X6R9Y9_HUMAN Loading...

Coiled-coil domain containing 107

AlphaFold DB , UniProt , Accession X6R9Y9, Species HUMAN (Homo sapiens, Human), Gene CCDC107, Length 137 aa.

						>X6R9Y9_HUMAN|X6R9Y9|CCDC107
MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFER
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.5	Very low	55.7	Low	233 Å²	233	95.5 Å²	95.5	100%	1.148	61%	0.611	S	S	*	*				0	5.3	0	-75.4	-173.7	150	0	0	115.1
2	A	43.3	Very low	57.3	Low	86 Å²	86	90.4 Å²	90.4	71%	0.711	59%	0.589	S	S	*	*			trans	-89.3	-15.4	-176.5	0	0	0	0	0	115.5
3	G	44.8	Very low	58.7	Low	51 Å²	51	92.9 Å²	92.9	53%	0.526	59%	0.593	S	S	.	*	H	α-helix	trans	-78	-35.2	-174.1	0	0	0	0	0	115.1	V5 S6 L7	G3-V5 PolarHBondContact O-N 3.13Å; G3-S6 PolarHBondContact O-N 2.93Å; G3-L7 PolarHBondContact O-N 3.35Å
4	A	47.8	Very low	59.8	Low	76 Å²	76	95.2 Å²	95.2	63%	0.628	60%	0.598	S	S	*	*	H	α-helix	trans	-71.4	-32.7	-175.2	0	0	0	0	0	113.1	S6 L8	A4-S6 VanDerWaalsContact C-N 3.33Å; A4-L8 PolarHBondContact O-N 3.34Å
5	V	49.2	Very low	60.5	Low	113 Å²	113	95.2 Å²	95.2	69%	0.685	59%	0.591	S	S	*	*	H	α-helix	trans	-70.1	-34.6	176.5	-173.9	0	0	0	0	110.7	G3 G9	G3-V5 PolarHBondContact O-N 3.13Å; V5-G9 PolarHBondContact O-N 3.37Å; V5-G9 VanDerWaalsContact O-N 3.1Å
6	S	57	Low	61.1	Low	75 Å²	75	95 Å²	95	52%	0.524	59%	0.589	S	S	.	*	H	α-helix	trans	-68.4	-43.1	178.2	-171.6	0	0	0	0	111.9	G3 A4 L8 G9 V10	G3-S6 PolarHBondContact O-N 2.93Å; A4-S6 VanDerWaalsContact C-N 3.33Å; S6-L8 PolarHBondContact O-N 2.94Å; S6-G9 PolarHBondContact O-N 3.35Å; S6-V10 VanDerWaalsContact O-CG2 3.28Å; S6-V10 WeakPolarHBondContact O-CG2 3.47Å; S6-V10 PolarHBondContact O-N 3.12Å
7	L	57.5	Low	61.2	Low	97 Å²	97	93.8 Å²	93.8	51%	0.508	59%	0.585	S	S	.	*	H	α-helix	trans	-63.6	-41.5	177.6	-78.2	163.6	0	0	0	112.6	G3 G9 V10 V11	G3-L7 PolarHBondContact O-N 3.35Å; L7-G9 VanDerWaalsContact C-N 3.32Å; L7-G9 PolarHBondContact O-N 3.21Å; L7-V10 PolarHBondContact O-N 3.5Å; L7-V11 WeakPolarHBondContact O-CB 3.09Å; L7-V11 VanDerWaalsContact O-CG2 3.24Å; L7-V11 WeakPolarHBondContact O-CG2 3.39Å; L7-V11 PolarHBondContact O-N 2.95Å
8	L	59.8	Low	61.2	Low	123 Å²	123	92 Å²	92	64%	0.644	58%	0.581	S	S	*	*	H	α-helix	trans	-65.5	-38.3	176.7	-157.7	76.4	0	0	0	111.5	A4 S6 G12	A4-L8 PolarHBondContact O-N 3.34Å; S6-L8 PolarHBondContact O-N 2.94Å; L8-G12 PolarHBondContact O-N 3Å
9	G	68.4	Low	60.8	Low	36 Å²	36	93.1 Å²	93.1	37%	0.371	58%	0.581	S	S	.	*	H	α-helix	trans	-65.3	-43.2	174	0	0	0	0	0	112.9	V5 S6 L7 G12 L13	V5-G9 PolarHBondContact O-N 3.37Å; V5-G9 VanDerWaalsContact O-N 3.1Å; S6-G9 PolarHBondContact O-N 3.35Å; L7-G9 VanDerWaalsContact C-N 3.32Å; L7-G9 PolarHBondContact O-N 3.21Å; G9-G12 PolarHBondContact O-N 2.99Å; G9-L13 WeakPolarHBondContact O-CB 3.33Å; G9-L13 WeakPolarHBondContact O-CD1 3.4Å; G9-L13 PolarHBondContact O-N 3.47Å
10	V	69.9	Low	60.8	Low	83 Å²	83	92.3 Å²	92.3	50%	0.503	58%	0.579	S	S	.	*	H	α-helix	trans	-66.9	-43.5	177.7	172.6	0	0	0	0	110.9	S6 L7 L13 L14	S6-V10 VanDerWaalsContact O-CG2 3.28Å; S6-V10 WeakPolarHBondContact O-CG2 3.47Å; S6-V10 PolarHBondContact O-N 3.12Å; L7-V10 PolarHBondContact O-N 3.5Å; V10-L13 PolarHBondContact O-N 3.44Å; V10-L14 WeakPolarHBondContact O-CB 3.44Å; V10-L14 PolarHBondContact O-N 2.82Å
11	V	70.5	Confident	60.4	Low	78 Å²	78	90.2 Å²	90.2	47%	0.473	58%	0.575	S	S	.	*	H	α-helix	trans	-64.5	-41.3	175.6	171	0	0	0	0	110.9	L7 L14 L15	L7-V11 WeakPolarHBondContact O-CB 3.09Å; L7-V11 VanDerWaalsContact O-CG2 3.24Å; L7-V11 WeakPolarHBondContact O-CG2 3.39Å; L7-V11 PolarHBondContact O-N 2.95Å; V11-L14 PolarHBondContact O-N 3.47Å; V11-L15 HydrophobicContact CG1-CD1 3.81Å; V11-L15 WeakPolarHBondContact O-CB 3.49Å; V11-L15 PolarHBondContact O-N 2.86Å
12	G	75.3	Confident	60.7	Low	34 Å²	34	84.8 Å²	84.8	35%	0.351	56%	0.555	S	S	.	*	H	α-helix	trans	-60.9	-45.8	174.1	0	0	0	0	0	112.6	L8 G9 L15 V16	L8-G12 PolarHBondContact O-N 3Å; G9-G12 PolarHBondContact O-N 2.99Å; G12-L15 PolarHBondContact O-N 3.43Å; G12-V16 WeakPolarHBondContact O-CB 3.13Å; G12-V16 WeakPolarHBondContact O-CG2 3.48Å; G12-V16 PolarHBondContact O-N 3.29Å
13	L	74.8	Confident	60.7	Low	123 Å²	123	87.3 Å²	87.3	64%	0.644	56%	0.556	S	S	*	*	H	α-helix	trans	-64	-39.6	174.6	-104.3	85.6	0	0	0	112.1	G9 V10 V16 S17	G9-L13 WeakPolarHBondContact O-CB 3.33Å; G9-L13 WeakPolarHBondContact O-CD1 3.4Å; G9-L13 PolarHBondContact O-N 3.47Å; V10-L13 PolarHBondContact O-N 3.44Å; L13-V16 PolarHBondContact O-N 2.82Å; L13-S17 VanDerWaalsContact O-CB 3.23Å; L13-S17 WeakPolarHBondContact O-CB 3.46Å; L13-S17 PolarHBondContact O-N 3.17Å; L13-S17 PolarHBondContact O-OG 3.45Å
14	L	74.4	Confident	60.7	Low	125 Å²	125	86.8 Å²	86.8	65%	0.654	55%	0.55	S	S	*	*	H	α-helix	trans	-66.7	-40.8	179.7	-151.6	104.2	0	0	0	111	V10 V11 S17 A18	V10-L14 WeakPolarHBondContact O-CB 3.44Å; V10-L14 PolarHBondContact O-N 2.82Å; V11-L14 PolarHBondContact O-N 3.47Å; L14-S17 PolarHBondContact O-N 3.28Å; L14-A18 VanDerWaalsContact O-CB 3.26Å; L14-A18 WeakPolarHBondContact O-CB 3.29Å; L14-A18 PolarHBondContact O-N 3.45Å
15	L	70.4	Confident	60.7	Low	95 Å²	95	90.7 Å²	90.7	50%	0.497	56%	0.561	S	S	.	*	H	α-helix	trans	-65.2	-45.6	174.6	-101.1	137.7	0	0	0	112.1	V11 G12 S17 A18 L19	V11-L15 HydrophobicContact CG1-CD1 3.81Å; V11-L15 WeakPolarHBondContact O-CB 3.49Å; V11-L15 PolarHBondContact O-N 2.86Å; G12-L15 PolarHBondContact O-N 3.43Å; L15-S17 VanDerWaalsContact C-N 3.35Å; L15-A18 PolarHBondContact O-N 3.06Å; L15-L19 WeakPolarHBondContact O-CB 3.45Å; L15-L19 WeakPolarHBondContact O-CD1 3.43Å; L15-L19 PolarHBondContact O-N 3.26Å
16	V	69.8	Low	60.6	Low	92 Å²	92	96.5 Å²	96.5	56%	0.558	57%	0.571	S	S	*	*	H	α-helix	trans	-63	-42.5	175.4	163.5	0	0	0	0	110.9	G12 L13 L19 S20	G12-V16 WeakPolarHBondContact O-CB 3.13Å; G12-V16 WeakPolarHBondContact O-CG2 3.48Å; G12-V16 PolarHBondContact O-N 3.29Å; L13-V16 PolarHBondContact O-N 2.82Å; V16-L19 PolarHBondContact O-N 3.26Å; V16-S20 WeakPolarHBondContact O-CB 3.28Å; V16-S20 PolarHBondContact O-N 3.48Å; V16-S20 PolarHBondContact O-OG 2.97Å
17	S	62.7	Low	59.8	Low	75 Å²	75	96.7 Å²	96.7	52%	0.524	58%	0.577	S	S	.	*	H	α-helix	trans	-68.5	-36.9	178.9	-57.2	0	0	0	0	112.3	L13 L14 L15 S20 G21	L13-S17 VanDerWaalsContact O-CB 3.23Å; L13-S17 WeakPolarHBondContact O-CB 3.46Å; L13-S17 PolarHBondContact O-N 3.17Å; L13-S17 PolarHBondContact O-OG 3.45Å; L14-S17 PolarHBondContact O-N 3.28Å; L15-S17 VanDerWaalsContact C-N 3.35Å; S17-S20 PolarHBondContact O-N 3.38Å; S17-G21 PolarHBondContact O-N 3Å
