X6RA56_HUMAN Loading...

Dynactin subunit 3

AlphaFold DB , UniProt , Accession X6RA56, Species HUMAN (Homo sapiens, Human), Gene DCTN3, Length 142 aa.

						>X6RA56_HUMAN|X6RA56|DCTN3
MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQVWEGR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.8	Low	76.9	Confident	205 Å²	205	111.9 Å²	111.9	100%	1.01	59%	0.592	S	S	*	*				0	-47.3	0	-63.8	-58.6	-85	0	0	112.6	G3 L4	M1-G3 PolarHBondContact O-N 3.13Å; M1-L4 PolarHBondContact O-N 2.96Å
2	A	60.8	Low	77.6	Confident	67 Å²	67	106.6 Å²	106.6	55%	0.554	58%	0.576	S	S	*	*	H	α-helix	trans	-62.3	-38.9	178.2	0	0	0	0	0	115.2	L4 T5 D6	A2-L4 PolarHBondContact O-N 3.29Å; A2-T5 PolarHBondContact O-N 3.35Å; A2-T5 PolarHBondContact O-OG1 2.96Å; A2-D6 PolarHBondContact O-N 3.04Å; A2-D6 VanDerWaalsContact O-N 3.14Å
3	G	69.3	Low	78.3	Confident	48 Å²	48	109.7 Å²	109.7	50%	0.495	57%	0.574	S	S	.	*	H	α-helix	trans	-64.2	-24.9	176.9	0	0	0	0	0	114.2	M1 L7	M1-G3 PolarHBondContact O-N 3.13Å; G3-L7 VanDerWaalsContact O-CG 3.29Å; G3-L7 WeakPolarHBondContact O-CG 3.49Å; G3-L7 PolarHBondContact O-N 3.16Å
4	L	74.1	Confident	78.7	Confident	112 Å²	112	106.6 Å²	106.6	59%	0.586	56%	0.562	S	S	*	*	H	α-helix	trans	-76.5	-37.1	177.8	-140.4	100.9	0	0	0	111.3	M1 A2 Q8	M1-L4 PolarHBondContact O-N 2.96Å; A2-L4 PolarHBondContact O-N 3.29Å; L4-Q8 VanDerWaalsContact O-CG 3.29Å; L4-Q8 WeakPolarHBondContact O-CG 3.43Å; L4-Q8 PolarHBondContact O-N 3.42Å
5	T	77.3	Confident	79	Confident	77 Å²	77	106.6 Å²	106.6	47%	0.472	56%	0.558	S	S	.	*	H	α-helix	trans	-70.9	-35.8	178	52.9	0	0	0	0	111.9	A2 Q8 R9	A2-T5 PolarHBondContact O-N 3.35Å; A2-T5 PolarHBondContact O-OG1 2.96Å; T5-Q8 PolarHBondContact O-N 3.06Å; T5-R9 WeakPolarHBondContact O-CB 3.38Å; T5-R9 PolarHBondContact O-N 2.83Å
6	D	81.6	Confident	79.2	Confident	97 Å²	97	107.5 Å²	107.5	52%	0.519	56%	0.558	S	S	.	*	H	α-helix	trans	-68.9	-39.4	176.2	-67.6	-28.9	0	0	0	111.8	A2 R9 L10	A2-D6 PolarHBondContact O-N 3.04Å; A2-D6 VanDerWaalsContact O-N 3.14Å; D6-R9 PolarHBondContact O-N 3.36Å; D6-L10 WeakPolarHBondContact O-CB 3.48Å; D6-L10 PolarHBondContact O-N 3.16Å
7	L	84.7	Confident	79.2	Confident	116 Å²	116	107.4 Å²	107.4	61%	0.607	56%	0.558	S	S	*	*	H	α-helix	trans	-63.9	-43.6	173.6	-76.2	172.2	0	0	0	112.1	G3 R9 L10 Q11	G3-L7 VanDerWaalsContact O-CG 3.29Å; G3-L7 WeakPolarHBondContact O-CG 3.49Å; G3-L7 PolarHBondContact O-N 3.16Å; L7-R9 PolarHBondContact O-N 3.29Å; L7-L10 PolarHBondContact O-N 3.27Å; L7-Q11 VanDerWaalsContact O-CB 3.31Å; L7-Q11 WeakPolarHBondContact O-CB 3.31Å; L7-Q11 PolarHBondContact O-N 2.73Å
8	Q	84.6	Confident	79.2	Confident	118 Å²	118	105.9 Å²	105.9	55%	0.551	55%	0.548	S	S	*	.	H	α-helix	trans	-62.3	-42	176	-75.4	172	-19.7	0	0	112.1	L4 T5 Q11 A12	L4-Q8 VanDerWaalsContact O-CG 3.29Å; L4-Q8 WeakPolarHBondContact O-CG 3.43Å; L4-Q8 PolarHBondContact O-N 3.42Å; T5-Q8 PolarHBondContact O-N 3.06Å; Q8-Q11 PolarHBondContact O-N 2.96Å; Q8-A12 PolarHBondContact O-N 3.47Å
9	R	86.9	Confident	79.1	Confident	177 Å²	177	109.7 Å²	109.7	67%	0.668	56%	0.555	S	S	*	*	H	α-helix	trans	-64.2	-41.5	175.9	-174.1	-179.8	-174.4	-173.5	2.8	111.8	T5 D6 L7 Q11 R13	T5-R9 WeakPolarHBondContact O-CB 3.38Å; T5-R9 PolarHBondContact O-N 2.83Å; D6-R9 PolarHBondContact O-N 3.36Å; L7-R9 PolarHBondContact O-N 3.29Å; R9-Q11 VanDerWaalsContact C-N 3.34Å; R9-R13 WeakPolarHBondContact O-CG 3.44Å; R9-R13 PolarHBondContact O-N 2.86Å
10	L	86.4	Confident	78.8	Confident	96 Å²	96	115.4 Å²	115.4	50%	0.503	57%	0.569	S	S	.	*	H	α-helix	trans	-66.4	-41.2	177.9	-163.6	70.3	0	0	0	110.6	D6 L7 R13 V14	D6-L10 WeakPolarHBondContact O-CB 3.48Å; D6-L10 PolarHBondContact O-N 3.16Å; L7-L10 PolarHBondContact O-N 3.27Å; L10-R13 PolarHBondContact O-N 3.43Å; L10-V14 VanDerWaalsContact O-CG2 3.29Å; L10-V14 WeakPolarHBondContact O-CG2 3.49Å; L10-V14 PolarHBondContact O-N 3.47Å
11	Q	86.8	Confident	78.4	Confident	118 Å²	118	113.4 Å²	113.4	55%	0.551	56%	0.563	S	S	*	*	H	α-helix	trans	-63.6	-44.8	178.4	-173.6	162.9	-19.4	0	0	112.3	L7 Q8 R9 R13 V14 E15	L7-Q11 VanDerWaalsContact O-CB 3.31Å; L7-Q11 WeakPolarHBondContact O-CB 3.31Å; L7-Q11 PolarHBondContact O-N 2.73Å; Q8-Q11 PolarHBondContact O-N 2.96Å; R9-Q11 VanDerWaalsContact C-N 3.34Å; Q11-R13 VanDerWaalsContact C-N 3.31Å; Q11-R13 PolarHBondContact O-N 2.88Å; Q11-V14 PolarHBondContact O-N 3Å; Q11-V14 VanDerWaalsContact O-N 3.15Å; Q11-E15 WeakPolarHBondContact CG-OE1 3.24Å; Q11-E15 PolarHBondContact NE2-OE1 3.32Å; Q11-E15 WeakPolarHBondContact O-CG 3.35Å; Q11-E15 PolarHBondContact O-N 3.41Å
12	A	85.6	Confident	79	Confident	48 Å²	48	108.2 Å²	108.2	40%	0.397	53%	0.533	S	S	.	.	H	α-helix	trans	-58.6	-41.8	175.1	0	0	0	0	0	112.4	Q8 E15 E16	Q8-A12 PolarHBondContact O-N 3.47Å; A12-E15 PolarHBondContact O-N 3.17Å; A12-E16 WeakPolarHBondContact O-CG 3.36Å; A12-E16 PolarHBondContact O-N 2.9Å
13	R	85.8	Confident	79.4	Confident	147 Å²	147	106.4 Å²	106.4	56%	0.555	52%	0.521	S	S	*	.	H	α-helix	trans	-66.3	-38.6	176.3	-71.2	176.5	67.9	-170	1.6	112.5	R9 L10 Q11 L17	R9-R13 WeakPolarHBondContact O-CG 3.44Å; R9-R13 PolarHBondContact O-N 2.86Å; L10-R13 PolarHBondContact O-N 3.43Å; Q11-R13 VanDerWaalsContact C-N 3.31Å; Q11-R13 PolarHBondContact O-N 2.88Å; R13-L17 WeakPolarHBondContact O-CB 3.22Å; R13-L17 VanDerWaalsContact O-CG 3.26Å; R13-L17 WeakPolarHBondContact O-CG 3.36Å; R13-L17 PolarHBondContact O-N 3.09Å
14	V	84.1	Confident	78.9	Confident	67 Å²	67	110.1 Å²	110.1	41%	0.406	54%	0.536	S	S	.	.	H	α-helix	trans	-66.8	-42.8	177	171	0	0	0	0	110.3	L10 Q11 E16 L17 E18	L10-V14 VanDerWaalsContact O-CG2 3.29Å; L10-V14 WeakPolarHBondContact O-CG2 3.49Å; L10-V14 PolarHBondContact O-N 3.47Å; Q11-V14 PolarHBondContact O-N 3Å; Q11-V14 VanDerWaalsContact O-N 3.15Å; V14-E16 PolarHBondContact O-N 3.32Å; V14-L17 PolarHBondContact O-N 2.96Å; V14-E18 HydrophobicContact CG1-CG 4.27Å; V14-E18 WeakPolarHBondContact O-CB 3.47Å; V14-E18 WeakPolarHBondContact O-CG 3.5Å; V14-E18 PolarHBondContact O-N 3.44Å
