CD1 4.32Å; L50-F76 HydrophobicContact CB-CE1 4.13Å; L50-F76 HydrophobicContact CD2-CZ 4.43Å; L50-I85 HydrophobicContact CD1-CD1 3.74Å; L50-I85 HydrophobicContact CD1-CG1 4.21Å; L50-I85 HydrophobicContact CD2-CD1 4.45Å; L50-I85 HydrophobicContact CD2-CG1 4.2Å; L50-I85 HydrophobicContact CD2-CG2 3.65Å
51	D	92.3	Very high	89.6	Confident	45 Å²	45	87.4 Å²	87.4	24%	0.241	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	166.3	169.2	-139.6	-20.9	0	0	0	110.2	I34 V35 R77	I34-D51 WeakPolarHBondContact CA-O 3.47Å; V35-D51 HydrophobicContact CG2-CB 3.83Å; V35-D51 PolarHBondContact N-O 2.86Å; V35-D51 PolarHBondContact O-N 3.41Å; D51-R77 IonicContact OD1-CZ 3.95Å; D51-R77 IonicContact OD1-NH1 3.04Å; D51-R77 PolarHBondContact OD1-NH1 3.37Å; D51-R77 IonicContact OD2-NH1 2.81Å; D51-R77 PolarHBondContact OD2-NH1 3.24Å
52	L	95.1	Very high	89.5	Confident	4 Å²	4	91 Å²	91	2%	0.021	47%	0.466	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	133	-179.2	171.7	69	0	0	0	109.8	L32 I34 A72 P73 F76	L32-L52 HydrophobicContact CB-CD1 3.84Å; L32-L52 HydrophobicContact CD2-CD1 4.23Å; L32-L52 HydrophobicContact CD2-CD2 4.47Å; L32-L52 HydrophobicContact CG-CD1 4.49Å; I34-L52 HydrophobicContact CG1-CD1 4.24Å; L52-A72 HydrophobicContact CD2-CB 4.1Å; L52-P73 WeakPolarHBondContact O-CB 3.29Å; L52-P73 VanDerWaalsContact O-CG 3.28Å; L52-P73 WeakPolarHBondContact O-CG 3.45Å; L52-F76 HydrophobicContact CB-CB 4Å; L52-F76 HydrophobicContact CB-CD1 3.51Å; L52-F76 HydrophobicContact CB-CE1 4.21Å; L52-F76 HydrophobicContact CB-CG 3.92Å; L52-F76 HydrophobicContact CD2-CB 3.8Å; L52-F76 HydrophobicContact CD2-CG 4.22Å
53	L	93.9	Very high	89.3	Confident	100 Å²	100	88 Å²	88	52%	0.524	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	131.8	169	-58.1	175.9	0	0	0	108.8	V33 V35	V33-L53 HydrophobicContact CB-CB 4.25Å; V33-L53 PolarHBondContact N-O 2.85Å; V33-L53 PolarHBondContact O-N 3.38Å; V35-L53 HydrophobicContact CG1-CD1 4.03Å
54	T	92.3	Very high	89	Confident	40 Å²	40	82.1 Å²	82.1	25%	0.245	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	125.2	176.3	48.4	0	0	0	0	109.3	L32 I69 A72	L32-T54 HydrophobicContact CD2-CG2 3.76Å; T54-I69 HydrophobicContact CG2-CG2 4.46Å; T54-I69 VanDerWaalsContact OG1-CG2 3.3Å; T54-I69 WeakPolarHBondContact OG1-CG2 3.49Å; T54-I69 PolarHBondContact OG1-O 2.87Å; T54-I69 VanDerWaalsContact OG1-O 3.14Å; T54-A72 HydrophobicContact CG2-CB 3.62Å
55	K	91	Very high	88.9	Confident	123 Å²	123	88.8 Å²	88.8	54%	0.535	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	109.8	173.8	175.8	178.6	165.8	-155.5	0	107.6	E31	E31-K55 HydrophobicContact CB-CB 4.16Å; E31-K55 HydrophobicContact CB-CD 4.46Å; E31-K55 PolarHBondContact N-O 3.48Å; E31-K55 PolarHBondContact O-N 2.84Å; E31-K55 WeakPolarHBondContact OE2-CD 3.47Å; E31-K55 IonicContact OE2-NZ 2.7Å; E31-K55 PolarHBondContact OE2-NZ 2.44Å
56	V	89.7	Confident	88.7	Confident	31 Å²	31	89.7 Å²	89.7	19%	0.188	45%	0.449	C	S	.	.			trans	-131.9	150.8	-174.1	-55.3	0	0	0	0	110.3	F30 L61 I69	F30-V56 HydrophobicContact CD2-CB 4.12Å; F30-V56 HydrophobicContact CD2-CG1 3.48Å; F30-V56 VanDerWaalsContact CD2-CG1 3.48Å; F30-V56 HydrophobicContact CE1-CG1 4.4Å; F30-V56 HydrophobicContact CE2-CB 4.17Å; F30-V56 HydrophobicContact CE2-CG1 3.21Å; F30-V56 HydrophobicContact CG-CG1 4.2Å; F30-V56 HydrophobicContact CZ-CG1 3.72Å; V56-L61 HydrophobicContact CG2-CB 4.26Å; V56-I69 HydrophobicContact CG1-CD1 3.84Å; V56-I69 HydrophobicContact CG1-CG1 4.31Å; V56-I69 HydrophobicContact CG1-CG2 4.16Å; V56-I69 HydrophobicContact CG2-CG1 4.34Å; V56-I69 HydrophobicContact CG2-CG2 3.85Å