18	A	61.4	Low	59.4	Low	61 Å²	61	98.8 Å²	98.8	50%	0.504	59%	0.588	S	S	.	*	H	α-helix	trans	-68.5	-39.8	174.2	0	0	0	0	0	111.8	L14 L15 G21 V22	L14-A18 VanDerWaalsContact O-CB 3.26Å; L14-A18 WeakPolarHBondContact O-CB 3.29Å; L14-A18 PolarHBondContact O-N 3.45Å; L15-A18 PolarHBondContact O-N 3.06Å; A18-G21 PolarHBondContact O-N 2.83Å; A18-V22 WeakPolarHBondContact O-CB 3.45Å; A18-V22 PolarHBondContact O-N 2.8Å
19	L	54	Low	58.7	Low	113 Å²	113	98.1 Å²	98.1	59%	0.592	59%	0.591	S	S	*	*	H	α-helix	trans	-64.8	-43.3	172.8	-104.8	72.5	0	0	0	111.7	L15 V16 G21 V22 L23	L15-L19 WeakPolarHBondContact O-CB 3.45Å; L15-L19 WeakPolarHBondContact O-CD1 3.43Å; L15-L19 PolarHBondContact O-N 3.26Å; V16-L19 PolarHBondContact O-N 3.26Å; L19-G21 VanDerWaalsContact C-N 3.34Å; L19-V22 PolarHBondContact O-N 3.29Å; L19-L23 WeakPolarHBondContact O-CB 3.46Å; L19-L23 PolarHBondContact O-N 2.99Å
20	S	60.3	Low	57.7	Low	76 Å²	76	103 Å²	103	53%	0.531	61%	0.609	S	S	.	*	H	α-helix	trans	-68.8	-31	175.1	-72.7	0	0	0	0	112.7	V16 S17 G24	V16-S20 WeakPolarHBondContact O-CB 3.28Å; V16-S20 PolarHBondContact O-N 3.48Å; V16-S20 PolarHBondContact O-OG 2.97Å; S17-S20 PolarHBondContact O-N 3.38Å; S20-G24 WeakPolarHBondContact O-CA 3.33Å; S20-G24 PolarHBondContact O-N 2.89Å
21	G	52	Low	56.6	Low	49 Å²	49	107.4 Å²	107.4	51%	0.505	63%	0.629	S	S	.	*	H	α-helix	trans	-69.8	-38.4	173.1	0	0	0	0	0	112.4	S17 A18 L19	S17-G21 PolarHBondContact O-N 3Å; A18-G21 PolarHBondContact O-N 2.83Å; L19-G21 VanDerWaalsContact C-N 3.34Å
22	V	52.2	Low	55.4	Low	120 Å²	120	115 Å²	115	73%	0.727	65%	0.649	S	S	*	*	H	α-helix	trans	-76.9	-28.5	177.6	103.8	0	0	0	0	112.8	A18 L19	A18-V22 WeakPolarHBondContact O-CB 3.45Å; A18-V22 PolarHBondContact O-N 2.8Å; L19-V22 PolarHBondContact O-N 3.29Å
23	L	43.1	Very low	54	Low	138 Å²	138	118 Å²	118	72%	0.723	67%	0.67	S	S	*	*	H	α-helix	trans	-90.9	-26.1	177.2	-158.9	68.9	0	0	0	112.6	L19	L19-L23 WeakPolarHBondContact O-CB 3.46Å; L19-L23 PolarHBondContact O-N 2.99Å
24	G	45.2	Very low	52	Low	40 Å²	40	120.8 Å²	120.8	41%	0.412	68%	0.68	S	S	.	*	H	α-helix	trans	-78	-23.1	-176.8	0	0	0	0	0	114.2	S20 R26 A27	S20-G24 WeakPolarHBondContact O-CA 3.33Å; S20-G24 PolarHBondContact O-N 2.89Å; G24-R26 PolarHBondContact O-N 2.74Å; G24-A27 PolarHBondContact O-N 3.4Å; G24-A27 VanDerWaalsContact O-N 3.09Å
25	D	46.7	Very low	51	Low	159 Å²	159	119.9 Å²	119.9	85%	0.85	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.5	-3	175.4	-140.3	19.5	0	0	0	112.9
26	R	47.1	Very low	49.6	Very low	235 Å²	235	119.1 Å²	119.1	89%	0.887	70%	0.697	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.9	-3.5	172.4	-110.6	-172.2	174.8	139.3	0	115.1	G24 N28	G24-R26 PolarHBondContact O-N 2.74Å; R26-N28 PolarHBondContact O-N 3.38Å
27	A	40.7	Very low	48.2	Very low	79 Å²	79	122.5 Å²	122.5	65%	0.653	71%	0.712	S	S	*	*			trans	-99.7	56.7	178.4	0	0	0	0	0	111.3	G24	G24-A27 PolarHBondContact O-N 3.4Å; G24-A27 VanDerWaalsContact O-N 3.09Å
28	N	48	Very low	47	Very low	140 Å²	140	123.6 Å²	123.6	75%	0.749	73%	0.725	S	S	*	*			trans	-143.8	84.7	156.7	-174.6	7.9	0	0	0	110.7	R26	R26-N28 PolarHBondContact O-N 3.38Å
29	P	45.7	Very low	46.1	Very low	109 Å²	109	125.3 Å²	125.3	71%	0.708	74%	0.74	S	S	*	*			trans	-97.5	126.3	152	30.5	-16.9	0	0	0	109.5
30	D	47	Very low	45.4	Very low	138 Å²	138	128.4 Å²	128.4	74%	0.738	75%	0.751	S	S	*	*			trans	65.7	88.1	157.2	-80.9	-32.4	0	0	0	119.2
31	L	47.1	Very low	44.8	Very low	177 Å²	177	130.4 Å²	130.4	93%	0.927	76%	0.762	S	S	*	*			trans	-119.6	50.8	133.5	-136.8	102.9	0	0	0	110.8
32	R	44.8	Very low	43.8	Very low	236 Å²	236	131.7 Å²	131.7	89%	0.891	78%	0.775	S	S	*	*			trans	-96.8	79.4	168	-154.6	-172.8	-150.5	-156.2	7.6	109.8
33	A	46	Very low	43.5	Very low	97 Å²	97	132.5 Å²	132.5	80%	0.802	79%	0.786	S	S	*	*			trans	-135.5	78.9	162	0	0	0	0	0	109.8
34	H	34.6	Very low	43.1	Very low	183 Å²	183	129.5 Å²	129.5	85%	0.847	79%	0.789	S	S	*	*			trans	-148.2	138.5	155	-145.2	54.6	0	0	0	111.1
35	P	52.1	Low	43.2	Very low	105 Å²	105	132.3 Å²	132.3	68%	0.682	81%	0.808	S	S	*	*			trans	-90.2	157.6	-139	35	-34.4	0	0	0	113.6
36	G	40.9	Very low	42.7	Very low	80 Å²	80	131.2 Å²	131.2	83%	0.825	81%	0.807	S	S	*	*			trans	-66.3	144.7	-179.8	0	0	0	0	0	113.9
37	N	40.9	Very low	42.3	Very low	162 Å²	162	126.4 Å²	126.4	87%	0.866	80%	0.795	S	S	*	*			trans	-171.3	117.5	136.2	-163.7	-4.8	0	0	0	108.7
38	A	37.9	Very low	42.7	Very low	98 Å²	98	128.8 Å²	128.8	81%	0.81	80%	0.804	S	S	*	*			trans	-176	125.1	142.5	0	0	0	0	0	110.2
39	A	41.8	Very low	42.5	Very low	98 Å²	98	131.6 Å²	131.6	81%	0.81	80%	0.804	S	S	*	*			trans	-56.5	151.8	-179	0	0	0	0	0	115.4
40	H	39.3	Very low	42.9	Very low	178 Å²	178	138.1 Å²	138.1	82%	0.824	81%	0.814	S	S	*	*			trans	-58.1	167.6	153.7	-133.8	61.2	0	0	0	110.5
41	P	48.1	Very low	43	Very low	117 Å²	117	142.6 Å²	142.6	76%	0.76	82%	0.821	S	S	*	*			cis	-142.9	175.6	18	41.1	-20.9	0	0	0	115.7
42	G	31.7	Very low	43.4	Very low	76 Å²	76	139.7 Å²	139.7	78%	0.784	81%	0.812	S	S	*	*			trans	175	85.4	167.6	0	0	0	0	0	116
43	S	44.8	Very low	43.5	Very low	137 Å²	137	133.8 Å²	133.8	96%	0.958	81%	0.805	S	S	*	*			trans	-77	132.1	170.6	179.8	0	0	0	0	111.1
44	G	35	Very low	43.7	Very low	76 Å²	76	135.8 Å²	135.8	78%	0.784	80%	0.801	S	S	*	*			trans	-170.5	113.3	173.4	0	0	0	0	0	112.1
45	A	46.7	Very low	44.2	Very low	98 Å²	98	135.1 Å²	135.1	81%	0.81	80%	0.796	S	S	*	*			trans	-77.5	149.7	-176.1	0	0	0	0	0	113.8
46	T	36.4	Very low	43.9	Very low	137 Å²	137	135.2 Å²	135.2	84%	0.84	79%	0.791	S	S	*	*			trans	145.9	105	135.8	-56.9	0	0	0	0	111.7
47	E	39.2	Very low	44.2	Very low	133 Å²	133	137 Å²	137	62%	0.621	78%	0.778	S	S	*	*				173.6	118.2	126.6	-159.9	179.8	151	0	0	110.5	R49	E47-R49 VanDerWaalsContact C-N 3.35Å; E47-R49 HydrophobicContact CG-CB 4.37Å; E47-R49 PolarHBondContact O-N 2.86Å; E47-R49 WeakPolarHBondContact OE1-CD 3.44Å; E47-R49 IonicContact OE1-NH1 3.81Å
48	P	48.7	Very low	44.4	Very low	130 Å²	130	139.5 Å²	139.5	84%	0.844	78%	0.775	S	S	*	*			trans	-87.9	73.2	171.7	34.3	-29.1	0	0	0	109.6	R50	P48-R50 PolarHBondContact O-N 3.35Å; P48-R50 VanDerWaalsContact O-N 3.15Å
49	R	44.4	Very low	44.8	Very low	199 Å²	199	141.6 Å²	141.6	75%	0.751	77%	0.768	S	S	*	*			trans	-82.5	97.6	178.4	-157.5	171.5	-174.2	152.4	-4.5	110.3	E47 R51	E47-R49 VanDerWaalsContact C-N 3.35Å; E47-R49 HydrophobicContact CG-CB 4.37Å; E47-R49 PolarHBondContact O-N 2.86Å; E47-R49 WeakPolarHBondContact OE1-CD 3.44Å; E47-R49 IonicContact OE1-NH1 3.81Å; R49-R51 PolarHBondContact O-N 2.93Å; R49-R51 VanDerWaalsContact O-N 3.11Å