15	E	83.4	Confident	78.3	Confident	106 Å²	106	108 Å²	108	50%	0.495	54%	0.541	S	S	.	.	H	α-helix	trans	-62.9	-40.4	176.8	-73.1	172.9	-169.5	0	0	112.1	Q11 A12 E18 R19	Q11-E15 WeakPolarHBondContact CG-OE1 3.24Å; Q11-E15 PolarHBondContact NE2-OE1 3.32Å; Q11-E15 WeakPolarHBondContact O-CG 3.35Å; Q11-E15 PolarHBondContact O-N 3.41Å; A12-E15 PolarHBondContact O-N 3.17Å; E15-E18 PolarHBondContact O-N 2.89Å; E15-R19 WeakPolarHBondContact O-CB 3.28Å; E15-R19 PolarHBondContact O-N 3.21Å
16	E	82.1	Confident	77.3	Confident	121 Å²	121	107 Å²	107	57%	0.565	55%	0.547	S	S	*	.	H	α-helix	trans	-59.8	-50.8	171	-76.8	177.5	179.6	0	0	111	A12 V14 E18 R19 W20	A12-E16 WeakPolarHBondContact O-CG 3.36Å; A12-E16 PolarHBondContact O-N 2.9Å; V14-E16 PolarHBondContact O-N 3.32Å; E16-E18 VanDerWaalsContact C-N 3.34Å; E16-E18 PolarHBondContact O-N 3.31Å; E16-R19 CarbonylContact O-C 3.57Å; E16-R19 WeakPolarHBondContact O-CA 3.43Å; E16-R19 WeakPolarHBondContact O-CB 3.32Å; E16-R19 PolarHBondContact O-N 3.43Å; E16-W20 PolarHBondContact O-N 3.15Å
17	L	79.7	Confident	76.1	Confident	106 Å²	106	105.9 Å²	105.9	56%	0.555	55%	0.551	S	S	*	*	H	α-helix	trans	-60.4	-42.3	179.1	-73.3	171.4	0	0	0	112.3	R13 V14 R19 W20 V21	R13-L17 WeakPolarHBondContact O-CB 3.22Å; R13-L17 VanDerWaalsContact O-CG 3.26Å; R13-L17 WeakPolarHBondContact O-CG 3.36Å; R13-L17 PolarHBondContact O-N 3.09Å; V14-L17 PolarHBondContact O-N 2.96Å; L17-R19 VanDerWaalsContact C-N 3.27Å; L17-R19 PolarHBondContact O-N 3.49Å; L17-W20 PolarHBondContact O-N 3.35Å; L17-V21 WeakPolarHBondContact O-CB 3.38Å; L17-V21 VanDerWaalsContact O-CG2 3.28Å; L17-V21 WeakPolarHBondContact O-CG2 3.33Å; L17-V21 PolarHBondContact O-N 3.43Å
18	E	79.3	Confident	74.8	Confident	81 Å²	81	109.6 Å²	109.6	38%	0.379	56%	0.557	S	S	.	*	H	α-helix	trans	-62.2	-37.8	174.9	-74.7	-171.8	149.2	0	0	111	V14 E15 E16 V21 Y22 R28	V14-E18 HydrophobicContact CG1-CG 4.27Å; V14-E18 WeakPolarHBondContact O-CB 3.47Å; V14-E18 WeakPolarHBondContact O-CG 3.5Å; V14-E18 PolarHBondContact O-N 3.44Å; E15-E18 PolarHBondContact O-N 2.89Å; E16-E18 VanDerWaalsContact C-N 3.34Å; E16-E18 PolarHBondContact O-N 3.31Å; E18-V21 PolarHBondContact O-N 3.2Å; E18-Y22 HydrophobicContact CB-CD2 4.34Å; E18-Y22 WeakPolarHBondContact O-CB 3.22Å; E18-Y22 WeakPolarHBondContact O-CD2 3.48Å; E18-Y22 PolarHBondContact O-N 3.49Å; E18-R28 IonicContact OE1-NH2 2.72Å
19	R	77.5	Confident	73.5	Confident	178 Å²	178	106.2 Å²	106.2	67%	0.672	55%	0.553	S	S	*	*	H	α-helix	trans	-68.8	-38	175.5	-169.4	165.2	179.6	149.7	-2.9	112.8	E15 E16 L17 G23	E15-R19 WeakPolarHBondContact O-CB 3.28Å; E15-R19 PolarHBondContact O-N 3.21Å; E16-R19 CarbonylContact O-C 3.57Å; E16-R19 WeakPolarHBondContact O-CA 3.43Å; E16-R19 WeakPolarHBondContact O-CB 3.32Å; E16-R19 PolarHBondContact O-N 3.43Å; L17-R19 VanDerWaalsContact C-N 3.27Å; L17-R19 PolarHBondContact O-N 3.49Å; R19-G23 VanDerWaalsContact O-CA 3.24Å; R19-G23 WeakPolarHBondContact O-CA 2.99Å; R19-G23 PolarHBondContact O-N 3.08Å
20	W	71.6	Confident	72	Confident	223 Å²	223	103.3 Å²	103.3	85%	0.845	56%	0.56	S	S	*	*	H	α-helix	trans	-65.1	-38.2	173.8	-81	101.1	0	0	0	112.3	E16 L17	E16-W20 PolarHBondContact O-N 3.15Å; L17-W20 PolarHBondContact O-N 3.35Å
21	V	70.4	Confident	70.6	Confident	74 Å²	74	107.4 Å²	107.4	45%	0.448	57%	0.569	S	S	.	*	H	α-helix	trans	-86.5	-44.7	-175.1	175.5	0	0	0	0	112.6	L17 E18	L17-V21 WeakPolarHBondContact O-CB 3.38Å; L17-V21 VanDerWaalsContact O-CG2 3.28Å; L17-V21 WeakPolarHBondContact O-CG2 3.33Å; L17-V21 PolarHBondContact O-N 3.43Å; E18-V21 PolarHBondContact O-N 3.2Å
22	Y	68.3	Low	69.4	Low	96 Å²	96	108.3 Å²	108.3	38%	0.376	57%	0.571	S	S	.	*	H	α-helix	trans	-101.3	-13.2	-172.9	-62	-77.7	0	0	0	113.9	E18	E18-Y22 HydrophobicContact CB-CD2 4.34Å; E18-Y22 WeakPolarHBondContact O-CB 3.22Å; E18-Y22 WeakPolarHBondContact O-CD2 3.48Å; E18-Y22 PolarHBondContact O-N 3.49Å
23	G	68.6	Low	68.4	Low	28 Å²	28	109.8 Å²	109.8	29%	0.289	58%	0.575	S	S	.	*			trans	71.3	179.4	-177.8	0	0	0	0	0	113.6	R19 G25	R19-G23 VanDerWaalsContact O-CA 3.24Å; R19-G23 WeakPolarHBondContact O-CA 2.99Å; R19-G23 PolarHBondContact O-N 3.08Å; G23-G25 VanDerWaalsContact C-N 3.31Å; G23-G25 PolarHBondContact O-N 3.26Å
24	P	58.7	Low	67.5	Low	127 Å²	127	106 Å²	106	83%	0.825	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	82.8	-178.9	31.3	-33.4	0	0	0	109.9
25	G	61.5	Low	67	Low	66 Å²	66	106 Å²	106	68%	0.68	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	172.7	-5.7	179.5	0	0	0	0	0	116.7	G23 A27	G23-G25 VanDerWaalsContact C-N 3.31Å; G23-G25 PolarHBondContact O-N 3.26Å; G25-A27 PolarHBondContact O-N 3.26Å
26	G	56.3	Low	66.6	Low	58 Å²	58	102.6 Å²	102.6	60%	0.598	57%	0.566	S	S	*	*			trans	57.4	11.3	168.2	0	0	0	0	0	115.7	R28	G26-R28 VanDerWaalsContact C-N 3.33Å; G26-R28 PolarHBondContact O-N 3.45Å
27	A	55.5	Low	66.2	Low	73 Å²	73	102.5 Å²	102.5	60%	0.603	57%	0.569	S	S	*	*			trans	-72.5	94.4	177.9	0	0	0	0	0	107.4	G25 G29	G25-A27 PolarHBondContact O-N 3.26Å; A27-G29 PolarHBondContact O-N 2.88Å
28	R	58.9	Low	66.2	Low	194 Å²	194	101.6 Å²	101.6	73%	0.732	57%	0.568	S	S	*	*			trans	-67	42.7	165	-66.2	-179.2	174.6	173	-2.1	110.8	E18 G26	E18-R28 IonicContact OE1-NH2 2.72Å; G26-R28 VanDerWaalsContact C-N 3.33Å; G26-R28 PolarHBondContact O-N 3.45Å
29	G	55.4	Low	66.4	Low	46 Å²	46	105.2 Å²	105.2	47%	0.474	58%	0.582	S	S	.	*			trans	-60.4	138	165.3	0	0	0	0	0	107.3	A27 R31	A27-G29 PolarHBondContact O-N 2.88Å; G29-R31 PolarHBondContact O-N 2.81Å
30	S	55.5	Low	66.5	Low	117 Å²	117	100.4 Å²	100.4	82%	0.818	57%	0.573	S	S	*	*			trans	-56.6	75.7	176.5	179	0	0	0	0	110.7	K32	S30-K32 PolarHBondContact O-N 3.29Å