57	P	88.3	Confident	88.7	Confident	56 Å²	56	92.4 Å²	92.4	36%	0.364	45%	0.45	S	S	.	.			trans	-62.9	143.9	172.5	-20.1	33.8	0	0	0	110.5	G29 R59 A60 L61	G29-P57 WeakPolarHBondContact O-CD 3.49Å; P57-R59 PolarHBondContact O-N 3.45Å; P57-R59 VanDerWaalsContact O-N 3.17Å; P57-A60 WeakPolarHBondContact O-CA 3.3Å; P57-A60 WeakPolarHBondContact O-CB 3.2Å; P57-A60 PolarHBondContact O-N 2.81Å; P57-L61 PolarHBondContact O-N 2.74Å
58	Q	87.6	Confident	89	Confident	144 Å²	144	91.1 Å²	91.1	67%	0.673	45%	0.454	S	S	*	.	H	α-helix	trans	-54.2	-40.1	-179.1	-177	179.3	-16.4	0	0	113	A60 L61 E62	Q58-A60 VanDerWaalsContact C-N 3.26Å; Q58-A60 PolarHBondContact O-N 3.13Å; Q58-L61 WeakPolarHBondContact O-CB 3.03Å; Q58-L61 PolarHBondContact O-N 2.89Å; Q58-E62 PolarHBondContact O-N 3.32Å
59	R	86.9	Confident	89.3	Confident	203 Å²	203	88.1 Å²	88.1	77%	0.766	43%	0.433	S	S	*	.	H	α-helix	trans	-60.3	-34.8	175.8	-65.5	-178.4	-176.4	169.1	0.9	112.8	P57 L61 E62 L63	P57-R59 PolarHBondContact O-N 3.45Å; P57-R59 VanDerWaalsContact O-N 3.17Å; R59-L61 VanDerWaalsContact C-N 3.35Å; R59-E62 PolarHBondContact O-N 3.38Å; R59-L63 VanDerWaalsContact O-CG 3.32Å; R59-L63 WeakPolarHBondContact O-CG 3.25Å; R59-L63 PolarHBondContact O-N 3.38Å
60	A	85.4	Confident	89.4	Confident	37 Å²	37	89.2 Å²	89.2	31%	0.306	44%	0.439	S	S	.	.	H	α-helix	trans	-71.9	-32.9	176.6	0	0	0	0	0	111.5	P57 Q58 L63 D64	P57-A60 WeakPolarHBondContact O-CA 3.3Å; P57-A60 WeakPolarHBondContact O-CB 3.2Å; P57-A60 PolarHBondContact O-N 2.81Å; Q58-A60 VanDerWaalsContact C-N 3.26Å; Q58-A60 PolarHBondContact O-N 3.13Å; A60-L63 PolarHBondContact O-N 3.02Å; A60-D64 PolarHBondContact O-N 2.78Å
61	L	87.4	Confident	89.4	Confident	93 Å²	93	91 Å²	91	49%	0.487	45%	0.451	S	S	.	.	H	α-helix	trans	-65.2	-40.3	173.6	-174.5	65.2	0	0	0	111.7	V56 P57 Q58 R59 L63 D64 I69	V56-L61 HydrophobicContact CG2-CB 4.26Å; P57-L61 PolarHBondContact O-N 2.74Å; Q58-L61 WeakPolarHBondContact O-CB 3.03Å; Q58-L61 PolarHBondContact O-N 2.89Å; R59-L61 VanDerWaalsContact C-N 3.35Å; L61-L63 PolarHBondContact O-N 3.13Å; L61-D64 WeakPolarHBondContact O-CB 3.32Å; L61-D64 PolarHBondContact O-N 2.84Å; L61-D64 VanDerWaalsContact O-N 3.13Å; L61-I69 HydrophobicContact CD1-CB 4.21Å; L61-I69 HydrophobicContact CD1-CG2 4.17Å
62	E	88.6	Confident	89.4	Confident	135 Å²	135	89.8 Å²	89.8	63%	0.631	45%	0.448	S	S	*	.	H	α-helix	trans	-63.4	-27	175.4	-68.9	167.2	-169.1	0	0	112.8	Q58 R59	Q58-E62 PolarHBondContact O-N 3.32Å; R59-E62 PolarHBondContact O-N 3.38Å
63	L	88.2	Confident	89.3	Confident	135 Å²	135	90.9 Å²	90.9	71%	0.707	46%	0.455	S	S	*	.	H	α-helix	trans	-86.6	-10.2	177.6	-64.9	172.5	0	0	0	113.2	R59 A60 L61 K65	R59-L63 VanDerWaalsContact O-CG 3.32Å; R59-L63 WeakPolarHBondContact O-CG 3.25Å; R59-L63 PolarHBondContact O-N 3.38Å; A60-L63 PolarHBondContact O-N 3.02Å; L61-L63 PolarHBondContact O-N 3.13Å; L63-K65 VanDerWaalsContact C-N 3.28Å; L63-K65 PolarHBondContact O-N 2.93Å
64	D	87.8	Confident	89.3	Confident	31 Å²	31	90.9 Å²	90.9	17%	0.166	46%	0.455	C	S	.	.			trans	-78.8	71	-177.8	-177.2	24.6	0	0	0	112.5	A60 L61 N66 R67 A68 I69	A60-D64 PolarHBondContact O-N 2.78Å; L61-D64 WeakPolarHBondContact O-CB 3.32Å; L61-D64 PolarHBondContact O-N 2.84Å; L61-D64 VanDerWaalsContact O-N 3.13Å; D64-N66 PolarHBondContact O-N 3.45Å; D64-N66 VanDerWaalsContact O-N 3.14Å; D64-R67 PolarHBondContact O-N 2.94Å; D64-R67 VanDerWaalsContact O-N 3.17Å; D64-R67 PolarHBondContact OD1-N 3.25Å; D64-R67 VanDerWaalsContact OD1-N 3.15Å; D64-R67 WeakPolarHBondContact OD2-CA 3.39Å; D64-A68 WeakPolarHBondContact OD1-CB 3.29Å; D64-A68 PolarHBondContact OD1-N 2.88Å; D64-A68 PolarHBondContact OD2-N 3.1Å; D64-I69 HydrophobicContact CB-CG1 4.16Å; D64-I69 WeakPolarHBondContact OD2-CB 3.18Å; D64-I69 WeakPolarHBondContact OD2-CG1 3.46Å; D64-I69 PolarHBondContact OD2-N 3.32Å