50	R	53.8	Low	44.9	Very low	246 Å²	246	146.2 Å²	146.2	93%	0.928	76%	0.764	S	S	*	*			trans	-31.4	111.7	166.1	-80.4	-178.7	175.6	151.2	-2.4	111.5	P48	P48-R50 PolarHBondContact O-N 3.35Å; P48-R50 VanDerWaalsContact O-N 3.15Å
51	R	49.8	Very low	45.2	Very low	231 Å²	231	142.3 Å²	142.3	87%	0.872	75%	0.753	S	S	*	*	P	Polyproline II helix	trans	-101.5	135.4	157.2	-72.7	-171.4	-167.4	180	4.6	108.5	R49	R49-R51 PolarHBondContact O-N 2.93Å; R49-R51 VanDerWaalsContact O-N 3.11Å
52	P	53.9	Low	45.2	Very low	116 Å²	116	147.5 Å²	147.5	75%	0.753	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-61.3	156	-177.5	20.5	-28.3	0	0	0	112.4
53	P	46.8	Very low	45.9	Very low	113 Å²	113	147.4 Å²	147.4	73%	0.734	75%	0.75	S	S	*	*	P	Polyproline II helix	trans	-66.1	141.4	-164.1	26.9	-33.1	0	0	0	111.8	K55	P53-K55 PolarHBondContact O-N 2.88Å
54	L	51.7	Low	46.2	Very low	139 Å²	139	144.3 Å²	144.3	73%	0.728	74%	0.739	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.3	31.2	173.8	-117.5	95.4	0	0	0	114.6
55	K	44.8	Very low	47.1	Very low	168 Å²	168	144.9 Å²	144.9	73%	0.73	73%	0.731	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.5	-25.9	-171.1	-148.3	165.8	179.3	-178.1	0	113.3	P53	P53-K55 PolarHBondContact O-N 2.88Å
56	D	46.2	Very low	47.6	Very low	107 Å²	107	145.3 Å²	145.3	57%	0.572	72%	0.719	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.3	-12.1	176.1	-76.4	-5.2	0	0	0	114.2	R58 E59 R60	D56-R58 VanDerWaalsContact C-N 3.34Å; D56-E59 PolarHBondContact O-N 2.95Å; D56-R60 PolarHBondContact O-N 3.26Å
57	Q	46.3	Very low	48.9	Very low	118 Å²	118	142.8 Å²	142.8	55%	0.551	71%	0.705	S	S	*	*	H	α-helix	trans	-70.7	-34.7	179.3	-167.4	-178.3	88.5	0	0	111	E59 R60 T61	Q57-E59 VanDerWaalsContact C-N 3.26Å; Q57-E59 PolarHBondContact O-N 2.97Å; Q57-R60 PolarHBondContact O-N 3.49Å; Q57-T61 HydrophobicContact CG-CG2 4.29Å; Q57-T61 WeakPolarHBondContact O-CG2 3.36Å; Q57-T61 PolarHBondContact O-N 3.43Å; Q57-T61 PolarHBondContact O-OG1 3.24Å
58	R	45.1	Very low	49.9	Very low	215 Å²	215	143.7 Å²	143.7	81%	0.811	71%	0.713	S	S	*	*	H	α-helix	trans	-67.9	-26.3	178.3	-160.3	177.5	-157.6	-144.3	4.5	112.7	D56 T61	D56-R58 VanDerWaalsContact C-N 3.34Å; R58-T61 WeakPolarHBondContact CA-OG1 3.43Å; R58-T61 PolarHBondContact O-OG1 3.41Å
59	E	45.5	Very low	50.7	Low	141 Å²	141	139.7 Å²	139.7	66%	0.659	70%	0.696	S	S	*	*	H	α-helix	trans	-83.4	-36.9	172.7	-74.8	175.9	154.3	0	0	111.6	D56 Q57 R62 A63	D56-E59 PolarHBondContact O-N 2.95Å; Q57-E59 VanDerWaalsContact C-N 3.26Å; Q57-E59 PolarHBondContact O-N 2.97Å; E59-R62 PolarHBondContact O-N 3.43Å; E59-A63 PolarHBondContact O-N 2.67Å
60	R	45.5	Very low	52.1	Low	195 Å²	195	131.7 Å²	131.7	74%	0.736	67%	0.672	S	S	*	*	H	α-helix	trans	-71.2	-26.9	173.3	-77.6	-173.1	-174.6	-179.7	2.6	114.7	D56 Q57 R62 A63 G64	D56-R60 PolarHBondContact O-N 3.26Å; Q57-R60 PolarHBondContact O-N 3.49Å; R60-R62 VanDerWaalsContact C-N 3.27Å; R60-A63 PolarHBondContact O-N 2.91Å; R60-G64 PolarHBondContact O-N 2.95Å
61	T	45.9	Very low	53.2	Low	97 Å²	97	123.9 Å²	123.9	60%	0.595	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77	-15.1	173	51.2	0	0	0	0	112.8	Q57 R58	Q57-T61 HydrophobicContact CG-CG2 4.29Å; Q57-T61 WeakPolarHBondContact O-CG2 3.36Å; Q57-T61 PolarHBondContact O-N 3.43Å; Q57-T61 PolarHBondContact O-OG1 3.24Å; R58-T61 WeakPolarHBondContact CA-OG1 3.43Å; R58-T61 PolarHBondContact O-OG1 3.41Å
62	R	46.4	Very low	54.1	Low	226 Å²	226	120.8 Å²	120.8	85%	0.853	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91	-16.1	170.5	-151.7	178.2	-158.2	-167.5	4.3	112.8	E59 R60	E59-R62 PolarHBondContact O-N 3.43Å; R60-R62 VanDerWaalsContact C-N 3.27Å
63	A	46.6	Very low	55.2	Low	74 Å²	74	119.5 Å²	119.5	61%	0.612	63%	0.628	S	S	*	*	S	Bend	trans	-87.3	-11.7	176.1	0	0	0	0	0	113.8	E59 R60	E59-A63 PolarHBondContact O-N 2.67Å; R60-A63 PolarHBondContact O-N 2.91Å
64	G	51.7	Low	56.6	Low	71 Å²	71	116.8 Å²	116.8	73%	0.732	62%	0.615	S	S	*	*	S	Bend	trans	-94.5	-10.1	-170.1	0	0	0	0	0	116.4	R60	R60-G64 PolarHBondContact O-N 2.95Å
65	S	53.8	Low	57.8	Low	88 Å²	88	112.5 Å²	112.5	62%	0.615	60%	0.6	S	S	*	*			trans	-115.8	74.8	172.6	68.4	0	0	0	0	108.4	P67	S65-P67 WeakPolarHBondContact O-CD 3.43Å
66	L	56.4	Low	59.5	Low	107 Å²	107	107.5 Å²	107.5	56%	0.56	58%	0.583	S	S	*	*			trans	-51.4	110.7	156.5	-87.7	144.4	0	0	0	105.1	L68 A70 L71	L66-L68 PolarHBondContact O-N 3.02Å; L66-A70 HydrophobicContact CD2-CB 4.28Å; L66-L71 HydrophobicContact CB-CD1 4.3Å; L66-L71 HydrophobicContact CB-CD2 3.67Å; L66-L71 HydrophobicContact CB-CG 3.79Å; L66-L71 HydrophobicContact CD1-CD2 3.93Å; L66-L71 HydrophobicContact CD2-CD2 4.32Å; L66-L71 HydrophobicContact CG-CD2 4.18Å
67	P	64.9	Low	61.2	Low	85 Å²	85	105.2 Å²	105.2	55%	0.552	58%	0.579	S	S	*	*			trans	-55.2	140.1	-176.1	18.6	-27	0	0	0	106.7	S65 G69 A70 L71	S65-P67 WeakPolarHBondContact O-CD 3.43Å; P67-G69 CarbonylContact O-C 3.52Å; P67-G69 PolarHBondContact O-N 3.02Å; P67-A70 HydrophobicContact CG-CB 3.6Å; P67-A70 WeakPolarHBondContact O-CA 3.43Å; P67-A70 WeakPolarHBondContact O-CB 3.42Å; P67-A70 PolarHBondContact O-N 2.81Å; P67-L71 PolarHBondContact O-N 2.75Å; P67-L71 VanDerWaalsContact O-N 3.08Å
68	L	60	Low	62.8	Low	151 Å²	151	102.3 Å²	102.3	79%	0.791	58%	0.576	S	S	*	*	H	α-helix	trans	-51.9	-30	-177.4	-166.6	66	0	0	0	111.4	L66 L71 Y72	L66-L68 PolarHBondContact O-N 3.02Å; L68-L71 PolarHBondContact O-N 3.19Å; L68-Y72 WeakPolarHBondContact O-CB 3.43Å; L68-Y72 PolarHBondContact O-N 3.41Å
69	G	65.6	Low	64.3	Low	46 Å²	46	97.6 Å²	97.6	47%	0.474	56%	0.561	S	S	.	*	H	α-helix	trans	-64.6	-38.5	169.5	0	0	0	0	0	115.3	P67 Y72 T73	P67-G69 CarbonylContact O-C 3.52Å; P67-G69 PolarHBondContact O-N 3.02Å; G69-Y72 PolarHBondContact O-N 3.39Å; G69-T73 WeakPolarHBondContact O-CG2 3.35Å; G69-T73 PolarHBondContact O-N 3.4Å; G69-T73 PolarHBondContact O-OG1 3.26Å
70	A	74.4	Confident	66	Low	31 Å²	31	94.6 Å²	94.6	26%	0.256	55%	0.552	S	S	.	*	H	α-helix	trans	-69.8	-34.6	172.9	0	0	0	0	0	112.7	L66 P67 Y72 T73 A74	L66-A70 HydrophobicContact CD2-CB 4.28Å; P67-A70 HydrophobicContact CG-CB 3.6Å; P67-A70 WeakPolarHBondContact O-CA 3.43Å; P67-A70 WeakPolarHBondContact O-CB 3.42Å; P67-A70 PolarHBondContact O-N 2.81Å; A70-Y72 VanDerWaalsContact C-N 3.33Å; A70-T73 VanDerWaalsContact CA-OG1 3.32Å; A70-T73 WeakPolarHBondContact CA-OG1 3.36Å; A70-T73 PolarHBondContact O-OG1 3.04Å; A70-T73 VanDerWaalsContact O-OG1 3.07Å; A70-A74 WeakPolarHBondContact O-CB 3.44Å; A70-A74 PolarHBondContact O-N 2.9Å