31	R	57.8	Low	66.9	Low	182 Å²	182	95.9 Å²	95.9	69%	0.687	56%	0.561	S	S	*	*			trans	-91.5	102.8	-178.4	-166.2	172.3	-90.1	170.6	-5	105.1	G29 V33	G29-R31 PolarHBondContact O-N 2.81Å; R31-V33 HydrophobicContact CB-CG2 4.36Å; R31-V33 HydrophobicContact CG-CG2 3.98Å; R31-V33 PolarHBondContact O-N 2.91Å
32	K	61.7	Low	67.5	Low	136 Å²	136	96.3 Å²	96.3	59%	0.591	56%	0.564	S	S	*	*			trans	-64.9	65.2	170.5	-58.7	157.3	151	-120.4	0	109.4	S30 A34 D35 G36	S30-K32 PolarHBondContact O-N 3.29Å; K32-A34 PolarHBondContact O-N 3.35Å; K32-D35 HydrophobicContact CB-CB 3.55Å; K32-D35 WeakPolarHBondContact CB-OD2 3.34Å; K32-D35 HydrophobicContact CD-CB 4.35Å; K32-D35 WeakPolarHBondContact CD-OD2 3.49Å; K32-D35 VanDerWaalsContact CE-OD2 3.28Å; K32-D35 WeakPolarHBondContact CE-OD2 3.31Å; K32-D35 HydrophobicContact CG-CB 4.37Å; K32-D35 VanDerWaalsContact CG-OD2 3.3Å; K32-D35 WeakPolarHBondContact CG-OD2 3.4Å; K32-D35 IonicContact NZ-OD2 3.63Å; K32-D35 PolarHBondContact NZ-OD2 3.42Å; K32-D35 CarbonylContact O-C 3.58Å; K32-D35 PolarHBondContact O-N 3.26Å; K32-D35 VanDerWaalsContact O-N 3.07Å; K32-G36 PolarHBondContact O-N 3.45Å
33	V	64.3	Low	68	Low	79 Å²	79	94 Å²	94	48%	0.479	56%	0.564	S	S	.	*	H	α-helix	trans	-58.6	-37.6	176	177.9	0	0	0	0	108.9	R31 G36 L37	R31-V33 HydrophobicContact CB-CG2 4.36Å; R31-V33 HydrophobicContact CG-CG2 3.98Å; R31-V33 PolarHBondContact O-N 2.91Å; V33-G36 PolarHBondContact O-N 3.13Å; V33-L37 WeakPolarHBondContact O-CB 3.15Å; V33-L37 PolarHBondContact O-N 2.89Å
34	A	66.6	Low	68.2	Low	67 Å²	67	95 Å²	95	55%	0.554	56%	0.563	S	S	*	*	H	α-helix	trans	-57.2	-54.1	168.8	0	0	0	0	0	112	K32 G36 L37 V38	K32-A34 PolarHBondContact O-N 3.35Å; A34-G36 VanDerWaalsContact C-N 3.31Å; A34-G36 PolarHBondContact O-N 3.35Å; A34-L37 PolarHBondContact O-N 2.94Å; A34-V38 WeakPolarHBondContact O-CB 3.18Å; A34-V38 VanDerWaalsContact O-CG2 3.24Å; A34-V38 WeakPolarHBondContact O-CG2 3.49Å; A34-V38 PolarHBondContact O-N 3.27Å
35	D	73.6	Confident	69	Low	68 Å²	68	90.8 Å²	90.8	36%	0.364	54%	0.542	S	S	.	.	H	α-helix	trans	-66.1	-33.2	179.5	-57.8	-10.6	0	0	0	112.6	K32 V38 K39	K32-D35 HydrophobicContact CB-CB 3.55Å; K32-D35 WeakPolarHBondContact CB-OD2 3.34Å; K32-D35 HydrophobicContact CD-CB 4.35Å; K32-D35 WeakPolarHBondContact CD-OD2 3.49Å; K32-D35 VanDerWaalsContact CE-OD2 3.28Å; K32-D35 WeakPolarHBondContact CE-OD2 3.31Å; K32-D35 HydrophobicContact CG-CB 4.37Å; K32-D35 VanDerWaalsContact CG-OD2 3.3Å; K32-D35 WeakPolarHBondContact CG-OD2 3.4Å; K32-D35 IonicContact NZ-OD2 3.63Å; K32-D35 PolarHBondContact NZ-OD2 3.42Å; K32-D35 CarbonylContact O-C 3.58Å; K32-D35 PolarHBondContact O-N 3.26Å; K32-D35 VanDerWaalsContact O-N 3.07Å; D35-V38 PolarHBondContact O-N 2.76Å; D35-K39 WeakPolarHBondContact O-CB 3.27Å; D35-K39 WeakPolarHBondContact O-CG 3.43Å; D35-K39 PolarHBondContact O-N 3.11Å
36	G	74.8	Confident	69.8	Low	35 Å²	35	91.7 Å²	91.7	36%	0.361	53%	0.531	S	S	.	.	H	α-helix	trans	-65.5	-44.9	174.4	0	0	0	0	0	111.2	K32 V33 A34 K39 V40	K32-G36 PolarHBondContact O-N 3.45Å; V33-G36 PolarHBondContact O-N 3.13Å; A34-G36 VanDerWaalsContact C-N 3.31Å; A34-G36 PolarHBondContact O-N 3.35Å; G36-K39 PolarHBondContact O-N 3.45Å; G36-V40 VanDerWaalsContact O-CG2 3.28Å; G36-V40 WeakPolarHBondContact O-CG2 2.97Å; G36-V40 PolarHBondContact O-N 3.45Å
37	L	75	Confident	70.6	Confident	118 Å²	118	92.6 Å²	92.6	62%	0.618	52%	0.521	S	S	*	.	H	α-helix	trans	-63.8	-42.4	174.6	-173.5	67.4	0	0	0	111.1	V33 A34 V40 Q41	V33-L37 WeakPolarHBondContact O-CB 3.15Å; V33-L37 PolarHBondContact O-N 2.89Å; A34-L37 PolarHBondContact O-N 2.94Å; L37-V40 PolarHBondContact O-N 2.84Å; L37-Q41 VanDerWaalsContact O-CB 3.28Å; L37-Q41 WeakPolarHBondContact O-CB 3.37Å; L37-Q41 PolarHBondContact O-N 3.47Å
38	V	79.9	Confident	71	Confident	88 Å²	88	90.5 Å²	90.5	53%	0.533	50%	0.502	S	S	.	.	H	α-helix	trans	-63.2	-42.5	174.8	171.4	0	0	0	0	110.7	A34 D35 Q41 V42	A34-V38 WeakPolarHBondContact O-CB 3.18Å; A34-V38 VanDerWaalsContact O-CG2 3.24Å; A34-V38 WeakPolarHBondContact O-CG2 3.49Å; A34-V38 PolarHBondContact O-N 3.27Å; D35-V38 PolarHBondContact O-N 2.76Å; V38-Q41 PolarHBondContact O-N 2.91Å; V38-V42 HydrophobicContact CG1-CG2 4.4Å; V38-V42 WeakPolarHBondContact O-CB 3.19Å; V38-V42 VanDerWaalsContact O-CG2 3.27Å; V38-V42 WeakPolarHBondContact O-CG2 3.28Å; V38-V42 PolarHBondContact O-N 3.45Å
39	K	83.1	Confident	71.4	Confident	156 Å²	156	85.1 Å²	85.1	68%	0.678	49%	0.494	S	S	*	.	H	α-helix	trans	-62.2	-43.2	174.8	-78.9	174.5	-178.6	-176	0	112	D35 G36 V42 A43	D35-K39 WeakPolarHBondContact O-CB 3.27Å; D35-K39 WeakPolarHBondContact O-CG 3.43Å; D35-K39 PolarHBondContact O-N 3.11Å; G36-K39 PolarHBondContact O-N 3.45Å; K39-V42 PolarHBondContact O-N 2.88Å; K39-A43 VanDerWaalsContact O-CB 3.3Å; K39-A43 WeakPolarHBondContact O-CB 3.27Å; K39-A43 PolarHBondContact O-N 2.98Å
40	V	79.8	Confident	72.1	Confident	78 Å²	78	91.3 Å²	91.3	47%	0.473	51%	0.508	S	S	.	.	H	α-helix	trans	-64.5	-44	175.5	172	0	0	0	0	110	G36 L37 V42 A43 L44	G36-V40 VanDerWaalsContact O-CG2 3.28Å; G36-V40 WeakPolarHBondContact O-CG2 2.97Å; G36-V40 PolarHBondContact O-N 3.45Å; L37-V40 PolarHBondContact O-N 2.84Å; V40-V42 PolarHBondContact O-N 3.3Å; V40-A43 PolarHBondContact O-N 3.39Å; V40-L44 HydrophobicContact CG1-CD1 3.74Å; V40-L44 HydrophobicContact CG1-CG 4.1Å; V40-L44 VanDerWaalsContact O-CB 3.31Å; V40-L44 WeakPolarHBondContact O-CB 3.47Å; V40-L44 WeakPolarHBondContact O-CG 3.43Å; V40-L44 PolarHBondContact O-N 3.35Å
41	Q	79.3	Confident	72.9	Confident	128 Å²	128	93.9 Å²	93.9	60%	0.598	50%	0.5	S	S	*	.	H	α-helix	trans	-60.4	-44	176.9	-173.6	64.7	10.3	0	0	112.1	L37 V38 L44 G45	L37-Q41 VanDerWaalsContact O-CB 3.28Å; L37-Q41 WeakPolarHBondContact O-CB 3.37Å; L37-Q41 PolarHBondContact O-N 3.47Å; V38-Q41 PolarHBondContact O-N 2.91Å; Q41-L44 PolarHBondContact O-N 3.14Å; Q41-G45 PolarHBondContact O-N 3.3Å