65	K	87.8	Confident	89.3	Confident	190 Å²	190	92.3 Å²	92.3	83%	0.826	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.6	-23.1	-179.6	-64	-176.8	-178.3	178.8	0	113.7	L63	L63-K65 VanDerWaalsContact C-N 3.28Å; L63-K65 PolarHBondContact O-N 2.93Å
66	N	87.8	Confident	89.5	Confident	143 Å²	143	86.6 Å²	86.6	77%	0.765	44%	0.442	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.6	1.6	-176.5	-64.4	-25.5	0	0	0	112.7	D64 A68	D64-N66 PolarHBondContact O-N 3.45Å; D64-N66 VanDerWaalsContact O-N 3.14Å; N66-A68 PolarHBondContact O-N 3.19Å
67	R	88.2	Confident	89.7	Confident	144 Å²	144	89.7 Å²	89.7	54%	0.543	45%	0.45	S	S	.	.			trans	53.9	34	-174.9	-55.8	174.3	71.9	-178.5	6.9	111.6	D64 I69 E70 T71	D64-R67 PolarHBondContact O-N 2.94Å; D64-R67 VanDerWaalsContact O-N 3.17Å; D64-R67 PolarHBondContact OD1-N 3.25Å; D64-R67 VanDerWaalsContact OD1-N 3.15Å; D64-R67 WeakPolarHBondContact OD2-CA 3.39Å; R67-I69 PolarHBondContact O-N 2.86Å; R67-E70 HydrophobicContact CB-CB 4.34Å; R67-E70 IonicContact CZ-OE1 3.08Å; R67-E70 IonicContact CZ-OE2 2.86Å; R67-E70 IonicContact NE-OE1 2.73Å; R67-E70 IonicContact NE-OE2 3.96Å; R67-E70 PolarHBondContact NE-OE2 3.45Å; R67-E70 IonicContact NH2-OE1 2.7Å; R67-E70 PolarHBondContact NH2-OE1 3.34Å; R67-E70 IonicContact NH2-OE2 3.48Å; R67-E70 PolarHBondContact NH2-OE2 3.1Å; R67-E70 PolarHBondContact O-N 2.78Å; R67-T71 WeakPolarHBondContact O-CB 3.41Å; R67-T71 WeakPolarHBondContact O-CG2 3.4Å; R67-T71 PolarHBondContact O-N 2.92Å; R67-T71 PolarHBondContact O-OG1 2.86Å
68	A	88.6	Confident	90	Very high	52 Å²	52	91.3 Å²	91.3	43%	0.43	46%	0.459	S	S	.	.	H	α-helix	trans	-60.1	-35.8	177.7	0	0	0	0	0	111.3	D64 N66 T71 A72	D64-A68 WeakPolarHBondContact OD1-CB 3.29Å; D64-A68 PolarHBondContact OD1-N 2.88Å; D64-A68 PolarHBondContact OD2-N 3.1Å; N66-A68 PolarHBondContact O-N 3.19Å; A68-T71 WeakPolarHBondContact CA-OG1 3.17Å; A68-T71 PolarHBondContact O-OG1 2.87Å; A68-A72 VanDerWaalsContact O-CB 3.27Å; A68-A72 WeakPolarHBondContact O-CB 3.49Å; A68-A72 PolarHBondContact O-N 3.47Å
69	I	89.8	Confident	90.4	Very high	25 Å²	25	86.8 Å²	86.8	13%	0.128	44%	0.439	C	S	.	.	H	α-helix	trans	-68.3	-41.1	179.4	-58.7	-47.2	0	0	0	111.4	F30 T54 V56 L61 D64 R67	F30-I69 HydrophobicContact CE2-CD1 3.72Å; F30-I69 HydrophobicContact CZ-CD1 3.77Å; T54-I69 HydrophobicContact CG2-CG2 4.46Å; T54-I69 VanDerWaalsContact OG1-CG2 3.3Å; T54-I69 WeakPolarHBondContact OG1-CG2 3.49Å; T54-I69 PolarHBondContact OG1-O 2.87Å; T54-I69 VanDerWaalsContact OG1-O 3.14Å; V56-I69 HydrophobicContact CG1-CD1 3.84Å; V56-I69 HydrophobicContact CG1-CG1 4.31Å; V56-I69 HydrophobicContact CG1-CG2 4.16Å; V56-I69 HydrophobicContact CG2-CG1 4.34Å; V56-I69 HydrophobicContact CG2-CG2 3.85Å; L61-I69 HydrophobicContact CD1-CB 4.21Å; L61-I69 HydrophobicContact CD1-CG2 4.17Å; D64-I69 HydrophobicContact CB-CG1 4.16Å; D64-I69 WeakPolarHBondContact OD2-CB 3.18Å; D64-I69 WeakPolarHBondContact OD2-CG1 3.46Å; D64-I69 PolarHBondContact OD2-N 3.32Å; R67-I69 PolarHBondContact O-N 2.86Å
70	E	88.9	Confident	90.7	Very high	118 Å²	118	78.5 Å²	78.5	55%	0.551	41%	0.411	S	S	*	.	H	α-helix	trans	-74.1	-36.6	178.5	-174.1	-174	159.5	0	0	112.5	R67 P73	R67-E70 HydrophobicContact CB-CB 4.34Å; R67-E70 IonicContact CZ-OE1 3.08Å; R67-E70 IonicContact CZ-OE2 2.86Å; R67-E70 IonicContact NE-OE1 2.73Å; R67-E70 IonicContact NE-OE2 3.96Å; R67-E70 PolarHBondContact NE-OE2 3.45Å; R67-E70 IonicContact NH2-OE1 2.7Å; R67-E70 PolarHBondContact NH2-OE1 3.34Å; R67-E70 IonicContact NH2-OE2 3.48Å; R67-E70 PolarHBondContact NH2-OE2 3.1Å; R67-E70 PolarHBondContact O-N 2.78Å; E70-P73 VanDerWaalsContact O-CD 3.26Å; E70-P73 WeakPolarHBondContact O-CD 3.46Å