71	L	75.3	Confident	67.7	Low	83 Å²	83	90.4 Å²	90.4	44%	0.435	54%	0.544	S	S	.	.	H	α-helix	trans	-66.4	-39.3	171.7	-65.8	176.8	0	0	0	110.8	L66 P67 L68 A75	L66-L71 HydrophobicContact CB-CD1 4.3Å; L66-L71 HydrophobicContact CB-CD2 3.67Å; L66-L71 HydrophobicContact CB-CG 3.79Å; L66-L71 HydrophobicContact CD1-CD2 3.93Å; L66-L71 HydrophobicContact CD2-CD2 4.32Å; L66-L71 HydrophobicContact CG-CD2 4.18Å; P67-L71 PolarHBondContact O-N 2.75Å; P67-L71 VanDerWaalsContact O-N 3.08Å; L68-L71 PolarHBondContact O-N 3.19Å; L71-A75 VanDerWaalsContact O-CB 3.29Å; L71-A75 WeakPolarHBondContact O-CB 3.44Å; L71-A75 PolarHBondContact O-N 3.36Å
72	Y	70.3	Confident	69	Low	166 Å²	166	90.9 Å²	90.9	65%	0.651	54%	0.536	S	S	*	.	H	α-helix	trans	-65.1	-46.7	175.3	-177.4	-100.2	0	0	0	112.2	L68 G69 A70 A74 A75 V76	L68-Y72 WeakPolarHBondContact O-CB 3.43Å; L68-Y72 PolarHBondContact O-N 3.41Å; G69-Y72 PolarHBondContact O-N 3.39Å; A70-Y72 VanDerWaalsContact C-N 3.33Å; Y72-A74 PolarHBondContact O-N 3.4Å; Y72-A75 PolarHBondContact O-N 2.96Å; Y72-V76 HydrophobicContact CD1-CG2 4.3Å; Y72-V76 HydrophobicContact CE1-CG2 3.93Å; Y72-V76 HydrophobicContact CE2-CG2 4.28Å; Y72-V76 WeakPolarHBondContact O-CG2 3.34Å; Y72-V76 PolarHBondContact O-N 3.17Å
73	T	76	Confident	70.4	Confident	88 Å²	88	84.7 Å²	84.7	54%	0.54	52%	0.515	S	S	.	.	H	α-helix	trans	-65.8	-38.8	176.8	52.1	0	0	0	0	112	G69 A70 V76 A77	G69-T73 WeakPolarHBondContact O-CG2 3.35Å; G69-T73 PolarHBondContact O-N 3.4Å; G69-T73 PolarHBondContact O-OG1 3.26Å; A70-T73 VanDerWaalsContact CA-OG1 3.32Å; A70-T73 WeakPolarHBondContact CA-OG1 3.36Å; A70-T73 PolarHBondContact O-OG1 3.04Å; A70-T73 VanDerWaalsContact O-OG1 3.07Å; T73-V76 PolarHBondContact O-N 3.42Å; T73-A77 WeakPolarHBondContact O-CB 3.32Å; T73-A77 PolarHBondContact O-N 3.49Å
74	A	76.3	Confident	71.4	Confident	56 Å²	56	84.9 Å²	84.9	46%	0.463	51%	0.511	S	S	.	.	H	α-helix	trans	-63.4	-40.3	173.7	0	0	0	0	0	111.9	A70 Y72 A77 A78	A70-A74 WeakPolarHBondContact O-CB 3.44Å; A70-A74 PolarHBondContact O-N 2.9Å; Y72-A74 PolarHBondContact O-N 3.4Å; A74-A77 PolarHBondContact O-N 3.04Å; A74-A78 WeakPolarHBondContact O-CB 3.33Å; A74-A78 PolarHBondContact O-N 2.9Å
75	A	76.7	Confident	72.2	Confident	49 Å²	49	85 Å²	85	41%	0.405	49%	0.494	S	S	.	.	H	α-helix	trans	-67.1	-43.3	176.8	0	0	0	0	0	112.3	L71 Y72 A78 F79	L71-A75 VanDerWaalsContact O-CB 3.29Å; L71-A75 WeakPolarHBondContact O-CB 3.44Å; L71-A75 PolarHBondContact O-N 3.36Å; Y72-A75 PolarHBondContact O-N 2.96Å; A75-A78 PolarHBondContact O-N 2.67Å; A75-F79 VanDerWaalsContact O-CB 3.27Å; A75-F79 WeakPolarHBondContact O-CB 3.34Å; A75-F79 PolarHBondContact O-N 3.15Å
76	V	80.3	Confident	72.6	Confident	64 Å²	64	83.1 Å²	83.1	39%	0.388	48%	0.476	S	S	.	.	H	α-helix	trans	-64.8	-44.3	175	174.2	0	0	0	0	110.6	Y72 T73 F79 V80	Y72-V76 HydrophobicContact CD1-CG2 4.3Å; Y72-V76 HydrophobicContact CE1-CG2 3.93Å; Y72-V76 HydrophobicContact CE2-CG2 4.28Å; Y72-V76 WeakPolarHBondContact O-CG2 3.34Å; Y72-V76 PolarHBondContact O-N 3.17Å; T73-V76 PolarHBondContact O-N 3.42Å; V76-F79 PolarHBondContact O-N 2.68Å; V76-V80 HydrophobicContact CG1-CG2 4.35Å; V76-V80 WeakPolarHBondContact O-CB 3.46Å; V76-V80 VanDerWaalsContact O-CG2 3.27Å; V76-V80 WeakPolarHBondContact O-CG2 3.41Å; V76-V80 PolarHBondContact O-N 3.49Å
77	A	81.8	Confident	72.5	Confident	58 Å²	58	79.2 Å²	79.2	48%	0.479	46%	0.461	S	S	.	.	H	α-helix	trans	-62.3	-43.8	176.5	0	0	0	0	0	111.7	T73 A74 L81	T73-A77 WeakPolarHBondContact O-CB 3.32Å; T73-A77 PolarHBondContact O-N 3.49Å; A74-A77 PolarHBondContact O-N 3.04Å; A77-L81 WeakPolarHBondContact O-CB 2.78Å; A77-L81 PolarHBondContact O-N 3.47Å
78	A	80.1	Confident	72	Confident	58 Å²	58	81.2 Å²	81.2	48%	0.479	46%	0.461	S	S	.	.	H	α-helix	trans	-66	-37.7	175.8	0	0	0	0	0	112.2	A74 A75 Y82	A74-A78 WeakPolarHBondContact O-CB 3.33Å; A74-A78 PolarHBondContact O-N 2.9Å; A75-A78 PolarHBondContact O-N 2.67Å; A78-Y82 WeakPolarHBondContact O-CB 3.46Å; A78-Y82 PolarHBondContact O-N 3.07Å
79	F	77.3	Confident	71.6	Confident	115 Å²	115	79 Å²	79	50%	0.504	45%	0.45	S	S	.	.	H	α-helix	trans	-67.7	-45.3	176.7	179.4	-98.8	0	0	0	112.1	A75 V76 Y82 K83	A75-F79 VanDerWaalsContact O-CB 3.27Å; A75-F79 WeakPolarHBondContact O-CB 3.34Å; A75-F79 PolarHBondContact O-N 3.15Å; V76-F79 PolarHBondContact O-N 2.68Å; F79-Y82 PolarHBondContact O-N 2.69Å; F79-K83 HydrophobicContact CE1-CG 4.12Å; F79-K83 HydrophobicContact CE2-CG 4.46Å; F79-K83 HydrophobicContact CZ-CG 4.09Å; F79-K83 WeakPolarHBondContact O-CB 3.42Å; F79-K83 WeakPolarHBondContact O-CG 3.45Å; F79-K83 PolarHBondContact O-N 2.75Å
80	V	81.6	Confident	70.9	Confident	78 Å²	78	82 Å²	82	47%	0.473	45%	0.451	S	S	.	.	H	α-helix	trans	-64.4	-45.1	175.3	174	0	0	0	0	109.9	V76 Y82 K83 C84	V76-V80 HydrophobicContact CG1-CG2 4.35Å; V76-V80 WeakPolarHBondContact O-CB 3.46Å; V76-V80 VanDerWaalsContact O-CG2 3.27Å; V76-V80 WeakPolarHBondContact O-CG2 3.41Å; V76-V80 PolarHBondContact O-N 3.49Å; V80-Y82 VanDerWaalsContact C-N 3.34Å; V80-Y82 PolarHBondContact O-N 3.09Å; V80-K83 PolarHBondContact O-N 3.48Å; V80-K83 VanDerWaalsContact O-N 3.15Å; V80-C84 WeakPolarHBondContact O-CB 3.3Å; V80-C84 PolarHBondContact O-N 2.61Å; V80-C84 PolarHBondContact O-SG 3.07Å; V80-C84 VanDerWaalsContact O-SG 3.33Å
81	L	81.4	Confident	69.6	Low	108 Å²	108	84.1 Å²	84.1	57%	0.565	46%	0.461	S	S	*	.	H	α-helix	trans	-62.3	-41.3	176.7	-167	63.7	0	0	0	110.9	A77 K83 C84 L85	A77-L81 WeakPolarHBondContact O-CB 2.78Å; A77-L81 PolarHBondContact O-N 3.47Å; L81-K83 PolarHBondContact O-N 2.8Å; L81-C84 CarbonylContact O-C 3.58Å; L81-C84 PolarHBondContact O-N 3.06Å; L81-L85 HydrophobicContact CD1-CD1 3.78Å; L81-L85 HydrophobicContact CD2-CD1 4.48Å; L81-L85 HydrophobicContact CG-CD1 3.56Å; L81-L85 WeakPolarHBondContact O-CB 3.44Å; L81-L85 WeakPolarHBondContact O-CD1 3.06Å; L81-L85 PolarHBondContact O-N 2.87Å
82	Y	73.1	Confident	68.4	Low	107 Å²	107	83 Å²	83	42%	0.42	46%	0.464	S	S	.	.	H	α-helix	trans	-64.5	-35.5	173.7	175.3	-116.5	0	0	0	113.1	A78 F79 V80 Q86	A78-Y82 WeakPolarHBondContact O-CB 3.46Å; A78-Y82 PolarHBondContact O-N 3.07Å; F79-Y82 PolarHBondContact O-N 2.69Å; V80-Y82 VanDerWaalsContact C-N 3.34Å; V80-Y82 PolarHBondContact O-N 3.09Å; Y82-Q86 HydrophobicContact CE2-CG 4.1Å; Y82-Q86 VanDerWaalsContact CZ-CD 3.4Å; Y82-Q86 WeakPolarHBondContact O-CB 3.44Å; Y82-Q86 PolarHBondContact O-N 2.87Å; Y82-Q86 PolarHBondContact O-NE2 3.37Å; Y82-Q86 PolarHBondContact OH-OE1 2.94Å