42	V	82.3	Confident	73.6	Confident	83 Å²	83	90.4 Å²	90.4	50%	0.503	49%	0.491	S	S	.	.	H	α-helix	trans	-67	-41.4	176.4	171	0	0	0	0	110.9	V38 K39 V40 G45 N46	V38-V42 HydrophobicContact CG1-CG2 4.4Å; V38-V42 WeakPolarHBondContact O-CB 3.19Å; V38-V42 VanDerWaalsContact O-CG2 3.27Å; V38-V42 WeakPolarHBondContact O-CG2 3.28Å; V38-V42 PolarHBondContact O-N 3.45Å; K39-V42 PolarHBondContact O-N 2.88Å; V40-V42 PolarHBondContact O-N 3.3Å; V42-G45 PolarHBondContact O-N 2.83Å; V42-N46 WeakPolarHBondContact O-CB 3.49Å; V42-N46 VanDerWaalsContact O-CG 3.25Å; V42-N46 PolarHBondContact O-N 3.34Å; V42-N46 PolarHBondContact O-ND2 3.42Å
43	A	78.9	Confident	74	Confident	46 Å²	46	93.8 Å²	93.8	38%	0.38	50%	0.501	S	S	.	.	H	α-helix	trans	-63	-44.6	175.6	0	0	0	0	0	111.6	K39 V40 N46 I47	K39-A43 VanDerWaalsContact O-CB 3.3Å; K39-A43 WeakPolarHBondContact O-CB 3.27Å; K39-A43 PolarHBondContact O-N 2.98Å; V40-A43 PolarHBondContact O-N 3.39Å; A43-N46 PolarHBondContact O-N 3.48Å; A43-I47 WeakPolarHBondContact O-CB 3.4Å; A43-I47 WeakPolarHBondContact O-CD1 3Å; A43-I47 WeakPolarHBondContact O-CG1 3.46Å; A43-I47 PolarHBondContact O-N 2.92Å
44	L	74.1	Confident	74.4	Confident	51 Å²	51	91.6 Å²	91.6	27%	0.267	49%	0.487	S	S	.	.	H	α-helix	trans	-65.7	-40.9	176.3	-70.3	179.9	0	0	0	112	V40 Q41 N46 I47 S48 Y58	V40-L44 HydrophobicContact CG1-CD1 3.74Å; V40-L44 HydrophobicContact CG1-CG 4.1Å; V40-L44 VanDerWaalsContact O-CB 3.31Å; V40-L44 WeakPolarHBondContact O-CB 3.47Å; V40-L44 WeakPolarHBondContact O-CG 3.43Å; V40-L44 PolarHBondContact O-N 3.35Å; Q41-L44 PolarHBondContact O-N 3.14Å; L44-N46 VanDerWaalsContact C-N 3.34Å; L44-N46 PolarHBondContact O-N 3.33Å; L44-I47 PolarHBondContact O-N 3.42Å; L44-S48 WeakPolarHBondContact O-CB 3.14Å; L44-S48 PolarHBondContact O-N 2.81Å; L44-Y58 HydrophobicContact CD2-CE2 4.36Å; L44-Y58 WeakPolarHBondContact CD2-OH 3.3Å
45	G	75.4	Confident	74.6	Confident	37 Å²	37	92.1 Å²	92.1	38%	0.381	48%	0.477	S	S	.	.	H	α-helix	trans	-60.5	-42.5	173.2	0	0	0	0	0	112.3	Q41 V42 S49	Q41-G45 PolarHBondContact O-N 3.3Å; V42-G45 PolarHBondContact O-N 2.83Å; G45-S49 WeakPolarHBondContact O-CB 3.21Å; G45-S49 PolarHBondContact O-N 3.46Å; G45-S49 PolarHBondContact O-OG 2.79Å; G45-S49 VanDerWaalsContact O-OG 3.09Å
46	N	77	Confident	74.8	Confident	86 Å²	86	92.8 Å²	92.8	46%	0.46	48%	0.48	S	S	.	.	H	α-helix	trans	-68.3	-35.3	175.9	-75.7	-29.8	0	0	0	113.4	V42 A43 L44 S49 K50	V42-N46 WeakPolarHBondContact O-CB 3.49Å; V42-N46 VanDerWaalsContact O-CG 3.25Å; V42-N46 PolarHBondContact O-N 3.34Å; V42-N46 PolarHBondContact O-ND2 3.42Å; A43-N46 PolarHBondContact O-N 3.48Å; L44-N46 VanDerWaalsContact C-N 3.34Å; L44-N46 PolarHBondContact O-N 3.33Å; N46-S49 PolarHBondContact O-OG 3.23Å; N46-K50 WeakPolarHBondContact O-CB 3.31Å; N46-K50 WeakPolarHBondContact O-CG 3.4Å; N46-K50 PolarHBondContact O-N 2.89Å
47	I	73.6	Confident	74.7	Confident	77 Å²	77	96 Å²	96	40%	0.395	49%	0.488	S	S	.	.	H	α-helix	trans	-74.2	-42.3	177.2	-67.5	163.2	0	0	0	110.2	A43 L44 K50 R51 V54	A43-I47 WeakPolarHBondContact O-CB 3.4Å; A43-I47 WeakPolarHBondContact O-CD1 3Å; A43-I47 WeakPolarHBondContact O-CG1 3.46Å; A43-I47 PolarHBondContact O-N 2.92Å; L44-I47 PolarHBondContact O-N 3.42Å; I47-K50 PolarHBondContact O-N 3.2Å; I47-R51 WeakPolarHBondContact O-CB 3.36Å; I47-R51 PolarHBondContact O-N 3.49Å; I47-V54 HydrophobicContact CG2-CB 4.2Å; I47-V54 HydrophobicContact CG2-CG1 3.87Å; I47-V54 HydrophobicContact CG2-CG2 3.99Å
48	S	64.9	Low	74.6	Confident	28 Å²	28	94.9 Å²	94.9	20%	0.196	48%	0.476	C	S	.	.	H	α-helix	trans	-65.5	-37	178.5	-174.2	0	0	0	0	112.1	L44	L44-S48 WeakPolarHBondContact O-CB 3.14Å; L44-S48 PolarHBondContact O-N 2.81Å
49	S	65.7	Low	74.5	Confident	82 Å²	82	96.9 Å²	96.9	57%	0.573	48%	0.478	S	S	*	.	H	α-helix	trans	-73.9	-32.1	177.1	65.6	0	0	0	0	113.8	G45 N46	G45-S49 WeakPolarHBondContact O-CB 3.21Å; G45-S49 PolarHBondContact O-N 3.46Å; G45-S49 PolarHBondContact O-OG 2.79Å; G45-S49 VanDerWaalsContact O-OG 3.09Å; N46-S49 PolarHBondContact O-OG 3.23Å
50	K	70.4	Confident	74.2	Confident	175 Å²	175	95.3 Å²	95.3	76%	0.761	47%	0.471	S	S	*	.	H	α-helix	trans	-91	-19.7	-178.6	-67.6	-179.2	-177.9	-176.9	0	114.2	N46 I47	N46-K50 WeakPolarHBondContact O-CB 3.31Å; N46-K50 WeakPolarHBondContact O-CG 3.4Å; N46-K50 PolarHBondContact O-N 2.89Å; I47-K50 PolarHBondContact O-N 3.2Å
51	R	72.4	Confident	74.1	Confident	172 Å²	172	95.6 Å²	95.6	65%	0.649	47%	0.469	S	S	*	.			trans	-128.8	96.2	-179	-64.9	-174.8	-175.2	-98	3.5	110.2	I47 R53 V54 K55	I47-R51 WeakPolarHBondContact O-CB 3.36Å; I47-R51 PolarHBondContact O-N 3.49Å; R51-R53 PolarHBondContact O-N 2.94Å; R51-V54 HydrophobicContact CB-CB 4.23Å; R51-V54 HydrophobicContact CB-CG2 3.77Å; R51-V54 WeakPolarHBondContact O-CB 3.45Å; R51-V54 PolarHBondContact O-N 3.38Å; R51-K55 PolarHBondContact O-N 3.25Å
52	E	72.4	Confident	73.8	Confident	108 Å²	108	95.4 Å²	95.4	51%	0.505	47%	0.468	S	S	.	.	H	α-helix	trans	-53.9	-32.4	179.1	-161	63.3	-152.3	0	0	112.6	V54 K55 I56	E52-V54 VanDerWaalsContact C-N 3.3Å; E52-V54 PolarHBondContact O-N 2.96Å; E52-K55 WeakPolarHBondContact O-CB 3.41Å; E52-K55 PolarHBondContact O-N 3.42Å; E52-K55 IonicContact OE1-NZ 2.73Å; E52-K55 PolarHBondContact OE1-NZ 2.84Å; E52-K55 VanDerWaalsContact OE1-NZ 3.13Å; E52-K55 IonicContact OE2-NZ 2.89Å; E52-I56 HydrophobicContact CG-CD1 4.37Å; E52-I56 VanDerWaalsContact O-CG1 3.31Å; E52-I56 WeakPolarHBondContact O-CG1 3.31Å; E52-I56 PolarHBondContact O-N 3.38Å
53	R	70.3	Confident	73.3	Confident	208 Å²	208	94.7 Å²	94.7	79%	0.785	46%	0.462	S	S	*	.	H	α-helix	trans	-59.4	-37.1	173.7	-68.4	179.8	68.5	176.2	1.4	113.1	R51 L57	R51-R53 PolarHBondContact O-N 2.94Å; R53-L57 VanDerWaalsContact O-CG 3.24Å; R53-L57 WeakPolarHBondContact O-CG 3.48Å; R53-L57 PolarHBondContact O-N 2.96Å