71	T	91.7	Very high	91	Very high	62 Å²	62	80.1 Å²	80.1	38%	0.38	43%	0.431	S	S	.	.	H	α-helix	trans	-83.2	-16.5	-179.5	55.6	0	0	0	0	113.1	R67 A68 P73 L74 S75	R67-T71 WeakPolarHBondContact O-CB 3.41Å; R67-T71 WeakPolarHBondContact O-CG2 3.4Å; R67-T71 PolarHBondContact O-N 2.92Å; R67-T71 PolarHBondContact O-OG1 2.86Å; A68-T71 WeakPolarHBondContact CA-OG1 3.17Å; A68-T71 PolarHBondContact O-OG1 2.87Å; T71-P73 VanDerWaalsContact C-CD 3.44Å; T71-L74 WeakPolarHBondContact O-CB 3.46Å; T71-L74 PolarHBondContact O-N 2.88Å; T71-S75 PolarHBondContact O-N 2.81Å; T71-S75 PolarHBondContact O-OG 3.23Å
72	A	92.6	Very high	91.4	Very high	20 Å²	20	82.1 Å²	82.1	17%	0.165	44%	0.441	C	S	.	.	H	α-helix	trans	-49.1	-44.2	-180	0	0	0	0	0	114.6	L52 T54 A68 L74 S75 F76	L52-A72 HydrophobicContact CD2-CB 4.1Å; T54-A72 HydrophobicContact CG2-CB 3.62Å; A68-A72 VanDerWaalsContact O-CB 3.27Å; A68-A72 WeakPolarHBondContact O-CB 3.49Å; A68-A72 PolarHBondContact O-N 3.47Å; A72-L74 VanDerWaalsContact C-N 3.34Å; A72-L74 PolarHBondContact O-N 3.12Å; A72-S75 PolarHBondContact O-N 2.98Å; A72-F76 WeakPolarHBondContact O-CB 3.22Å; A72-F76 PolarHBondContact O-N 2.93Å
73	P	93.4	Very high	91.7	Very high	27 Å²	27	79.5 Å²	79.5	18%	0.175	43%	0.431	C	S	.	.	H	α-helix	trans	-62.1	-40.3	178.3	-21.7	34	0	0	0	112.9	L52 E70 T71 R77	L52-P73 WeakPolarHBondContact O-CB 3.29Å; L52-P73 VanDerWaalsContact O-CG 3.28Å; L52-P73 WeakPolarHBondContact O-CG 3.45Å; E70-P73 VanDerWaalsContact O-CD 3.26Å; E70-P73 WeakPolarHBondContact O-CD 3.46Å; T71-P73 VanDerWaalsContact C-CD 3.44Å; P73-R77 WeakPolarHBondContact O-CG 3.03Å; P73-R77 PolarHBondContact O-N 2.86Å; P73-R77 VanDerWaalsContact O-N 3.13Å; P73-R77 PolarHBondContact O-NH1 3Å
74	L	93.4	Very high	91.9	Very high	100 Å²	100	74.7 Å²	74.7	52%	0.524	41%	0.414	S	S	.	.	H	α-helix	trans	-66.8	-48.7	176.3	178.8	62.8	0	0	0	111.1	T71 A72 F76 R77 T78	T71-L74 WeakPolarHBondContact O-CB 3.46Å; T71-L74 PolarHBondContact O-N 2.88Å; A72-L74 VanDerWaalsContact C-N 3.34Å; A72-L74 PolarHBondContact O-N 3.12Å; L74-F76 VanDerWaalsContact C-N 3.25Å; L74-F76 PolarHBondContact O-N 3Å; L74-R77 PolarHBondContact O-N 2.9Å; L74-R77 VanDerWaalsContact O-N 3.13Å; L74-T78 PolarHBondContact O-N 3.48Å; L74-T78 PolarHBondContact O-OG1 2.95Å
75	S	93.1	Very high	92.1	Very high	69 Å²	69	76.5 Å²	76.5	48%	0.483	42%	0.424	S	S	.	.	H	α-helix	trans	-57.8	-39.6	177.9	-60.8	0	0	0	0	111.9	T71 A72 T78 L79	T71-S75 PolarHBondContact O-N 2.81Å; T71-S75 PolarHBondContact O-OG 3.23Å; A72-S75 PolarHBondContact O-N 2.98Å; S75-T78 PolarHBondContact O-N 3.03Å; S75-L79 WeakPolarHBondContact O-CB 3.45Å; S75-L79 PolarHBondContact O-N 2.84Å
76	F	94.8	Very high	92.2	Very high	4 Å²	4	74.5 Å²	74.5	2%	0.018	42%	0.417	C	S	.	.	H	α-helix	trans	-63.4	-45.7	175.3	175.2	-119.6	0	0	0	112.3	I34 L50 L52 A72 L74 T78 L79 V80 A88 L89 L92	I34-F76 HydrophobicContact CG1-CZ 4.26Å; I34-F76 HydrophobicContact CG2-CE1 4.41Å; I34-F76 HydrophobicContact CG2-CZ 4.32Å; L50-F76 HydrophobicContact CB-CE1 4.13Å; L50-F76 HydrophobicContact CD2-CZ 4.43Å; L52-F76 HydrophobicContact CB-CB 4Å; L52-F76 HydrophobicContact CB-CD1 3.51Å; L52-F76 HydrophobicContact CB-CE1 4.21Å; L52-F76 HydrophobicContact CB-CG 3.92Å; L52-F76 HydrophobicContact CD2-CB 3.8Å; L52-F76 HydrophobicContact CD2-CG 4.22Å; A72-F76 WeakPolarHBondContact O-CB 3.22Å; A72-F76 PolarHBondContact O-N 2.93Å; L74-F76 VanDerWaalsContact C-N 3.25Å; L74-F76 PolarHBondContact O-N 3Å; F76-T78 VanDerWaalsContact C-N 3.29Å; F76-T78 PolarHBondContact O-N 3.46Å; F76-L79 WeakPolarHBondContact O-CB 3.45Å; F76-L79 PolarHBondContact O-N 3.44Å; F76-L79 VanDerWaalsContact O-N 3.1Å; F76-V80 HydrophobicContact CD1-CG2 4.46Å; F76-V80 HydrophobicContact CD2-CG2 4.02Å; F76-V80 HydrophobicContact CE1-CG2 4.06Å; F76-V80 HydrophobicContact CE2-CG2 3.56Å; F76-V80 HydrophobicContact CG-CG2 4.47Å; F76-V80 HydrophobicContact CZ-CG2 3.61Å; F76-V80 WeakPolarHBondContact O-CG2 3.37Å; F76-V80 PolarHBondContact O-N 3.23Å; F76-A88 HydrophobicContact CE2-CB 4.34Å; F76-L89 HydrophobicContact CE2-CD2 4.3Å; F76-L89 HydrophobicContact CZ-CD2 4.15Å; F76-L92 HydrophobicContact CD2-CD1 3.3Å; F76-L92 HydrophobicContact CD2-CG 4.17Å; F76-L92 HydrophobicContact CE2-CD1 3.37Å; F76-L92 HydrophobicContact CE2-CG 4.41Å; F76-L92 HydrophobicContact CG-CD1 4.2Å; F76-L92 HydrophobicContact CZ-CD1 4.32Å