83	K	74.7	Confident	67.3	Low	96 Å²	96	80.7 Å²	80.7	42%	0.417	47%	0.467	S	S	.	.	H	α-helix	trans	-73.1	-36.8	174.3	-77.1	-72.5	148.7	-159.4	0	112.1	F79 V80 L81 G87	F79-K83 HydrophobicContact CE1-CG 4.12Å; F79-K83 HydrophobicContact CE2-CG 4.46Å; F79-K83 HydrophobicContact CZ-CG 4.09Å; F79-K83 WeakPolarHBondContact O-CB 3.42Å; F79-K83 WeakPolarHBondContact O-CG 3.45Å; F79-K83 PolarHBondContact O-N 2.75Å; V80-K83 PolarHBondContact O-N 3.48Å; V80-K83 VanDerWaalsContact O-N 3.15Å; L81-K83 PolarHBondContact O-N 2.8Å; K83-G87 PolarHBondContact O-N 2.86Å
84	C	67.7	Low	66.1	Low	78 Å²	78	81.4 Å²	81.4	53%	0.527	47%	0.467	S	S	.	.	H	α-helix	trans	-67.6	-37.5	171.2	-71.2	0	0	0	0	112	V80 L81 G87 K88	V80-C84 WeakPolarHBondContact O-CB 3.3Å; V80-C84 PolarHBondContact O-N 2.61Å; V80-C84 PolarHBondContact O-SG 3.07Å; V80-C84 VanDerWaalsContact O-SG 3.33Å; L81-C84 CarbonylContact O-C 3.58Å; L81-C84 PolarHBondContact O-N 3.06Å; C84-G87 CarbonylContact O-C 3.59Å; C84-G87 PolarHBondContact O-N 2.8Å; C84-K88 VanDerWaalsContact O-CB 3.26Å; C84-K88 WeakPolarHBondContact O-CB 3.34Å; C84-K88 PolarHBondContact O-N 3.16Å
85	L	68.6	Low	64.6	Low	74 Å²	74	85.1 Å²	85.1	39%	0.387	48%	0.475	S	S	.	.	H	α-helix	trans	-73.7	-39.8	176.1	-91.9	100.4	0	0	0	112.4	L81 G87 K88 D89	L81-L85 HydrophobicContact CD1-CD1 3.78Å; L81-L85 HydrophobicContact CD2-CD1 4.48Å; L81-L85 HydrophobicContact CG-CD1 3.56Å; L81-L85 WeakPolarHBondContact O-CB 3.44Å; L81-L85 WeakPolarHBondContact O-CD1 3.06Å; L81-L85 PolarHBondContact O-N 2.87Å; L85-G87 VanDerWaalsContact C-N 3.3Å; L85-G87 PolarHBondContact O-N 3.33Å; L85-K88 CarbonylContact O-C 3.49Å; L85-K88 WeakPolarHBondContact O-CA 3.01Å; L85-K88 PolarHBondContact O-N 2.98Å; L85-K88 VanDerWaalsContact O-N 3.07Å; L85-D89 PolarHBondContact O-N 2.78Å
86	Q	62.3	Low	63.4	Low	48 Å²	48	90.9 Å²	90.9	22%	0.224	49%	0.493	C	S	.	.	H	α-helix	trans	-55	-52.5	168	-91.2	166.1	113.5	0	0	109.1	Y82 K88 D89 E90	Y82-Q86 HydrophobicContact CE2-CG 4.1Å; Y82-Q86 VanDerWaalsContact CZ-CD 3.4Å; Y82-Q86 WeakPolarHBondContact O-CB 3.44Å; Y82-Q86 PolarHBondContact O-N 2.87Å; Y82-Q86 PolarHBondContact O-NE2 3.37Å; Y82-Q86 PolarHBondContact OH-OE1 2.94Å; Q86-K88 PolarHBondContact O-N 2.93Å; Q86-K88 VanDerWaalsContact O-N 3.16Å; Q86-D89 PolarHBondContact O-N 3.32Å; Q86-E90 VanDerWaalsContact C-CD 3.48Å; Q86-E90 WeakPolarHBondContact CB-OE1 3.28Å; Q86-E90 WeakPolarHBondContact O-CG 3.34Å; Q86-E90 PolarHBondContact O-N 3.47Å
87	G	55	Low	61.9	Low	24 Å²	24	95.3 Å²	95.3	25%	0.247	51%	0.51	C	S	.	.	H	α-helix	trans	-55.3	-34.3	175.5	0	0	0	0	0	112.8	K83 C84 L85 E90 T91	K83-G87 PolarHBondContact O-N 2.86Å; C84-G87 CarbonylContact O-C 3.59Å; C84-G87 PolarHBondContact O-N 2.8Å; L85-G87 VanDerWaalsContact C-N 3.3Å; L85-G87 PolarHBondContact O-N 3.33Å; G87-E90 WeakPolarHBondContact CA-OE1 3.07Å; G87-E90 PolarHBondContact N-OE1 3.15Å; G87-T91 WeakPolarHBondContact O-CB 3.43Å; G87-T91 WeakPolarHBondContact O-CG2 3.47Å; G87-T91 PolarHBondContact O-N 3.49Å; G87-T91 PolarHBondContact O-OG1 2.86Å
88	K	53.4	Low	60.3	Low	127 Å²	127	94 Å²	94	55%	0.552	50%	0.498	S	S	*	.	H	α-helix	trans	-77.9	-32	177.6	-160.7	174.5	68.2	165.1	0	113.8	C84 L85 Q86 T91 A92	C84-K88 VanDerWaalsContact O-CB 3.26Å; C84-K88 WeakPolarHBondContact O-CB 3.34Å; C84-K88 PolarHBondContact O-N 3.16Å; L85-K88 CarbonylContact O-C 3.49Å; L85-K88 WeakPolarHBondContact O-CA 3.01Å; L85-K88 PolarHBondContact O-N 2.98Å; L85-K88 VanDerWaalsContact O-N 3.07Å; Q86-K88 PolarHBondContact O-N 2.93Å; Q86-K88 VanDerWaalsContact O-N 3.16Å; K88-T91 VanDerWaalsContact CA-OG1 3.28Å; K88-T91 WeakPolarHBondContact CA-OG1 3.46Å; K88-T91 CarbonylContact O-C 3.57Å; K88-T91 PolarHBondContact O-OG1 2.84Å; K88-A92 WeakPolarHBondContact O-CA 3.11Å; K88-A92 WeakPolarHBondContact O-CB 3.19Å; K88-A92 PolarHBondContact O-N 3.03Å
89	D	52.2	Low	58.7	Low	106 Å²	106	94.4 Å²	94.4	57%	0.567	50%	0.498	S	S	*	.	H	α-helix	trans	-81.4	-34.3	175.4	-77.7	-29.3	0	0	0	111.2	L85 Q86 A92 V93	L85-D89 PolarHBondContact O-N 2.78Å; Q86-D89 PolarHBondContact O-N 3.32Å; D89-A92 PolarHBondContact O-N 3.43Å; D89-V93 WeakPolarHBondContact O-CB 3.12Å; D89-V93 WeakPolarHBondContact O-CG2 3.32Å; D89-V93 PolarHBondContact O-N 2.79Å; D89-V93 VanDerWaalsContact O-N 3.09Å
90	E	50.5	Low	57.5	Low	107 Å²	107	96.9 Å²	96.9	50%	0.5	51%	0.509	S	S	.	.	H	α-helix	trans	-74.5	-27.4	170.1	60.7	-140.3	145.8	0	0	112.3	Q86 G87 L94	Q86-E90 VanDerWaalsContact C-CD 3.48Å; Q86-E90 WeakPolarHBondContact CB-OE1 3.28Å; Q86-E90 WeakPolarHBondContact O-CG 3.34Å; Q86-E90 PolarHBondContact O-N 3.47Å; G87-E90 WeakPolarHBondContact CA-OE1 3.07Å; G87-E90 PolarHBondContact N-OE1 3.15Å; E90-L94 WeakPolarHBondContact O-CB 3.41Å; E90-L94 WeakPolarHBondContact O-CD1 3.26Å; E90-L94 WeakPolarHBondContact O-CG 3.02Å; E90-L94 PolarHBondContact O-N 3.36Å
91	T	47	Very low	56.3	Low	76 Å²	76	100.5 Å²	100.5	47%	0.466	52%	0.52	S	S	.	.	H	α-helix	trans	-84.4	-23.5	165.7	56.6	0	0	0	0	114	G87 K88 V93 H95	G87-T91 WeakPolarHBondContact O-CB 3.43Å; G87-T91 WeakPolarHBondContact O-CG2 3.47Å; G87-T91 PolarHBondContact O-N 3.49Å; G87-T91 PolarHBondContact O-OG1 2.86Å; K88-T91 VanDerWaalsContact CA-OG1 3.28Å; K88-T91 WeakPolarHBondContact CA-OG1 3.46Å; K88-T91 CarbonylContact O-C 3.57Å; K88-T91 PolarHBondContact O-OG1 2.84Å; T91-V93 VanDerWaalsContact C-N 3.33Å; T91-H95 VanDerWaalsContact O-CA 3.3Å; T91-H95 WeakPolarHBondContact O-CA 3.38Å; T91-H95 WeakPolarHBondContact O-CB 3.34Å; T91-H95 PolarHBondContact O-N 2.83Å
92	A	50.5	Low	54.9	Low	60 Å²	60	101.9 Å²	101.9	50%	0.496	52%	0.524	S	S	.	.	H	α-helix	trans	-70.7	-36.1	173.1	0	0	0	0	0	110.5	K88 D89	K88-A92 WeakPolarHBondContact O-CA 3.11Å; K88-A92 WeakPolarHBondContact O-CB 3.19Å; K88-A92 PolarHBondContact O-N 3.03Å; D89-A92 PolarHBondContact O-N 3.43Å
93	V	47.6	Very low	54.1	Low	117 Å²	117	99.2 Å²	99.2	71%	0.709	52%	0.52	S	S	*	.	H	α-helix	trans	-80.4	-32.2	173.9	178.6	0	0	0	0	112.1	D89 T91	D89-V93 WeakPolarHBondContact O-CB 3.12Å; D89-V93 WeakPolarHBondContact O-CG2 3.32Å; D89-V93 PolarHBondContact O-N 2.79Å; D89-V93 VanDerWaalsContact O-N 3.09Å; T91-V93 VanDerWaalsContact C-N 3.33Å