54	V	72.1	Confident	73	Confident	33 Å²	33	97 Å²	97	20%	0.2	47%	0.467	C	S	.	.	H	α-helix	trans	-73.7	-39.3	179.6	178.9	0	0	0	0	110.4	I47 R51 E52 I56 L57 Y58	I47-V54 HydrophobicContact CG2-CB 4.2Å; I47-V54 HydrophobicContact CG2-CG1 3.87Å; I47-V54 HydrophobicContact CG2-CG2 3.99Å; R51-V54 HydrophobicContact CB-CB 4.23Å; R51-V54 HydrophobicContact CB-CG2 3.77Å; R51-V54 WeakPolarHBondContact O-CB 3.45Å; R51-V54 PolarHBondContact O-N 3.38Å; E52-V54 VanDerWaalsContact C-N 3.3Å; E52-V54 PolarHBondContact O-N 2.96Å; V54-I56 VanDerWaalsContact C-N 3.34Å; V54-I56 PolarHBondContact O-N 3.24Å; V54-L57 WeakPolarHBondContact O-CB 3.42Å; V54-L57 PolarHBondContact O-N 3.44Å; V54-L57 VanDerWaalsContact O-N 3.16Å; V54-Y58 HydrophobicContact CG1-CD2 3.72Å; V54-Y58 HydrophobicContact CG1-CE2 3.63Å; V54-Y58 VanDerWaalsContact O-CD2 3.31Å; V54-Y58 WeakPolarHBondContact O-CD2 3.2Å; V54-Y58 PolarHBondContact O-N 3.16Å
55	K	72.3	Confident	73	Confident	77 Å²	77	100.1 Å²	100.1	34%	0.335	48%	0.482	S	S	.	.	H	α-helix	trans	-61.6	-40.9	173.4	-174.5	178.6	167.8	-156.9	0	112.6	R51 E52 Y58 K59	R51-K55 PolarHBondContact O-N 3.25Å; E52-K55 WeakPolarHBondContact O-CB 3.41Å; E52-K55 PolarHBondContact O-N 3.42Å; E52-K55 IonicContact OE1-NZ 2.73Å; E52-K55 PolarHBondContact OE1-NZ 2.84Å; E52-K55 VanDerWaalsContact OE1-NZ 3.13Å; E52-K55 IonicContact OE2-NZ 2.89Å; K55-Y58 PolarHBondContact O-N 3.44Å; K55-K59 PolarHBondContact O-N 3.46Å
56	I	77.3	Confident	72.8	Confident	83 Å²	83	103.8 Å²	103.8	43%	0.426	49%	0.488	S	S	.	.	H	α-helix	trans	-63.6	-42.4	172.8	-66.8	164.3	0	0	0	110.7	E52 V54 K59 K60	E52-I56 HydrophobicContact CG-CD1 4.37Å; E52-I56 VanDerWaalsContact O-CG1 3.31Å; E52-I56 WeakPolarHBondContact O-CG1 3.31Å; E52-I56 PolarHBondContact O-N 3.38Å; V54-I56 VanDerWaalsContact C-N 3.34Å; V54-I56 PolarHBondContact O-N 3.24Å; I56-K59 PolarHBondContact O-N 3.42Å; I56-K60 HydrophobicContact CG2-CD 4.26Å; I56-K60 HydrophobicContact CG2-CG 4.47Å; I56-K60 WeakPolarHBondContact O-CB 3.31Å; I56-K60 WeakPolarHBondContact O-CG 3.45Å; I56-K60 PolarHBondContact O-N 2.95Å
57	L	73.3	Confident	72.2	Confident	101 Å²	101	106 Å²	106	53%	0.529	49%	0.491	S	S	.	.	H	α-helix	trans	-63.8	-40.9	177.2	-73.4	166	0	0	0	112.2	R53 V54 K59 K60 I61	R53-L57 VanDerWaalsContact O-CG 3.24Å; R53-L57 WeakPolarHBondContact O-CG 3.48Å; R53-L57 PolarHBondContact O-N 2.96Å; V54-L57 WeakPolarHBondContact O-CB 3.42Å; V54-L57 PolarHBondContact O-N 3.44Å; V54-L57 VanDerWaalsContact O-N 3.16Å; L57-K59 PolarHBondContact O-N 3.3Å; L57-K60 CarbonylContact O-C 3.58Å; L57-K60 PolarHBondContact O-N 3.29Å; L57-I61 VanDerWaalsContact O-CG1 3.27Å; L57-I61 WeakPolarHBondContact O-CG1 3.41Å; L57-I61 PolarHBondContact O-N 3.03Å
58	Y	71.5	Confident	71.8	Confident	96 Å²	96	108.7 Å²	108.7	38%	0.376	51%	0.505	S	S	.	.	H	α-helix	trans	-60.3	-44.9	175.6	-91.6	-72.2	0	0	0	112.8	L44 V54 K55 K60 I61 E62	L44-Y58 HydrophobicContact CD2-CE2 4.36Å; L44-Y58 WeakPolarHBondContact CD2-OH 3.3Å; V54-Y58 HydrophobicContact CG1-CD2 3.72Å; V54-Y58 HydrophobicContact CG1-CE2 3.63Å; V54-Y58 VanDerWaalsContact O-CD2 3.31Å; V54-Y58 WeakPolarHBondContact O-CD2 3.2Å; V54-Y58 PolarHBondContact O-N 3.16Å; K55-Y58 PolarHBondContact O-N 3.44Å; Y58-K60 VanDerWaalsContact C-N 3.34Å; Y58-K60 PolarHBondContact O-N 2.84Å; Y58-I61 PolarHBondContact O-N 2.85Å; Y58-E62 PolarHBondContact O-N 3.43Å
59	K	77.7	Confident	71.9	Confident	130 Å²	130	111.3 Å²	111.3	57%	0.565	52%	0.517	S	S	*	.	H	α-helix	trans	-62.3	-42.2	174.1	-70	-176.6	175	-170.7	0	111.9	K55 I56 L57 I61 E62 D63	K55-K59 PolarHBondContact O-N 3.46Å; I56-K59 PolarHBondContact O-N 3.42Å; L57-K59 PolarHBondContact O-N 3.3Å; K59-I61 VanDerWaalsContact C-N 3.32Å; K59-I61 PolarHBondContact O-N 2.77Å; K59-E62 PolarHBondContact O-N 3.31Å; K59-D63 PolarHBondContact O-N 2.87Å; K59-D63 VanDerWaalsContact O-N 3.08Å
60	K	77.3	Confident	71.7	Confident	122 Å²	122	111.6 Å²	111.6	53%	0.53	52%	0.517	S	S	.	.	H	α-helix	trans	-65.3	-31.8	176.5	-76	-173	176.8	-166.3	0	113.1	I56 L57 Y58 D63 L64	I56-K60 HydrophobicContact CG2-CD 4.26Å; I56-K60 HydrophobicContact CG2-CG 4.47Å; I56-K60 WeakPolarHBondContact O-CB 3.31Å; I56-K60 WeakPolarHBondContact O-CG 3.45Å; I56-K60 PolarHBondContact O-N 2.95Å; L57-K60 CarbonylContact O-C 3.58Å; L57-K60 PolarHBondContact O-N 3.29Å; Y58-K60 VanDerWaalsContact C-N 3.34Å; Y58-K60 PolarHBondContact O-N 2.84Å; K60-D63 PolarHBondContact O-N 3.45Å; K60-L64 WeakPolarHBondContact O-CB 3.19Å; K60-L64 WeakPolarHBondContact O-CD1 3.43Å; K60-L64 WeakPolarHBondContact O-CG 3.37Å; K60-L64 PolarHBondContact O-N 3.23Å
61	I	77.4	Confident	71.3	Confident	84 Å²	84	108.8 Å²	108.8	43%	0.431	51%	0.507	S	S	.	.	H	α-helix	trans	-66	-45.2	175.9	-72.1	162.8	0	0	0	110.2	L57 Y58 K59 D63 L64 I65	L57-I61 VanDerWaalsContact O-CG1 3.27Å; L57-I61 WeakPolarHBondContact O-CG1 3.41Å; L57-I61 PolarHBondContact O-N 3.03Å; Y58-I61 PolarHBondContact O-N 2.85Å; K59-I61 VanDerWaalsContact C-N 3.32Å; K59-I61 PolarHBondContact O-N 2.77Å; I61-D63 VanDerWaalsContact C-N 3.31Å; I61-D63 PolarHBondContact O-N 3.38Å; I61-L64 PolarHBondContact O-N 2.93Å; I61-I65 HydrophobicContact CG2-CD1 3.98Å; I61-I65 VanDerWaalsContact O-CG1 3.28Å; I61-I65 WeakPolarHBondContact O-CG1 3.32Å; I61-I65 PolarHBondContact O-N 3.06Å
62	E	72.9	Confident	70.6	Confident	125 Å²	125	105.9 Å²	105.9	58%	0.584	50%	0.496	S	S	*	.	H	α-helix	trans	-60.8	-42.2	174.8	-72	-179.9	-176.5	0	0	111.8	Y58 K59 I65 K66	Y58-E62 PolarHBondContact O-N 3.43Å; K59-E62 PolarHBondContact O-N 3.31Å; E62-I65 PolarHBondContact O-N 3.43Å; E62-K66 WeakPolarHBondContact O-CG 2.97Å; E62-K66 PolarHBondContact O-N 2.69Å