77	R	94	Very high	92.5	Very high	96 Å²	96	69.8 Å²	69.8	36%	0.362	40%	0.398	S	S	.	.	H	α-helix	trans	-60.6	-40.1	176.6	-70.9	-174.7	-58.4	-96.3	2.6	111.9	D51 P73 L74 V80 G81	D51-R77 IonicContact OD1-CZ 3.95Å; D51-R77 IonicContact OD1-NH1 3.04Å; D51-R77 PolarHBondContact OD1-NH1 3.37Å; D51-R77 IonicContact OD2-NH1 2.81Å; D51-R77 PolarHBondContact OD2-NH1 3.24Å; P73-R77 WeakPolarHBondContact O-CG 3.03Å; P73-R77 PolarHBondContact O-N 2.86Å; P73-R77 VanDerWaalsContact O-N 3.13Å; P73-R77 PolarHBondContact O-NH1 3Å; L74-R77 PolarHBondContact O-N 2.9Å; L74-R77 VanDerWaalsContact O-N 3.13Å; R77-V80 PolarHBondContact O-N 3.44Å; R77-G81 PolarHBondContact O-N 3.48Å
78	T	94.6	Very high	92.8	Very high	89 Å²	89	62.9 Å²	62.9	55%	0.546	37%	0.372	S	S	.	.	H	α-helix	trans	-61.7	-44.3	173.2	-60.1	0	0	0	0	111.3	L74 S75 F76 V80 G81 L82	L74-T78 PolarHBondContact O-N 3.48Å; L74-T78 PolarHBondContact O-OG1 2.95Å; S75-T78 PolarHBondContact O-N 3.03Å; F76-T78 VanDerWaalsContact C-N 3.29Å; F76-T78 PolarHBondContact O-N 3.46Å; T78-V80 PolarHBondContact O-N 3.42Å; T78-G81 PolarHBondContact O-N 3.22Å; T78-L82 WeakPolarHBondContact O-CB 2.93Å; T78-L82 PolarHBondContact O-N 3.42Å
79	L	94.8	Very high	93	Very high	49 Å²	49	61.2 Å²	61.2	26%	0.257	36%	0.356	S	S	.	.	H	α-helix	trans	-62.5	-42.5	178.7	-166.7	68.4	0	0	0	112.2	S75 F76 G81 L82 L83 A88	S75-L79 WeakPolarHBondContact O-CB 3.45Å; S75-L79 PolarHBondContact O-N 2.84Å; F76-L79 WeakPolarHBondContact O-CB 3.45Å; F76-L79 PolarHBondContact O-N 3.44Å; F76-L79 VanDerWaalsContact O-N 3.1Å; L79-G81 VanDerWaalsContact C-N 3.35Å; L79-L82 PolarHBondContact O-N 3.24Å; L79-L83 HydrophobicContact CD1-CD1 3.43Å; L79-L83 VanDerWaalsContact CD1-CD1 3.43Å; L79-L83 HydrophobicContact CD1-CG 4.01Å; L79-L83 HydrophobicContact CG-CD1 3.91Å; L79-L83 HydrophobicContact CG-CG 4.44Å; L79-L83 WeakPolarHBondContact O-CB 3.13Å; L79-L83 PolarHBondContact O-N 3.27Å; L79-A88 HydrophobicContact CB-CB 4.34Å; L79-A88 HydrophobicContact CD2-CB 4.03Å; L79-A88 HydrophobicContact CG-CB 3.89Å
80	V	94.1	Very high	93.2	Very high	29 Å²	29	61.4 Å²	61.4	18%	0.176	36%	0.356	C	S	.	.	H	α-helix	trans	-62.5	-41.9	174.8	172.5	0	0	0	0	111.1	F76 R77 T78 L82 G84 I85 A88	F76-V80 HydrophobicContact CD1-CG2 4.46Å; F76-V80 HydrophobicContact CD2-CG2 4.02Å; F76-V80 HydrophobicContact CE1-CG2 4.06Å; F76-V80 HydrophobicContact CE2-CG2 3.56Å; F76-V80 HydrophobicContact CG-CG2 4.47Å; F76-V80 HydrophobicContact CZ-CG2 3.61Å; F76-V80 WeakPolarHBondContact O-CG2 3.37Å; F76-V80 PolarHBondContact O-N 3.23Å; R77-V80 PolarHBondContact O-N 3.44Å; T78-V80 PolarHBondContact O-N 3.42Å; V80-L82 VanDerWaalsContact C-N 3.3Å; V80-L82 PolarHBondContact O-N 2.97Å; V80-G84 WeakPolarHBondContact O-CA 3.31Å; V80-G84 PolarHBondContact O-N 3.38Å; V80-I85 HydrophobicContact CG1-CG1 3.83Å; V80-A88 HydrophobicContact CB-CB 4.41Å; V80-A88 HydrophobicContact CG2-CB 3.73Å
81	G	92.4	Very high	93.4	Very high	71 Å²	71	58.2 Å²	58.2	73%	0.732	35%	0.347	S	S	*	.	H	α-helix	trans	-65.2	-31.9	176.6	0	0	0	0	0	113.5	R77 T78 L79	R77-G81 PolarHBondContact O-N 3.48Å; T78-G81 PolarHBondContact O-N 3.22Å; L79-G81 VanDerWaalsContact C-N 3.35Å
82	L	95.4	Very high	93.4	Very high	135 Å²	135	56.7 Å²	56.7	71%	0.707	34%	0.336	S	S	*	.	H	α-helix	trans	-84.2	-45.4	-178.7	-178	64.6	0	0	0	113.1	T78 L79 V80	T78-L82 WeakPolarHBondContact O-CB 2.93Å; T78-L82 PolarHBondContact O-N 3.42Å; L79-L82 PolarHBondContact O-N 3.24Å; V80-L82 VanDerWaalsContact C-N 3.3Å; V80-L82 PolarHBondContact O-N 2.97Å