94	L	49.4	Very low	53.2	Low	104 Å²	104	99.7 Å²	99.7	55%	0.545	53%	0.526	S	S	.	.	H	α-helix	trans	-89.1	-23.8	176.2	-71.5	168.2	0	0	0	115.3	E90 E96 E97 A98	E90-L94 WeakPolarHBondContact O-CB 3.41Å; E90-L94 WeakPolarHBondContact O-CD1 3.26Å; E90-L94 WeakPolarHBondContact O-CG 3.02Å; E90-L94 PolarHBondContact O-N 3.36Å; L94-E96 VanDerWaalsContact C-N 3.3Å; L94-E96 PolarHBondContact O-N 3.49Å; L94-E97 CarbonylContact O-C 3.57Å; L94-E97 PolarHBondContact O-N 2.91Å; L94-E97 VanDerWaalsContact O-N 3.17Å; L94-A98 WeakPolarHBondContact O-CA 3.04Å; L94-A98 WeakPolarHBondContact O-CB 3.36Å; L94-A98 PolarHBondContact O-N 2.85Å
95	H	45.2	Very low	52.8	Low	133 Å²	133	102 Å²	102	62%	0.616	53%	0.529	S	S	*	.	H	α-helix	trans	-74.1	-25.3	-178.3	-177.5	-90.8	0	0	0	111.7	T91 E97 S99	T91-H95 VanDerWaalsContact O-CA 3.3Å; T91-H95 WeakPolarHBondContact O-CA 3.38Å; T91-H95 WeakPolarHBondContact O-CB 3.34Å; T91-H95 PolarHBondContact O-N 2.83Å; H95-E97 PolarHBondContact O-N 3.29Å; H95-S99 WeakPolarHBondContact O-CB 3.14Å; H95-S99 PolarHBondContact O-N 3.5Å; H95-S99 PolarHBondContact O-OG 2.88Å
96	E	51.2	Low	52.5	Low	171 Å²	171	101.5 Å²	101.5	80%	0.799	53%	0.532	S	S	*	.	H	α-helix	trans	-64.4	-28.4	169.8	-155.6	174.8	108.9	0	0	111.6	L94	L94-E96 VanDerWaalsContact C-N 3.3Å; L94-E96 PolarHBondContact O-N 3.49Å
97	E	48.8	Very low	52.9	Low	157 Å²	157	104.9 Å²	104.9	73%	0.734	55%	0.548	S	S	*	.	H	α-helix	trans	-107.3	-29	177.1	-75.1	-143.7	134.8	0	0	115.9	L94 H95	L94-E97 CarbonylContact O-C 3.57Å; L94-E97 PolarHBondContact O-N 2.91Å; L94-E97 VanDerWaalsContact O-N 3.17Å; H95-E97 PolarHBondContact O-N 3.29Å
98	A	48.5	Very low	53.9	Low	29 Å²	29	110.5 Å²	110.5	24%	0.24	57%	0.568	C	S	.	*	H	α-helix	trans	-89.5	-15.6	-172.7	0	0	0	0	0	113.7	L94 K100 Q101 Q102	L94-A98 WeakPolarHBondContact O-CA 3.04Å; L94-A98 WeakPolarHBondContact O-CB 3.36Å; L94-A98 PolarHBondContact O-N 2.85Å; A98-K100 PolarHBondContact O-N 3.17Å; A98-Q101 PolarHBondContact O-N 3.45Å; A98-Q101 VanDerWaalsContact O-N 3.15Å; A98-Q102 WeakPolarHBondContact O-CB 3.1Å; A98-Q102 PolarHBondContact O-N 2.84Å
99	S	46.3	Very low	55	Low	67 Å²	67	109.6 Å²	109.6	47%	0.469	57%	0.566	S	S	.	*	T	Hydrogen-bonded Turn	trans	-62.9	-8.1	173.2	60.2	0	0	0	0	113.7	H95	H95-S99 WeakPolarHBondContact O-CB 3.14Å; H95-S99 PolarHBondContact O-N 3.5Å; H95-S99 PolarHBondContact O-OG 2.88Å
100	K	53.6	Low	56.4	Low	168 Å²	168	110 Å²	110	73%	0.73	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.9	-21.1	173.3	-65.6	-169.1	179.2	-166.2	0	115.2	A98	A98-K100 PolarHBondContact O-N 3.17Å
101	Q	54.3	Low	58	Low	154 Å²	154	107.8 Å²	107.8	72%	0.72	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.2	-27.9	-174.1	-62.6	-161.5	13.9	0	0	114.7	A98 P103	A98-Q101 PolarHBondContact O-N 3.45Å; A98-Q101 VanDerWaalsContact O-N 3.15Å; Q101-P103 VanDerWaalsContact C-CD 3.46Å
102	Q	53.2	Low	59.9	Low	137 Å²	137	110.5 Å²	110.5	64%	0.64	57%	0.574	S	S	*	*	H	α-helix	trans	-67	-31.3	174.4	-142.2	163.9	19.8	0	0	115.3	A98 L104 S106	A98-Q102 WeakPolarHBondContact O-CB 3.1Å; A98-Q102 PolarHBondContact O-N 2.84Å; Q102-L104 VanDerWaalsContact C-N 3.32Å; Q102-L104 PolarHBondContact O-N 2.83Å; Q102-S106 PolarHBondContact O-N 3.07Å; Q102-S106 PolarHBondContact O-OG 3.44Å
103	P	55.5	Low	61.7	Low	51 Å²	51	112.7 Å²	112.7	33%	0.331	58%	0.577	S	S	.	*	H	α-helix	trans	-63	-38.4	176.3	21.5	-31.5	0	0	0	112.1	Q101 Q105 S106 E107	Q101-P103 VanDerWaalsContact C-CD 3.46Å; P103-Q105 PolarHBondContact O-N 2.74Å; P103-S106 WeakPolarHBondContact CA-OG 3.44Å; P103-S106 PolarHBondContact O-N 3.38Å; P103-S106 PolarHBondContact O-OG 3.43Å; P103-E107 WeakPolarHBondContact O-CB 3.47Å; P103-E107 WeakPolarHBondContact O-CG 3.18Å; P103-E107 PolarHBondContact O-N 3.01Å
104	L	56.1	Low	63.5	Low	106 Å²	106	111.3 Å²	111.3	56%	0.555	57%	0.569	S	S	*	*	H	α-helix	trans	-65	-39	-176.6	-63.2	176.7	0	0	0	113.1	Q102 Q108	Q102-L104 VanDerWaalsContact C-N 3.32Å; Q102-L104 PolarHBondContact O-N 2.83Å; L104-Q108 WeakPolarHBondContact O-CB 3.18Å; L104-Q108 WeakPolarHBondContact O-CG 3.27Å; L104-Q108 PolarHBondContact O-N 3.25Å
105	Q	59.3	Low	65.4	Low	125 Å²	125	112.3 Å²	112.3	58%	0.584	57%	0.571	S	S	*	*	H	α-helix	trans	-71.3	-36.9	177	-160.4	-178.4	16.1	0	0	111.3	P103 Q109	P103-Q105 PolarHBondContact O-N 2.74Å; Q105-Q109 WeakPolarHBondContact O-CG 3.47Å; Q105-Q109 PolarHBondContact O-N 3.21Å
106	S	62.9	Low	67.6	Low	64 Å²	64	111.2 Å²	111.2	45%	0.448	57%	0.566	S	S	.	*	H	α-helix	trans	-69.8	-36.5	175.9	70.8	0	0	0	0	112.8	Q102 P103 Q109 L110	Q102-S106 PolarHBondContact O-N 3.07Å; Q102-S106 PolarHBondContact O-OG 3.44Å; P103-S106 WeakPolarHBondContact CA-OG 3.44Å; P103-S106 PolarHBondContact O-N 3.38Å; P103-S106 PolarHBondContact O-OG 3.43Å; S106-Q109 PolarHBondContact O-N 2.99Å; S106-L110 WeakPolarHBondContact O-CB 3.4Å; S106-L110 PolarHBondContact O-N 3.44Å
107	E	71.6	Confident	69.5	Low	120 Å²	120	108.7 Å²	108.7	56%	0.561	56%	0.557	S	S	*	*	H	α-helix	trans	-69.6	-39.4	175.5	-75.8	-173.4	111.7	0	0	111.7	P103 L110 A111	P103-E107 WeakPolarHBondContact O-CB 3.47Å; P103-E107 WeakPolarHBondContact O-CG 3.18Å; P103-E107 PolarHBondContact O-N 3.01Å; E107-L110 PolarHBondContact O-N 3.36Å; E107-A111 WeakPolarHBondContact O-CB 3.35Å; E107-A111 PolarHBondContact O-N 3.26Å
108	Q	75.8	Confident	71.4	Confident	141 Å²	141	103.7 Å²	103.7	66%	0.659	54%	0.543	S	S	*	.	H	α-helix	trans	-63.1	-41.5	172.6	-77.9	-178.9	-12.8	0	0	112.1	L104 A111 Q112	L104-Q108 WeakPolarHBondContact O-CB 3.18Å; L104-Q108 WeakPolarHBondContact O-CG 3.27Å; L104-Q108 PolarHBondContact O-N 3.25Å; Q108-A111 PolarHBondContact O-N 2.91Å; Q108-Q112 WeakPolarHBondContact O-CB 3.32Å; Q108-Q112 PolarHBondContact O-N 3.29Å
109	Q	76.1	Confident	73.3	Confident	109 Å²	109	108.1 Å²	108.1	51%	0.509	56%	0.559	S	S	.	*	H	α-helix	trans	-64.4	-39.4	174.2	-76.1	177.3	-8.9	0	0	112	Q105 S106 Q112 L113	Q105-Q109 WeakPolarHBondContact O-CG 3.47Å; Q105-Q109 PolarHBondContact O-N 3.21Å; S106-Q109 PolarHBondContact O-N 2.99Å; Q109-Q112 PolarHBondContact O-N 3.44Å; Q109-L113 WeakPolarHBondContact O-CB 3.44Å; Q109-L113 WeakPolarHBondContact O-CG 3.19Å; Q109-L113 PolarHBondContact O-N 3.08Å
110	L	80.9	Confident	75.2	Confident	115 Å²	115	108.1 Å²	108.1	60%	0.602	56%	0.556	S	S	*	*	H	α-helix	trans	-64.4	-42.8	175.9	-165.7	92.8	0	0	0	111.6	S106 E107 Q112 L113 T114	S106-L110 WeakPolarHBondContact O-CB 3.4Å; S106-L110 PolarHBondContact O-N 3.44Å; E107-L110 PolarHBondContact O-N 3.36Å; L110-Q112 VanDerWaalsContact C-N 3.34Å; L110-L113 PolarHBondContact O-N 3.26Å; L110-T114 WeakPolarHBondContact O-CB 3.29Å; L110-T114 PolarHBondContact O-N 2.89Å; L110-T114 PolarHBondContact O-OG1 2.88Å