63	D	71.9	Confident	69.8	Low	68 Å²	68	105 Å²	105	36%	0.364	49%	0.494	S	S	.	.	H	α-helix	trans	-68.3	-40.1	176.1	-67.8	-24.6	0	0	0	111.7	K59 K60 I61 I65 K66 Y67	K59-D63 PolarHBondContact O-N 2.87Å; K59-D63 VanDerWaalsContact O-N 3.08Å; K60-D63 PolarHBondContact O-N 3.45Å; I61-D63 VanDerWaalsContact C-N 3.31Å; I61-D63 PolarHBondContact O-N 3.38Å; D63-I65 VanDerWaalsContact C-N 3.32Å; D63-I65 PolarHBondContact O-N 3.18Å; D63-K66 WeakPolarHBondContact O-CB 3.13Å; D63-K66 PolarHBondContact O-N 3.49Å; D63-K66 VanDerWaalsContact O-N 3.11Å; D63-K66 IonicContact OD1-NZ 2.75Å; D63-K66 PolarHBondContact OD1-NZ 2.96Å; D63-Y67 HydrophobicContact CB-CD2 4.45Å; D63-Y67 HydrophobicContact CB-CE2 4.22Å; D63-Y67 WeakPolarHBondContact O-CD2 3.13Å; D63-Y67 PolarHBondContact O-N 2.8Å
64	L	73.6	Confident	69.3	Low	95 Å²	95	101 Å²	101	50%	0.497	49%	0.489	S	S	.	.	H	α-helix	trans	-62	-37.3	175.1	-85	159.4	0	0	0	112.3	K60 I61 K66 Y67 L68	K60-L64 WeakPolarHBondContact O-CB 3.19Å; K60-L64 WeakPolarHBondContact O-CD1 3.43Å; K60-L64 WeakPolarHBondContact O-CG 3.37Å; K60-L64 PolarHBondContact O-N 3.23Å; I61-L64 PolarHBondContact O-N 2.93Å; L64-K66 VanDerWaalsContact C-N 3.31Å; L64-Y67 CarbonylContact O-C 3.59Å; L64-Y67 PolarHBondContact O-N 2.86Å; L64-L68 WeakPolarHBondContact O-CB 3.49Å; L64-L68 VanDerWaalsContact O-CD1 3.31Å; L64-L68 WeakPolarHBondContact O-CD1 3.28Å; L64-L68 PolarHBondContact O-N 3.49Å
65	I	74.2	Confident	68.6	Low	115 Å²	115	108.3 Å²	108.3	59%	0.59	51%	0.512	S	S	*	.	H	α-helix	trans	-63.1	-39.8	174	-70	164.9	0	0	0	110.4	I61 E62 D63 L68 D69	I61-I65 HydrophobicContact CG2-CD1 3.98Å; I61-I65 VanDerWaalsContact O-CG1 3.28Å; I61-I65 WeakPolarHBondContact O-CG1 3.32Å; I61-I65 PolarHBondContact O-N 3.06Å; E62-I65 PolarHBondContact O-N 3.43Å; D63-I65 VanDerWaalsContact C-N 3.32Å; D63-I65 PolarHBondContact O-N 3.18Å; I65-L68 PolarHBondContact O-N 3.36Å; I65-D69 PolarHBondContact O-N 3.12Å
66	K	70.4	Confident	67.9	Low	114 Å²	114	109.8 Å²	109.8	50%	0.496	52%	0.523	S	S	.	.	H	α-helix	trans	-65.3	-39.2	174.2	-62.1	168.1	-163	157.2	0	112.1	E62 D63 L64 L68 D69	E62-K66 WeakPolarHBondContact O-CG 2.97Å; E62-K66 PolarHBondContact O-N 2.69Å; D63-K66 WeakPolarHBondContact O-CB 3.13Å; D63-K66 PolarHBondContact O-N 3.49Å; D63-K66 VanDerWaalsContact O-N 3.11Å; D63-K66 IonicContact OD1-NZ 2.75Å; D63-K66 PolarHBondContact OD1-NZ 2.96Å; L64-K66 VanDerWaalsContact C-N 3.31Å; K66-L68 VanDerWaalsContact C-N 3.34Å; K66-D69 PolarHBondContact O-N 3.45Å
67	Y	63.8	Low	67.4	Low	133 Å²	133	108.9 Å²	108.9	52%	0.522	53%	0.528	S	S	.	.	H	α-helix	trans	-75.5	-21.2	177.1	-70.5	-67.4	0	0	0	113.3	D63 L64 D69 Y72 I73	D63-Y67 HydrophobicContact CB-CD2 4.45Å; D63-Y67 HydrophobicContact CB-CE2 4.22Å; D63-Y67 WeakPolarHBondContact O-CD2 3.13Å; D63-Y67 PolarHBondContact O-N 2.8Å; L64-Y67 CarbonylContact O-C 3.59Å; L64-Y67 PolarHBondContact O-N 2.86Å; Y67-D69 VanDerWaalsContact C-N 3.3Å; Y67-Y72 HydrophobicContact CD1-CD1 4.16Å; Y67-Y72 AromaticContact CD1-CE1 3.85Å; Y67-Y72 HydrophobicContact CD1-CE1 3.85Å; Y67-Y72 AromaticContact CE1-CE1 3.78Å; Y67-Y72 HydrophobicContact CE1-CE1 3.78Å; Y67-I73 WeakPolarHBondContact O-CD1 3.36Å
68	L	65	Low	66.9	Low	134 Å²	134	108.4 Å²	108.4	70%	0.702	53%	0.525	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.2	-9.4	174.9	-107.3	97.5	0	0	0	113.4	L64 I65 K66 P70	L64-L68 WeakPolarHBondContact O-CB 3.49Å; L64-L68 VanDerWaalsContact O-CD1 3.31Å; L64-L68 WeakPolarHBondContact O-CD1 3.28Å; L64-L68 PolarHBondContact O-N 3.49Å; I65-L68 PolarHBondContact O-N 3.36Å; K66-L68 VanDerWaalsContact C-N 3.34Å; L68-P70 WeakPolarHBondContact O-CD 3.24Å
69	D	68.8	Low	67.1	Low	82 Å²	82	107.5 Å²	107.5	44%	0.439	53%	0.531	S	S	.	.			trans	-72.9	112.4	174.6	-160.1	-19.3	0	0	0	109.2	I65 K66 Y67 E71 Y72	I65-D69 PolarHBondContact O-N 3.12Å; K66-D69 PolarHBondContact O-N 3.45Å; Y67-D69 VanDerWaalsContact C-N 3.3Å; D69-E71 PolarHBondContact O-N 3.5Å; D69-E71 VanDerWaalsContact O-N 3.16Å; D69-E71 PolarHBondContact OD1-N 3.24Å; D69-Y72 WeakPolarHBondContact O-CB 3.27Å; D69-Y72 PolarHBondContact O-N 3.37Å
70	P	61.7	Low	66.7	Low	88 Å²	88	107 Å²	107	57%	0.571	53%	0.534	S	S	*	.	H	α-helix	trans	-58.4	-29.8	-177.2	-21	32.9	0	0	0	112.3	L68 Y72 D74	L68-P70 WeakPolarHBondContact O-CD 3.24Å; P70-Y72 PolarHBondContact O-N 2.82Å; P70-D74 WeakPolarHBondContact O-CB 3.28Å; P70-D74 PolarHBondContact O-N 2.75Å; P70-D74 VanDerWaalsContact O-N 3.14Å
71	E	61.9	Low	66.5	Low	117 Å²	117	104.8 Å²	104.8	55%	0.547	54%	0.539	S	S	.	.	H	α-helix	trans	-65.5	-25.1	177	-71.6	-161.5	166.7	0	0	113.2	D69 R75	D69-E71 PolarHBondContact O-N 3.5Å; D69-E71 VanDerWaalsContact O-N 3.16Å; D69-E71 PolarHBondContact OD1-N 3.24Å; E71-R75 WeakPolarHBondContact O-CB 3.22Å; E71-R75 WeakPolarHBondContact O-CD 3.35Å; E71-R75 VanDerWaalsContact O-CG 3.24Å; E71-R75 WeakPolarHBondContact O-CG 3.34Å; E71-R75 IonicContact OE2-NH2 3.13Å; E71-R75 PolarHBondContact OE2-NH2 3.4Å
72	Y	56.2	Low	66.4	Low	110 Å²	110	103.6 Å²	103.6	43%	0.431	54%	0.538	S	S	.	.	H	α-helix	trans	-80.6	-42.1	-179.5	-173.4	-104.4	0	0	0	112.1	Y67 D69 P70 I76	Y67-Y72 HydrophobicContact CD1-CD1 4.16Å; Y67-Y72 AromaticContact CD1-CE1 3.85Å; Y67-Y72 HydrophobicContact CD1-CE1 3.85Å; Y67-Y72 AromaticContact CE1-CE1 3.78Å; Y67-Y72 HydrophobicContact CE1-CE1 3.78Å; D69-Y72 WeakPolarHBondContact O-CB 3.27Å; D69-Y72 PolarHBondContact O-N 3.37Å; P70-Y72 PolarHBondContact O-N 2.82Å; Y72-I76 HydrophobicContact CD1-CD1 4Å; Y72-I76 HydrophobicContact CD2-CD1 3.97Å; Y72-I76 HydrophobicContact CE1-CD1 3.47Å; Y72-I76 VanDerWaalsContact CE1-CD1 3.47Å; Y72-I76 HydrophobicContact CE2-CD1 3.44Å; Y72-I76 VanDerWaalsContact CE2-CD1 3.44Å; Y72-I76 HydrophobicContact CG-CD1 4.22Å; Y72-I76 WeakPolarHBondContact O-CG1 3.34Å; Y72-I76 PolarHBondContact O-N 2.86Å; Y72-I76 WeakPolarHBondContact OH-CD1 3.46Å
73	I	57.2	Low	66.8	Low	90 Å²	90	102.2 Å²	102.2	46%	0.462	53%	0.53	S	S	.	.	H	α-helix	trans	-69.7	-43.4	178.7	-67	-179.3	0	0	0	110.7	Y67 R75 I76 A77	Y67-I73 WeakPolarHBondContact O-CD1 3.36Å; I73-R75 VanDerWaalsContact C-N 3.3Å; I73-R75 PolarHBondContact O-N 3.07Å; I73-I76 PolarHBondContact O-N 3.35Å; I73-A77 WeakPolarHBondContact O-CB 3.41Å; I73-A77 PolarHBondContact O-N 3.42Å; I73-A77 VanDerWaalsContact O-N 3.13Å