83	L	94.2	Very high	93.3	Very high	80 Å²	80	55.8 Å²	55.8	42%	0.419	33%	0.328	S	S	.	.	H	α-helix	trans	-104.5	-13.9	-170.4	-57.1	-176.1	0	0	0	113.5	L79 A87	L79-L83 HydrophobicContact CD1-CD1 3.43Å; L79-L83 VanDerWaalsContact CD1-CD1 3.43Å; L79-L83 HydrophobicContact CD1-CG 4.01Å; L79-L83 HydrophobicContact CG-CD1 3.91Å; L79-L83 HydrophobicContact CG-CG 4.44Å; L79-L83 WeakPolarHBondContact O-CB 3.13Å; L79-L83 PolarHBondContact O-N 3.27Å; L83-A87 HydrophobicContact CB-CB 3.86Å
84	G	92.7	Very high	93.1	Very high	34 Å²	34	59.8 Å²	59.8	35%	0.351	34%	0.343	S	S	.	.			trans	80	168.4	-164.6	0	0	0	0	0	112.5	V80 A88	V80-G84 WeakPolarHBondContact O-CA 3.31Å; V80-G84 PolarHBondContact O-N 3.38Å; G84-A88 VanDerWaalsContact O-CB 3.22Å; G84-A88 WeakPolarHBondContact O-CB 3.33Å; G84-A88 PolarHBondContact O-N 2.98Å; G84-A88 VanDerWaalsContact O-N 3.09Å
85	I	91.3	Very high	92.8	Very high	70 Å²	70	59.5 Å²	59.5	36%	0.359	35%	0.349	S	S	.	.	H	α-helix	trans	-62.5	-52.7	-171	-65.5	168	0	0	0	111.7	L50 V80 A87 A88 L89	L50-I85 HydrophobicContact CD1-CD1 3.74Å; L50-I85 HydrophobicContact CD1-CG1 4.21Å; L50-I85 HydrophobicContact CD2-CD1 4.45Å; L50-I85 HydrophobicContact CD2-CG1 4.2Å; L50-I85 HydrophobicContact CD2-CG2 3.65Å; V80-I85 HydrophobicContact CG1-CG1 3.83Å; I85-A87 PolarHBondContact O-N 2.86Å; I85-A88 PolarHBondContact O-N 3.16Å; I85-L89 HydrophobicContact CG2-CD1 3.84Å; I85-L89 HydrophobicContact CG2-CG 4.32Å; I85-L89 WeakPolarHBondContact O-CB 3.24Å; I85-L89 VanDerWaalsContact O-CG 3.24Å; I85-L89 WeakPolarHBondContact O-CG 3.24Å; I85-L89 PolarHBondContact O-N 2.7Å
86	E	91.4	Very high	92.5	Very high	147 Å²	147	56.6 Å²	56.6	69%	0.687	33%	0.329	S	S	*	.	H	α-helix	trans	-61.3	-48.1	-173	-172.1	177.4	172.2	0	0	112.2	M1 L89 E90	M1-E86 HydrophobicContact CE-CG 3.8Å; E86-L89 PolarHBondContact O-N 3.09Å; E86-E90 WeakPolarHBondContact O-CB 3.49Å; E86-E90 PolarHBondContact O-N 3.46Å
87	A	93.8	Very high	91.9	Very high	44 Å²	44	58.1 Å²	58.1	36%	0.364	34%	0.339	S	S	.	.	H	α-helix	trans	-67.8	-38.2	179.7	0	0	0	0	0	112.3	L83 I85 L89 E90 S91	L83-A87 HydrophobicContact CB-CB 3.86Å; I85-A87 PolarHBondContact O-N 2.86Å; A87-L89 VanDerWaalsContact C-N 3.34Å; A87-L89 PolarHBondContact O-N 3.02Å; A87-E90 PolarHBondContact O-N 2.82Å; A87-S91 WeakPolarHBondContact O-CB 3.46Å; A87-S91 PolarHBondContact O-N 2.93Å; A87-S91 PolarHBondContact O-OG 3.34Å
88	A	94.2	Very high	90.8	Very high	0 Å²	0	56.3 Å²	56.3	0%	0	35%	0.345	C	S	.	.	H	α-helix	trans	-63	-41.1	175.3	0	0	0	0	0	112.2	F76 L79 V80 G84 I85 S91 L92	F76-A88 HydrophobicContact CE2-CB 4.34Å; L79-A88 HydrophobicContact CB-CB 4.34Å; L79-A88 HydrophobicContact CD2-CB 4.03Å; L79-A88 HydrophobicContact CG-CB 3.89Å; V80-A88 HydrophobicContact CB-CB 4.41Å; V80-A88 HydrophobicContact CG2-CB 3.73Å; G84-A88 VanDerWaalsContact O-CB 3.22Å; G84-A88 WeakPolarHBondContact O-CB 3.33Å; G84-A88 PolarHBondContact O-N 2.98Å; G84-A88 VanDerWaalsContact O-N 3.09Å; I85-A88 PolarHBondContact O-N 3.16Å; A88-S91 PolarHBondContact O-N 3Å; A88-L92 PolarHBondContact O-N 3.48Å