111	A	83.6	Confident	77	Confident	59 Å²	59	106.4 Å²	106.4	49%	0.488	55%	0.55	S	S	.	*	H	α-helix	trans	-62.9	-42.3	175.9	0	0	0	0	0	111.3	E107 Q108 T114 Q115	E107-A111 WeakPolarHBondContact O-CB 3.35Å; E107-A111 PolarHBondContact O-N 3.26Å; Q108-A111 PolarHBondContact O-N 2.91Å; A111-T114 PolarHBondContact O-N 3.47Å; A111-Q115 WeakPolarHBondContact O-CB 3.27Å; A111-Q115 PolarHBondContact O-N 3.24Å
112	Q	87	Confident	78.5	Confident	134 Å²	134	106 Å²	106	63%	0.626	55%	0.549	S	S	*	.	H	α-helix	trans	-64	-43.1	176.6	-168.3	178.5	-1.9	0	0	111.9	Q108 Q109 L110 Q115 Q116	Q108-Q112 WeakPolarHBondContact O-CB 3.32Å; Q108-Q112 PolarHBondContact O-N 3.29Å; Q109-Q112 PolarHBondContact O-N 3.44Å; L110-Q112 VanDerWaalsContact C-N 3.34Å; Q112-Q115 PolarHBondContact O-N 3.36Å; Q112-Q116 WeakPolarHBondContact O-CB 3.13Å; Q112-Q116 PolarHBondContact O-N 3.11Å
113	L	88.5	Confident	80.2	Confident	106 Å²	106	105.2 Å²	105.2	56%	0.555	55%	0.545	S	S	*	.	H	α-helix	trans	-65.1	-40.9	175.3	-74.5	172.2	0	0	0	111.9	Q109 L110 Q115 Q116 L117	Q109-L113 WeakPolarHBondContact O-CB 3.44Å; Q109-L113 WeakPolarHBondContact O-CG 3.19Å; Q109-L113 PolarHBondContact O-N 3.08Å; L110-L113 PolarHBondContact O-N 3.26Å; L113-Q115 VanDerWaalsContact C-N 3.34Å; L113-Q115 PolarHBondContact O-N 2.69Å; L113-Q116 PolarHBondContact O-N 2.95Å; L113-L117 WeakPolarHBondContact O-CB 3.36Å; L113-L117 PolarHBondContact O-N 2.94Å
114	T	86.8	Confident	81.7	Confident	87 Å²	87	107.6 Å²	107.6	53%	0.534	55%	0.554	S	S	.	*	H	α-helix	trans	-63.5	-42.2	177.5	-56.5	0	0	0	0	111	L110 A111 L117 A118	L110-T114 WeakPolarHBondContact O-CB 3.29Å; L110-T114 PolarHBondContact O-N 2.89Å; L110-T114 PolarHBondContact O-OG1 2.88Å; A111-T114 PolarHBondContact O-N 3.47Å; T114-L117 WeakPolarHBondContact O-CB 3.43Å; T114-L117 PolarHBondContact O-N 3.49Å; T114-A118 PolarHBondContact O-N 2.89Å
115	Q	89.2	Confident	83.2	Confident	125 Å²	125	107.4 Å²	107.4	58%	0.584	55%	0.554	S	S	*	*	H	α-helix	trans	-64.9	-41	175.1	-174.1	176.8	-12.9	0	0	111.7	A111 Q112 L113 L117 A118 Q119	A111-Q115 WeakPolarHBondContact O-CB 3.27Å; A111-Q115 PolarHBondContact O-N 3.24Å; Q112-Q115 PolarHBondContact O-N 3.36Å; L113-Q115 VanDerWaalsContact C-N 3.34Å; L113-Q115 PolarHBondContact O-N 2.69Å; Q115-L117 VanDerWaalsContact C-N 3.26Å; Q115-L117 PolarHBondContact O-N 3.32Å; Q115-A118 PolarHBondContact O-N 3.37Å; Q115-Q119 WeakPolarHBondContact O-CG 3.48Å; Q115-Q119 PolarHBondContact O-N 3.15Å
116	Q	89.9	Confident	84.5	Confident	111 Å²	111	105.8 Å²	105.8	52%	0.519	55%	0.549	S	S	.	.	H	α-helix	trans	-63	-36.5	174.8	-167.2	-175.5	-42.1	0	0	111.3	Q112 L113 Q119 T120	Q112-Q116 WeakPolarHBondContact O-CB 3.13Å; Q112-Q116 PolarHBondContact O-N 3.11Å; L113-Q116 PolarHBondContact O-N 2.95Å; Q116-Q119 PolarHBondContact O-N 3.49Å; Q116-T120 WeakPolarHBondContact O-CB 3.39Å; Q116-T120 PolarHBondContact O-N 2.85Å; Q116-T120 PolarHBondContact O-OG1 3.47Å
117	L	91.1	Very high	85.6	Confident	117 Å²	117	106.1 Å²	106.1	61%	0.613	55%	0.545	S	S	*	.	H	α-helix	trans	-66.1	-45.7	177.2	-140.2	153.3	0	0	0	111.3	L113 T114 Q115 Q119 T120 E121	L113-L117 WeakPolarHBondContact O-CB 3.36Å; L113-L117 PolarHBondContact O-N 2.94Å; T114-L117 WeakPolarHBondContact O-CB 3.43Å; T114-L117 PolarHBondContact O-N 3.49Å; Q115-L117 VanDerWaalsContact C-N 3.26Å; Q115-L117 PolarHBondContact O-N 3.32Å; L117-Q119 VanDerWaalsContact C-N 3.35Å; L117-Q119 PolarHBondContact O-N 3.24Å; L117-T120 PolarHBondContact O-N 3.32Å; L117-E121 WeakPolarHBondContact O-CB 3.47Å; L117-E121 PolarHBondContact O-N 2.86Å
118	A	89.4	Confident	86	Confident	52 Å²	52	106.4 Å²	106.4	43%	0.43	55%	0.548	S	S	.	.	H	α-helix	trans	-62.2	-39.7	174.3	0	0	0	0	0	112.5	T114 Q115 T120 E121 Q122	T114-A118 PolarHBondContact O-N 2.89Å; Q115-A118 PolarHBondContact O-N 3.37Å; A118-T120 VanDerWaalsContact C-N 3.34Å; A118-E121 PolarHBondContact O-N 3.42Å; A118-Q122 WeakPolarHBondContact O-CB 3.34Å; A118-Q122 PolarHBondContact O-N 2.91Å
119	Q	88.4	Confident	86.3	Confident	123 Å²	123	102.6 Å²	102.6	58%	0.575	54%	0.541	S	S	*	.	H	α-helix	trans	-63.9	-40.1	173.8	-76.6	-175.7	-25.3	0	0	112.1	Q115 Q116 L117 Q122 H123	Q115-Q119 WeakPolarHBondContact O-CG 3.48Å; Q115-Q119 PolarHBondContact O-N 3.15Å; Q116-Q119 PolarHBondContact O-N 3.49Å; L117-Q119 VanDerWaalsContact C-N 3.35Å; L117-Q119 PolarHBondContact O-N 3.24Å; Q119-Q122 PolarHBondContact O-N 3.44Å; Q119-H123 WeakPolarHBondContact O-CB 3.24Å; Q119-H123 PolarHBondContact O-N 3.19Å
120	T	86.9	Confident	86.2	Confident	67 Å²	67	103 Å²	103	41%	0.411	54%	0.543	S	S	.	.	H	α-helix	trans	-69.5	-39.9	178.7	-49.7	0	0	0	0	110.8	Q116 L117 A118 H123 L124	Q116-T120 WeakPolarHBondContact O-CB 3.39Å; Q116-T120 PolarHBondContact O-N 2.85Å; Q116-T120 PolarHBondContact O-OG1 3.47Å; L117-T120 PolarHBondContact O-N 3.32Å; A118-T120 VanDerWaalsContact C-N 3.34Å; T120-H123 PolarHBondContact O-N 3.25Å; T120-L124 HydrophobicContact CG2-CD1 4.34Å; T120-L124 WeakPolarHBondContact O-CB 3.26Å; T120-L124 VanDerWaalsContact O-CG 3.29Å; T120-L124 WeakPolarHBondContact O-CG 3.32Å; T120-L124 PolarHBondContact O-N 2.84Å
121	E	89.8	Confident	85.9	Confident	132 Å²	132	101.7 Å²	101.7	62%	0.617	54%	0.536	S	S	*	.	H	α-helix	trans	-60	-46.9	174	-176.2	-178.7	168.9	0	0	111.2	L117 A118 H123 L124 N125	L117-E121 WeakPolarHBondContact O-CB 3.47Å; L117-E121 PolarHBondContact O-N 2.86Å; A118-E121 PolarHBondContact O-N 3.42Å; E121-H123 VanDerWaalsContact C-N 3.32Å; E121-H123 PolarHBondContact O-N 3.46Å; E121-L124 PolarHBondContact O-N 3.47Å; E121-N125 WeakPolarHBondContact O-CB 3.23Å; E121-N125 PolarHBondContact O-N 3.35Å
122	Q	86.3	Confident	85.3	Confident	146 Å²	146	104 Å²	104	68%	0.682	54%	0.54	S	S	*	.	H	α-helix	trans	-66.9	-35.4	178.5	-166	172	-7.9	0	0	112.1	A118 Q119 N125 N126	A118-Q122 WeakPolarHBondContact O-CB 3.34Å; A118-Q122 PolarHBondContact O-N 2.91Å; Q119-Q122 PolarHBondContact O-N 3.44Å; Q122-N125 PolarHBondContact O-N 2.85Å; Q122-N126 WeakPolarHBondContact O-CB 3.4Å; Q122-N126 PolarHBondContact O-N 2.88Å