74	D	58.1	Low	67.4	Low	125 Å²	125	103.8 Å²	103.8	67%	0.668	54%	0.538	S	S	*	.	H	α-helix	trans	-67.9	-28.6	-177	-77.7	-13.8	0	0	0	113	P70	P70-D74 WeakPolarHBondContact O-CB 3.28Å; P70-D74 PolarHBondContact O-N 2.75Å; P70-D74 VanDerWaalsContact O-N 3.14Å
75	R	58.2	Low	67.8	Low	185 Å²	185	105.3 Å²	105.3	70%	0.698	54%	0.542	S	S	*	.	H	α-helix	trans	-81.8	-28.9	177.4	-70.6	-177.9	-171	179.8	12.8	113.9	E71 I73	E71-R75 WeakPolarHBondContact O-CB 3.22Å; E71-R75 WeakPolarHBondContact O-CD 3.35Å; E71-R75 VanDerWaalsContact O-CG 3.24Å; E71-R75 WeakPolarHBondContact O-CG 3.34Å; E71-R75 IonicContact OE2-NH2 3.13Å; E71-R75 PolarHBondContact OE2-NH2 3.4Å; I73-R75 VanDerWaalsContact C-N 3.3Å; I73-R75 PolarHBondContact O-N 3.07Å
76	I	58.4	Low	68.3	Low	109 Å²	109	105.5 Å²	105.5	56%	0.559	54%	0.539	S	S	*	.	H	α-helix	trans	-87.4	-30.6	-176.7	-70	178.1	0	0	0	111.9	Y72 I73	Y72-I76 HydrophobicContact CD1-CD1 4Å; Y72-I76 HydrophobicContact CD2-CD1 3.97Å; Y72-I76 HydrophobicContact CE1-CD1 3.47Å; Y72-I76 VanDerWaalsContact CE1-CD1 3.47Å; Y72-I76 HydrophobicContact CE2-CD1 3.44Å; Y72-I76 VanDerWaalsContact CE2-CD1 3.44Å; Y72-I76 HydrophobicContact CG-CD1 4.22Å; Y72-I76 WeakPolarHBondContact O-CG1 3.34Å; Y72-I76 PolarHBondContact O-N 2.86Å; Y72-I76 WeakPolarHBondContact OH-CD1 3.46Å; I73-I76 PolarHBondContact O-N 3.35Å
77	A	65.8	Low	69.1	Low	63 Å²	63	104.8 Å²	104.8	52%	0.521	54%	0.54	S	S	.	.			trans	-101.8	33.4	-168	0	0	0	0	0	114.2	I73 P79	I73-A77 WeakPolarHBondContact O-CB 3.41Å; I73-A77 PolarHBondContact O-N 3.42Å; I73-A77 VanDerWaalsContact O-N 3.13Å; A77-P79 WeakPolarHBondContact O-CD 3.18Å; A77-P79 VanDerWaalsContact O-N 3.14Å
78	I	63	Low	70.3	Confident	92 Å²	92	102.9 Å²	102.9	47%	0.472	54%	0.538	S	S	.	.			trans	-70.4	108.3	165.1	-55.2	178.5	0	0	0	107	K83	I78-K83 HydrophobicContact CG2-CG 3.7Å; I78-K83 VanDerWaalsContact O-CE 3.32Å; I78-K83 WeakPolarHBondContact O-CE 3.22Å
79	P	74.8	Confident	71.4	Confident	77 Å²	77	100.5 Å²	100.5	50%	0.5	54%	0.537	S	S	.	.			trans	-63.9	144.8	-178.5	-17.5	33.7	0	0	0	109.7	A77 A81 S82 K83	A77-P79 WeakPolarHBondContact O-CD 3.18Å; A77-P79 VanDerWaalsContact O-N 3.14Å; P79-A81 PolarHBondContact O-N 2.87Å; P79-A81 VanDerWaalsContact O-N 3.16Å; P79-S82 WeakPolarHBondContact O-CA 3.24Å; P79-S82 WeakPolarHBondContact O-CB 3.47Å; P79-S82 PolarHBondContact O-N 2.73Å; P79-K83 PolarHBondContact O-N 2.76Å; P79-K83 VanDerWaalsContact O-N 3.17Å
80	D	69.6	Low	72.5	Confident	120 Å²	120	99.7 Å²	99.7	64%	0.642	53%	0.531	S	S	*	.	H	α-helix	trans	-60.4	-31.1	-176.5	-70.5	-23.5	0	0	0	112.9	S82 K83 L84	D80-S82 VanDerWaalsContact C-N 3.3Å; D80-S82 PolarHBondContact O-N 3.34Å; D80-K83 WeakPolarHBondContact O-CB 3.3Å; D80-K83 PolarHBondContact O-N 3.06Å; D80-K83 WeakPolarHBondContact OD1-CE 3.4Å; D80-K83 IonicContact OD1-NZ 3.45Å; D80-K83 PolarHBondContact OD1-NZ 3.41Å; D80-L84 PolarHBondContact O-N 2.95Å
81	A	74.1	Confident	73.9	Confident	75 Å²	75	100.5 Å²	100.5	62%	0.62	53%	0.527	S	S	*	.	H	α-helix	trans	-62.2	-36.2	172.1	0	0	0	0	0	112.7	P79 Q85	P79-A81 PolarHBondContact O-N 2.87Å; P79-A81 VanDerWaalsContact O-N 3.16Å; A81-Q85 WeakPolarHBondContact O-CG 3.4Å; A81-Q85 PolarHBondContact O-N 2.87Å
82	S	75.9	Confident	75.2	Confident	58 Å²	58	102.7 Å²	102.7	41%	0.406	54%	0.538	S	S	.	.	H	α-helix	trans	-73	-31.8	177	-55.4	0	0	0	0	112	P79 D80 Q85 F86	P79-S82 WeakPolarHBondContact O-CA 3.24Å; P79-S82 WeakPolarHBondContact O-CB 3.47Å; P79-S82 PolarHBondContact O-N 2.73Å; D80-S82 VanDerWaalsContact C-N 3.3Å; D80-S82 PolarHBondContact O-N 3.34Å; S82-Q85 PolarHBondContact O-N 3.35Å; S82-F86 VanDerWaalsContact O-CB 3.28Å; S82-F86 WeakPolarHBondContact O-CB 3.28Å; S82-F86 PolarHBondContact O-N 3.42Å
83	K	80	Confident	77	Confident	96 Å²	96	103 Å²	103	42%	0.417	54%	0.541	S	S	.	.	H	α-helix	trans	-62.5	-42.4	174.3	-62	177.3	-172.4	157.4	0	111.5	I78 P79 D80 F86 I87	I78-K83 HydrophobicContact CG2-CG 3.7Å; I78-K83 VanDerWaalsContact O-CE 3.32Å; I78-K83 WeakPolarHBondContact O-CE 3.22Å; P79-K83 PolarHBondContact O-N 2.76Å; P79-K83 VanDerWaalsContact O-N 3.17Å; D80-K83 WeakPolarHBondContact O-CB 3.3Å; D80-K83 PolarHBondContact O-N 3.06Å; D80-K83 WeakPolarHBondContact OD1-CE 3.4Å; D80-K83 IonicContact OD1-NZ 3.45Å; D80-K83 PolarHBondContact OD1-NZ 3.41Å; K83-F86 PolarHBondContact O-N 3.49Å; K83-I87 VanDerWaalsContact O-CG1 3.27Å; K83-I87 WeakPolarHBondContact O-CG1 3.32Å; K83-I87 PolarHBondContact O-N 3.34Å
84	L	83.9	Confident	78.8	Confident	102 Å²	102	102.4 Å²	102.4	53%	0.534	54%	0.538	S	S	.	.	H	α-helix	trans	-63.6	-46.2	177.3	-175.4	69.3	0	0	0	111.5	D80 F86 I87 L88	D80-L84 PolarHBondContact O-N 2.95Å; L84-F86 VanDerWaalsContact C-N 3.3Å; L84-F86 PolarHBondContact O-N 3.27Å; L84-I87 PolarHBondContact O-N 3.01Å; L84-L88 HydrophobicContact CD1-CD1 4.48Å; L84-L88 HydrophobicContact CG-CD1 4.11Å; L84-L88 WeakPolarHBondContact O-CG 3.47Å; L84-L88 PolarHBondContact O-N 2.8Å
85	Q	83.8	Confident	80.5	Confident	126 Å²	126	101.6 Å²	101.6	59%	0.589	53%	0.533	S	S	*	.	H	α-helix	trans	-63.1	-38.5	178	-68.4	-63.7	-38.5	0	0	111.9	A81 S82 L88 A89	A81-Q85 WeakPolarHBondContact O-CG 3.4Å; A81-Q85 PolarHBondContact O-N 2.87Å; S82-Q85 PolarHBondContact O-N 3.35Å; Q85-L88 PolarHBondContact O-N 2.94Å; Q85-A89 WeakPolarHBondContact O-CB 3.05Å; Q85-A89 PolarHBondContact O-N 3.38Å