89	L	92.9	Very high	89	Confident	17 Å²	17	59.9 Å²	59.9	9%	0.089	36%	0.355	C	S	.	.	H	α-helix	trans	-64.1	-46.7	175.2	-70.2	178.7	0	0	0	111.7	M1 M20 I34 F76 I85 E86 A87 S91 L92 I93	M1-L89 HydrophobicContact CE-CB 4.02Å; M20-L89 HydrophobicContact CE-CD1 4.3Å; M20-L89 HydrophobicContact CE-CD2 4.04Å; I34-L89 HydrophobicContact CD1-CD2 3.22Å; I34-L89 HydrophobicContact CG1-CD2 4.05Å; I34-L89 HydrophobicContact CG2-CD2 4.4Å; F76-L89 HydrophobicContact CE2-CD2 4.3Å; F76-L89 HydrophobicContact CZ-CD2 4.15Å; I85-L89 HydrophobicContact CG2-CD1 3.84Å; I85-L89 HydrophobicContact CG2-CG 4.32Å; I85-L89 WeakPolarHBondContact O-CB 3.24Å; I85-L89 VanDerWaalsContact O-CG 3.24Å; I85-L89 WeakPolarHBondContact O-CG 3.24Å; I85-L89 PolarHBondContact O-N 2.7Å; E86-L89 PolarHBondContact O-N 3.09Å; A87-L89 VanDerWaalsContact C-N 3.34Å; A87-L89 PolarHBondContact O-N 3.02Å; L89-S91 VanDerWaalsContact C-N 3.32Å; L89-S91 PolarHBondContact O-N 3.32Å; L89-L92 PolarHBondContact O-N 2.85Å; L89-I93 VanDerWaalsContact O-CG1 3.29Å; L89-I93 WeakPolarHBondContact O-CG1 3.49Å; L89-I93 PolarHBondContact O-N 2.7Å
90	E	93.8	Very high	86.7	Confident	28 Å²	28	64.2 Å²	64.2	13%	0.131	37%	0.374	C	S	.	.	H	α-helix	trans	-57.1	-45.6	176.1	-177.4	83.3	174.5	0	0	111.5	K4 Y5 E86 A87 I93 K94	K4-E90 IonicContact NZ-OE1 2.74Å; K4-E90 PolarHBondContact NZ-OE1 3.41Å; K4-E90 IonicContact NZ-OE2 2.7Å; K4-E90 PolarHBondContact NZ-OE2 3.09Å; Y5-E90 WeakPolarHBondContact CE2-OE2 3.32Å; Y5-E90 VanDerWaalsContact OH-CD 3.27Å; Y5-E90 PolarHBondContact OH-OE1 3.29Å; Y5-E90 PolarHBondContact OH-OE2 3.45Å; E86-E90 WeakPolarHBondContact O-CB 3.49Å; E86-E90 PolarHBondContact O-N 3.46Å; A87-E90 PolarHBondContact O-N 2.82Å; E90-I93 PolarHBondContact O-N 2.78Å; E90-K94 HydrophobicContact CG-CD 4.2Å; E90-K94 WeakPolarHBondContact O-CB 3.45Å; E90-K94 WeakPolarHBondContact O-CG 3.5Å; E90-K94 PolarHBondContact O-N 3.45Å; E90-K94 WeakPolarHBondContact OE1-CE 3.29Å; E90-K94 IonicContact OE1-NZ 2.78Å; E90-K94 PolarHBondContact OE1-NZ 3.17Å
91	S	92.4	Very high	84.1	Confident	52 Å²	52	70.3 Å²	70.3	36%	0.364	41%	0.406	S	S	.	.	H	α-helix	trans	-62.1	-41.4	177	-70.5	0	0	0	0	112.4	A87 A88 L89 S95	A87-S91 WeakPolarHBondContact O-CB 3.46Å; A87-S91 PolarHBondContact O-N 2.93Å; A87-S91 PolarHBondContact O-OG 3.34Å; A88-S91 PolarHBondContact O-N 3Å; L89-S91 VanDerWaalsContact C-N 3.32Å; L89-S91 PolarHBondContact O-N 3.32Å; S91-S95 VanDerWaalsContact O-CB 3.3Å; S91-S95 WeakPolarHBondContact O-CB 3.44Å; S91-S95 PolarHBondContact O-N 3.05Å
92	L	91.2	Very high	81.3	Confident	29 Å²	29	77.3 Å²	77.3	15%	0.152	43%	0.426	C	S	.	.	H	α-helix	trans	-64.4	-47	176.1	-83.8	-178.9	0	0	0	112.3	I22 L32 F76 A88 L89 K94 S95 L96	I22-L92 HydrophobicContact CD1-CB 4.37Å; L32-L92 HydrophobicContact CD1-CD2 4.14Å; F76-L92 HydrophobicContact CD2-CD1 3.3Å; F76-L92 HydrophobicContact CD2-CG 4.17Å; F76-L92 HydrophobicContact CE2-CD1 3.37Å; F76-L92 HydrophobicContact CE2-CG 4.41Å; F76-L92 HydrophobicContact CG-CD1 4.2Å; F76-L92 HydrophobicContact CZ-CD1 4.32Å; A88-L92 PolarHBondContact O-N 3.48Å; L89-L92 PolarHBondContact O-N 2.85Å; L92-K94 VanDerWaalsContact C-N 3.32Å; L92-K94 PolarHBondContact O-N 3.01Å; L92-S95 PolarHBondContact O-N 3.08Å; L92-L96 PolarHBondContact O-N 3.32Å
93	I	91.1	Very high	80.6	Confident	1 Å²	1	74.4 Å²	74.4	1%	0.005	41%	0.412	C	S	.	.	H	α-helix	trans	-59.6	-48	179.8	-65.8	163.6	0	0	0	109.4	M1 Y5 V9 I22 L89 E90 S95 L96 C97	M1-I93 HydrophobicContact SD-CD1 4.08Å; Y5-I93 HydrophobicContact CD1-CG2 3.79Å; Y5-I93 HydrophobicContact CD2-CD1 3.78Å; Y5-I93 HydrophobicContact CD2-CG2 3.95Å; Y5-I93 HydrophobicContact CE1-CG2 3.97Å; Y5-I93 HydrophobicContact CE2-CD1 4.07Å; Y5-I93 HydrophobicContact CE2-CG2 4.1Å; Y5-I93 HydrophobicContact CG-CG2 3.78Å; V9-I93 HydrophobicContact CG2-CD1 3.68Å; V9-I93 HydrophobicContact CG2-CG1 4.01Å; I22-I93 HydrophobicContact CD1-CG1 3.67Å; I22-I93 HydrophobicContact CG1-CG1 4.27Å; I22-I93 HydrophobicContact CG2-CG1 4.02Å; L89-I93 VanDerWaalsContact O-CG1 3.29Å; L89-I93 WeakPolarHBondContact O-CG1 3.49Å; L89-I93 PolarHBondContact O-N 2.7Å; E90-I93 PolarHBondContact O-N 2.78Å; I93-S95 PolarHBondContact O-N 2.92Å; I93-L96 PolarHBondContact O-N 2.74Å; I93-C97 WeakPolarHBondContact O-CB 3.47Å; I93-C97 PolarHBondContact O-N 3.1Å; I93-C97 PolarHBondContact O-SG 3.04Å