123	H	88.6	Confident	84.4	Confident	120 Å²	120	101.8 Å²	101.8	56%	0.556	54%	0.537	S	S	*	.	H	α-helix	trans	-64.5	-44.2	173.8	-174.6	61.4	0	0	0	111.8	Q119 T120 E121 N126 L127	Q119-H123 WeakPolarHBondContact O-CB 3.24Å; Q119-H123 PolarHBondContact O-N 3.19Å; T120-H123 PolarHBondContact O-N 3.25Å; E121-H123 VanDerWaalsContact C-N 3.32Å; E121-H123 PolarHBondContact O-N 3.46Å; H123-N126 PolarHBondContact O-N 3.1Å; H123-L127 WeakPolarHBondContact O-CG 3.28Å; H123-L127 PolarHBondContact O-N 3.3Å
124	L	87.5	Confident	83.1	Confident	101 Å²	101	102.9 Å²	102.9	53%	0.529	54%	0.543	S	S	.	.	H	α-helix	trans	-65.8	-39.9	175.2	-71.6	174.1	0	0	0	112.1	T120 E121 N126 L127 M128	T120-L124 HydrophobicContact CG2-CD1 4.34Å; T120-L124 WeakPolarHBondContact O-CB 3.26Å; T120-L124 VanDerWaalsContact O-CG 3.29Å; T120-L124 WeakPolarHBondContact O-CG 3.32Å; T120-L124 PolarHBondContact O-N 2.84Å; E121-L124 PolarHBondContact O-N 3.47Å; L124-N126 VanDerWaalsContact C-N 3.3Å; L124-N126 PolarHBondContact O-N 3.41Å; L124-L127 HydrophobicContact CD2-CD1 4.49Å; L124-L127 PolarHBondContact O-N 2.71Å; L124-M128 WeakPolarHBondContact O-CB 3.21Å; L124-M128 PolarHBondContact O-N 2.83Å
125	N	87.8	Confident	81.8	Confident	102 Å²	102	106.6 Å²	106.6	55%	0.545	55%	0.552	S	S	.	*	H	α-helix	trans	-64.3	-37.6	177.2	-168	23.8	0	0	0	111.4	E121 Q122 M128 A129	E121-N125 WeakPolarHBondContact O-CB 3.23Å; E121-N125 PolarHBondContact O-N 3.35Å; Q122-N125 PolarHBondContact O-N 2.85Å; N125-M128 PolarHBondContact O-N 3.4Å; N125-A129 WeakPolarHBondContact O-CB 3.5Å; N125-A129 PolarHBondContact O-N 2.95Å
126	N	85.7	Confident	80.4	Confident	91 Å²	91	109.1 Å²	109.1	49%	0.487	56%	0.564	S	S	.	*	H	α-helix	trans	-66.4	-42.5	174.4	-161.1	-63.1	0	0	0	111.8	Q122 H123 L124 M128 A129 Q130	Q122-N126 WeakPolarHBondContact O-CB 3.4Å; Q122-N126 PolarHBondContact O-N 2.88Å; H123-N126 PolarHBondContact O-N 3.1Å; L124-N126 VanDerWaalsContact C-N 3.3Å; L124-N126 PolarHBondContact O-N 3.41Å; N126-M128 VanDerWaalsContact C-N 3.32Å; N126-M128 PolarHBondContact O-N 2.92Å; N126-A129 PolarHBondContact O-N 3.49Å; N126-Q130 WeakPolarHBondContact O-CG 3.38Å; N126-Q130 PolarHBondContact O-N 2.78Å; N126-Q130 PolarHBondContact OD1-NE2 3.29Å
127	L	86.6	Confident	78.6	Confident	70 Å²	70	118 Å²	118	37%	0.366	59%	0.592	S	S	.	*	H	α-helix	trans	-62.2	-39.9	173.5	-71.8	169.4	0	0	0	111.8	H123 L124 Q130 L131	H123-L127 WeakPolarHBondContact O-CG 3.28Å; H123-L127 PolarHBondContact O-N 3.3Å; L124-L127 HydrophobicContact CD2-CD1 4.49Å; L124-L127 PolarHBondContact O-N 2.71Å; L127-Q130 PolarHBondContact O-N 2.73Å; L127-L131 WeakPolarHBondContact O-CB 3.46Å; L127-L131 VanDerWaalsContact O-CG 3.28Å; L127-L131 WeakPolarHBondContact O-CG 3.48Å; L127-L131 PolarHBondContact O-N 2.95Å
128	M	80.9	Confident	77.9	Confident	126 Å²	126	118 Å²	118	62%	0.621	59%	0.591	S	S	*	*	H	α-helix	trans	-62.1	-47	175.8	-171	-177.9	-60.2	0	0	111.3	L124 N125 N126 Q130 L131 D132	L124-M128 WeakPolarHBondContact O-CB 3.21Å; L124-M128 PolarHBondContact O-N 2.83Å; N125-M128 PolarHBondContact O-N 3.4Å; N126-M128 VanDerWaalsContact C-N 3.32Å; N126-M128 PolarHBondContact O-N 2.92Å; M128-Q130 VanDerWaalsContact C-N 3.26Å; M128-Q130 PolarHBondContact O-N 3.38Å; M128-L131 PolarHBondContact O-N 2.92Å; M128-L131 VanDerWaalsContact O-N 3.13Å; M128-D132 PolarHBondContact O-N 3.36Å
129	A	81	Confident	77.3	Confident	62 Å²	62	121.5 Å²	121.5	51%	0.512	60%	0.6	S	S	.	*	H	α-helix	trans	-65.3	-26.3	176.4	0	0	0	0	0	113.5	N125 N126 P133	N125-A129 WeakPolarHBondContact O-CB 3.5Å; N125-A129 PolarHBondContact O-N 2.95Å; N126-A129 PolarHBondContact O-N 3.49Å; A129-P133 WeakPolarHBondContact O-CD 3.17Å
130	Q	73.8	Confident	76.7	Confident	117 Å²	117	121.4 Å²	121.4	55%	0.547	60%	0.601	S	S	.	*	H	α-helix	trans	-79	-28	173	-73.2	-179.8	26	0	0	113.1	N126 L127 M128 P133	N126-Q130 WeakPolarHBondContact O-CG 3.38Å; N126-Q130 PolarHBondContact O-N 2.78Å; N126-Q130 PolarHBondContact OD1-NE2 3.29Å; L127-Q130 PolarHBondContact O-N 2.73Å; M128-Q130 VanDerWaalsContact C-N 3.26Å; M128-Q130 PolarHBondContact O-N 3.38Å; Q130-P133 WeakPolarHBondContact O-CD 3.38Å; Q130-P133 WeakPolarHBondContact O-CG 3.45Å
131	L	74.8	Confident	76.1	Confident	88 Å²	88	124.6 Å²	124.6	46%	0.461	61%	0.613	S	S	.	*	H	α-helix	trans	-81	-32.4	177	-74.8	167.8	0	0	0	112	L127 M128 L134 F135	L127-L131 WeakPolarHBondContact O-CB 3.46Å; L127-L131 VanDerWaalsContact O-CG 3.28Å; L127-L131 WeakPolarHBondContact O-CG 3.48Å; L127-L131 PolarHBondContact O-N 2.95Å; M128-L131 PolarHBondContact O-N 2.92Å; M128-L131 VanDerWaalsContact O-N 3.13Å; L131-L134 HydrophobicContact CD2-CD1 4.29Å; L131-L134 WeakPolarHBondContact O-CB 3.45Å; L131-L134 PolarHBondContact O-N 2.83Å; L131-F135 HydrophobicContact CB-CE2 4.09Å; L131-F135 WeakPolarHBondContact O-CD2 3.4Å; L131-F135 PolarHBondContact O-N 3.09Å
132	D	71.2	Confident	75.3	Confident	107 Å²	107	124.1 Å²	124.1	57%	0.572	61%	0.612	S	S	*	*	H	α-helix	trans	-48.6	-49.2	177.9	-155.7	36.5	0	0	0	114	M128 L134 F135	M128-D132 PolarHBondContact O-N 3.36Å; D132-L134 VanDerWaalsContact C-N 3.25Å; D132-L134 PolarHBondContact O-N 3.05Å; D132-F135 PolarHBondContact O-N 3.42Å; D132-F135 VanDerWaalsContact O-N 3.12Å
133	P	68	Low	74.5	Confident	87 Å²	87	122.7 Å²	122.7	57%	0.565	61%	0.608	S	S	*	*	H	α-helix	trans	-71.1	-10.5	177	27	-35.4	0	0	0	115.2	A129 Q130	A129-P133 WeakPolarHBondContact O-CD 3.17Å; Q130-P133 WeakPolarHBondContact O-CD 3.38Å; Q130-P133 WeakPolarHBondContact O-CG 3.45Å
134	L	61	Low	73.5	Confident	130 Å²	130	122.9 Å²	122.9	68%	0.681	61%	0.611	S	S	*	*	H	α-helix	trans	-83.8	-16.6	171.9	-69.3	173.9	0	0	0	112.5	L131 D132	L131-L134 HydrophobicContact CD2-CD1 4.29Å; L131-L134 WeakPolarHBondContact O-CB 3.45Å; L131-L134 PolarHBondContact O-N 2.83Å; D132-L134 VanDerWaalsContact C-N 3.25Å; D132-L134 PolarHBondContact O-N 3.05Å
135	F	61.1	Low	72.5	Confident	165 Å²	165	124.5 Å²	124.5	72%	0.724	62%	0.618	S	S	*	*	H	α-helix	trans	-95.9	-9.9	179.9	-70.1	-73	0	0	0	114	L131 D132	L131-F135 HydrophobicContact CB-CE2 4.09Å; L131-F135 WeakPolarHBondContact O-CD2 3.4Å; L131-F135 PolarHBondContact O-N 3.09Å; D132-F135 PolarHBondContact O-N 3.42Å; D132-F135 VanDerWaalsContact O-N 3.12Å
136	E	59.4	Low	71.2	Confident	178 Å²	178	126.4 Å²	126.4	83%	0.832	62%	0.624	S	S	*	*			trans	-89.5	9.3	179.2	-77.8	-155.5	149	0	0	115.5
137	R	50.9	Low	69.9	Low	296 Å²	296	129.6 Å²	129.6	100%	1.117	64%	0.636	S	S	*	*			trans	-115.6	0	-179.5	-155	-171	-162.2	99.7	1.4	112.7

Retrieved 137 of 137 residues in 21.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).