94	K	89.6	Confident	79.9	Confident	112 Å²	112	74.1 Å²	74.1	49%	0.487	41%	0.412	S	S	.	.	H	α-helix	trans	-61.9	-41.5	176.1	-73.2	174.4	-177.8	164	0	112.1	E90 L92 L96 A98	E90-K94 HydrophobicContact CG-CD 4.2Å; E90-K94 WeakPolarHBondContact O-CB 3.45Å; E90-K94 WeakPolarHBondContact O-CG 3.5Å; E90-K94 PolarHBondContact O-N 3.45Å; E90-K94 WeakPolarHBondContact OE1-CE 3.29Å; E90-K94 IonicContact OE1-NZ 2.78Å; E90-K94 PolarHBondContact OE1-NZ 3.17Å; L92-K94 VanDerWaalsContact C-N 3.32Å; L92-K94 PolarHBondContact O-N 3.01Å; K94-L96 VanDerWaalsContact C-N 3.34Å; K94-L96 PolarHBondContact O-N 3.3Å; K94-A98 WeakPolarHBondContact O-CA 3.45Å; K94-A98 WeakPolarHBondContact O-CB 3.45Å; K94-A98 PolarHBondContact O-N 3.02Å
95	S	87.8	Confident	79.1	Confident	93 Å²	93	76.3 Å²	76.3	65%	0.65	42%	0.416	S	S	*	.	H	α-helix	trans	-66.2	-35.6	179.5	-176.2	0	0	0	0	113	S91 L92 I93	S91-S95 VanDerWaalsContact O-CB 3.3Å; S91-S95 WeakPolarHBondContact O-CB 3.44Å; S91-S95 PolarHBondContact O-N 3.05Å; L92-S95 PolarHBondContact O-N 3.08Å; I93-S95 PolarHBondContact O-N 2.92Å
96	L	85.6	Confident	78.4	Confident	9 Å²	9	76.7 Å²	76.7	5%	0.047	42%	0.419	C	S	.	.	H	α-helix	trans	-83.2	-34.5	-178.9	-174.4	64.5	0	0	0	112.3	I22 S24 F30 L32 L92 I93 K94	I22-L96 HydrophobicContact CB-CD2 4.23Å; I22-L96 HydrophobicContact CG2-CD2 3.84Å; I22-L96 WeakPolarHBondContact O-CD2 3.39Å; S24-L96 VanDerWaalsContact CB-O 3.26Å; S24-L96 WeakPolarHBondContact CB-O 3.33Å; S24-L96 PolarHBondContact OG-O 3.11Å; F30-L96 HydrophobicContact CD1-CD1 3.53Å; F30-L96 HydrophobicContact CE1-CD1 3.76Å; L32-L96 HydrophobicContact CB-CD2 4.43Å; L32-L96 HydrophobicContact CD1-CB 4.46Å; L32-L96 HydrophobicContact CD1-CD2 4.06Å; L32-L96 HydrophobicContact CG-CD2 4Å; L92-L96 PolarHBondContact O-N 3.32Å; I93-L96 PolarHBondContact O-N 2.74Å; K94-L96 VanDerWaalsContact C-N 3.34Å; K94-L96 PolarHBondContact O-N 3.3Å
97	C	83.2	Confident	77.6	Confident	35 Å²	35	72.3 Å²	72.3	24%	0.236	40%	0.402	C	S	.	.	H	α-helix	trans	-107.8	2.6	-172.3	-47.2	0	0	0	0	113.3	A8 I93 E99	A8-C97 HydrophobicContact CB-CB 4.48Å; A8-C97 WeakPolarHBondContact CB-SG 3.3Å; I93-C97 WeakPolarHBondContact O-CB 3.47Å; I93-C97 PolarHBondContact O-N 3.1Å; I93-C97 PolarHBondContact O-SG 3.04Å; C97-E99 PolarHBondContact O-N 3.48Å; C97-E99 VanDerWaalsContact O-N 3.1Å
98	A	70.9	Confident	76.5	Confident	59 Å²	59	74.2 Å²	74.2	49%	0.488	41%	0.405	S	S	.	.			trans	-55.4	120.6	170.8	0	0	0	0	0	108.1	K94 E100	K94-A98 WeakPolarHBondContact O-CA 3.45Å; K94-A98 WeakPolarHBondContact O-CB 3.45Å; K94-A98 PolarHBondContact O-N 3.02Å; A98-E100 PolarHBondContact O-N 2.75Å
99	E	56.1	Low	75.3	Confident	164 Å²	164	79.5 Å²	79.5	77%	0.766	43%	0.434	S	S	*	.			trans	-58.2	131.1	164.4	-63.2	-170.4	164.2	0	0	107.2	C97 N101	C97-E99 PolarHBondContact O-N 3.48Å; C97-E99 VanDerWaalsContact O-N 3.1Å; E99-N101 VanDerWaalsContact C-N 3.25Å; E99-N101 PolarHBondContact O-N 2.79Å
100	E	47.5	Very low	73.9	Confident	140 Å²	140	84.3 Å²	84.3	65%	0.654	46%	0.46	S	S	*	.			trans	-63.1	95.5	168.1	-73.9	175.1	-176	0	0	106.5	R27 A98 N102	R27-E100 IonicContact NH2-OE1 3.58Å; R27-E100 PolarHBondContact NH2-OE1 3.32Å; A98-E100 PolarHBondContact O-N 2.75Å; E100-N102 PolarHBondContact O-N 3.4Å
101	N	38.1	Very low	72.3	Confident	156 Å²	156	89 Å²	89	83%	0.834	49%	0.487	S	S	*	.			trans	-65.6	86.6	163	-76.3	-23.1	0	0	0	106.8	E99	E99-N101 VanDerWaalsContact C-N 3.25Å; E99-N101 PolarHBondContact O-N 2.79Å
102	N	33.6	Very low	70.4	Confident	218 Å²	218	92.4 Å²	92.4	100%	1.166	50%	0.499	S	S	*	.			trans	-71.4	0	163.3	-101.8	-18.7	0	0	0	110.2	E100	E100-N102 PolarHBondContact O-N 3.4Å

Retrieved 102 of 102 residues in 23.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).