86	F	84.6	Confident	82.2	Confident	120 Å²	120	95.2 Å²	95.2	53%	0.526	52%	0.517	S	S	.	.	H	α-helix	trans	-62.6	-47.8	175.1	-176.7	-96.3	0	0	0	111.8	S82 K83 L84 L88 A89 E90	S82-F86 VanDerWaalsContact O-CB 3.28Å; S82-F86 WeakPolarHBondContact O-CB 3.28Å; S82-F86 PolarHBondContact O-N 3.42Å; K83-F86 PolarHBondContact O-N 3.49Å; L84-F86 VanDerWaalsContact C-N 3.3Å; L84-F86 PolarHBondContact O-N 3.27Å; F86-L88 VanDerWaalsContact C-N 3.34Å; F86-L88 PolarHBondContact O-N 2.84Å; F86-A89 PolarHBondContact O-N 2.99Å; F86-E90 HydrophobicContact CD2-CG 4.49Å; F86-E90 VanDerWaalsContact CE1-CD 3.5Å; F86-E90 HydrophobicContact CE1-CG 4.28Å; F86-E90 WeakPolarHBondContact CE1-OE2 3.42Å; F86-E90 HydrophobicContact CE2-CG 4.19Å; F86-E90 WeakPolarHBondContact CE2-OE1 3.24Å; F86-E90 HydrophobicContact CZ-CG 4.1Å; F86-E90 WeakPolarHBondContact CZ-OE1 3.33Å; F86-E90 WeakPolarHBondContact CZ-OE2 3.28Å; F86-E90 WeakPolarHBondContact O-CB 3.39Å; F86-E90 WeakPolarHBondContact O-CG 3.47Å; F86-E90 PolarHBondContact O-N 3.32Å
87	I	86.8	Confident	83.8	Confident	99 Å²	99	94.4 Å²	94.4	51%	0.508	51%	0.511	S	S	.	.	H	α-helix	trans	-60.9	-43.4	178	-68.1	165.8	0	0	0	111.2	K83 L84 E90 E91	K83-I87 VanDerWaalsContact O-CG1 3.27Å; K83-I87 WeakPolarHBondContact O-CG1 3.32Å; K83-I87 PolarHBondContact O-N 3.34Å; L84-I87 PolarHBondContact O-N 3.01Å; I87-E90 CarbonylContact O-C 3.57Å; I87-E90 PolarHBondContact O-N 3.21Å; I87-E91 WeakPolarHBondContact O-CA 3.46Å; I87-E91 PolarHBondContact O-N 3.28Å
88	L	88	Confident	85.2	Confident	92 Å²	92	94.8 Å²	94.8	48%	0.482	51%	0.507	S	S	.	.	H	α-helix	trans	-68.8	-39	178.9	-69.1	171.4	0	0	0	112.2	L84 Q85 F86 E90 E91	L84-L88 HydrophobicContact CD1-CD1 4.48Å; L84-L88 HydrophobicContact CG-CD1 4.11Å; L84-L88 WeakPolarHBondContact O-CG 3.47Å; L84-L88 PolarHBondContact O-N 2.8Å; Q85-L88 PolarHBondContact O-N 2.94Å; F86-L88 VanDerWaalsContact C-N 3.34Å; F86-L88 PolarHBondContact O-N 2.84Å; L88-E90 VanDerWaalsContact C-N 3.34Å; L88-E91 WeakPolarHBondContact O-CB 3.39Å; L88-E91 PolarHBondContact O-N 2.62Å
89	A	89.3	Confident	86.7	Confident	84 Å²	84	92.4 Å²	92.4	69%	0.694	50%	0.501	S	S	*	.	H	α-helix	trans	-67	-36.2	176.2	0	0	0	0	0	112.1	Q85 F86	Q85-A89 WeakPolarHBondContact O-CB 3.05Å; Q85-A89 PolarHBondContact O-N 3.38Å; F86-A89 PolarHBondContact O-N 2.99Å
90	E	90.9	Very high	87.7	Confident	65 Å²	65	93.1 Å²	93.1	30%	0.304	50%	0.5	S	S	.	.	H	α-helix	trans	-92.1	1.9	179.4	-65	-159.6	164.9	0	0	114	F86 I87 L88 Q92 F93 I94	F86-E90 HydrophobicContact CD2-CG 4.49Å; F86-E90 VanDerWaalsContact CE1-CD 3.5Å; F86-E90 HydrophobicContact CE1-CG 4.28Å; F86-E90 WeakPolarHBondContact CE1-OE2 3.42Å; F86-E90 HydrophobicContact CE2-CG 4.19Å; F86-E90 WeakPolarHBondContact CE2-OE1 3.24Å; F86-E90 HydrophobicContact CZ-CG 4.1Å; F86-E90 WeakPolarHBondContact CZ-OE1 3.33Å; F86-E90 WeakPolarHBondContact CZ-OE2 3.28Å; F86-E90 WeakPolarHBondContact O-CB 3.39Å; F86-E90 WeakPolarHBondContact O-CG 3.47Å; F86-E90 PolarHBondContact O-N 3.32Å; I87-E90 CarbonylContact O-C 3.57Å; I87-E90 PolarHBondContact O-N 3.21Å; L88-E90 VanDerWaalsContact C-N 3.34Å; E90-Q92 VanDerWaalsContact C-N 3.32Å; E90-Q92 PolarHBondContact O-N 2.99Å; E90-F93 CarbonylContact O-C 3.57Å; E90-F93 WeakPolarHBondContact O-CA 3.31Å; E90-F93 WeakPolarHBondContact O-CB 3.46Å; E90-F93 PolarHBondContact O-N 3.24Å; E90-I94 HydrophobicContact CB-CD1 4.2Å; E90-I94 HydrophobicContact CB-CG1 4.37Å; E90-I94 WeakPolarHBondContact O-CG1 3.37Å; E90-I94 PolarHBondContact O-N 2.94Å
91	E	90.8	Very high	88.9	Confident	105 Å²	105	93 Å²	93	49%	0.491	50%	0.499	S	S	.	.	H	α-helix	trans	-53	-48.9	-175.1	-179	178.3	-158.3	0	0	111.9	I87 L88 F93 I94 L95	I87-E91 WeakPolarHBondContact O-CA 3.46Å; I87-E91 PolarHBondContact O-N 3.28Å; L88-E91 WeakPolarHBondContact O-CB 3.39Å; L88-E91 PolarHBondContact O-N 2.62Å; E91-F93 VanDerWaalsContact C-N 3.31Å; E91-F93 PolarHBondContact O-N 3.2Å; E91-I94 PolarHBondContact O-N 3.49Å; E91-L95 HydrophobicContact CG-CD1 4.08Å; E91-L95 WeakPolarHBondContact O-CB 3.45Å; E91-L95 VanDerWaalsContact O-CG 3.31Å; E91-L95 WeakPolarHBondContact O-CG 3.43Å; E91-L95 PolarHBondContact O-N 2.78Å
92	Q	90.8	Very high	89.9	Confident	164 Å²	164	95.5 Å²	95.5	77%	0.766	50%	0.497	S	S	*	.	H	α-helix	trans	-64.6	-37	178	-66.5	-173.9	-1.5	0	0	112.4	E90 S96	E90-Q92 VanDerWaalsContact C-N 3.32Å; E90-Q92 PolarHBondContact O-N 2.99Å; Q92-S96 VanDerWaalsContact O-CB 3.32Å; Q92-S96 WeakPolarHBondContact O-CB 3.26Å; Q92-S96 PolarHBondContact O-N 3.47Å; Q92-S96 PolarHBondContact O-OG 2.79Å
93	F	93.8	Very high	90.7	Very high	117 Å²	117	98.5 Å²	98.5	51%	0.513	51%	0.505	S	S	.	.	H	α-helix	trans	-65.4	-49.7	176.9	176.3	-104.4	0	0	0	110.5	E90 E91 L95 S96 Q97	E90-F93 CarbonylContact O-C 3.57Å; E90-F93 WeakPolarHBondContact O-CA 3.31Å; E90-F93 WeakPolarHBondContact O-CB 3.46Å; E90-F93 PolarHBondContact O-N 3.24Å; E91-F93 VanDerWaalsContact C-N 3.31Å; E91-F93 PolarHBondContact O-N 3.2Å; F93-L95 PolarHBondContact O-N 2.87Å; F93-S96 PolarHBondContact O-N 2.78Å; F93-S96 PolarHBondContact O-OG 3.42Å; F93-Q97 HydrophobicContact CD1-CG 4.35Å; F93-Q97 HydrophobicContact CD2-CG 4.36Å; F93-Q97 HydrophobicContact CE1-CG 3.95Å; F93-Q97 HydrophobicContact CE2-CG 3.98Å; F93-Q97 HydrophobicContact CZ-CG 3.75Å; F93-Q97 WeakPolarHBondContact O-CG 3.47Å; F93-Q97 PolarHBondContact O-N 3.08Å
94	I	94.3	Very high	91.3	Very high	76 Å²	76	98.4 Å²	98.4	39%	0.39	51%	0.512	S	S	.	.	H	α-helix	trans	-58	-48.1	178.1	-65.5	167.3	0	0	0	110.5	E90 E91 S96 Q97 V98	E90-I94 HydrophobicContact CB-CD1 4.2Å; E90-I94 HydrophobicContact CB-CG1 4.37Å; E90-I94 WeakPolarHBondContact O-CG1 3.37Å; E90-I94 PolarHBondContact O-N 2.94Å; E91-I94 PolarHBondContact O-N 3.49Å; I94-S96 VanDerWaalsContact C-N 3.34Å; I94-S96 PolarHBondContact O-N 3.38Å; I94-Q97 PolarHBondContact O-N 3Å; I94-V98 WeakPolarHBondContact O-CG2 3.46Å; I94-V98 PolarHBondContact O-N 3.01Å
95	L	94.3	Very high	91.7	Very high	108 Å²	108	98.8 Å²	98.8	57%	0.565	52%	0.515	S	S	*	.	H	α-helix	trans	-61.6	-41.4	178.1	-71.7	173.2	0	0	0	112.1	E91 F93 Q97 V98 A99	E91-L95 HydrophobicContact CG-CD1 4.08Å; E91-L95 WeakPolarHBondContact O-CB 3.45Å; E91-L95 VanDerWaalsContact O-CG 3.31Å; E91-L95 WeakPolarHBondContact O-CG 3.43Å; E91-L95 PolarHBondContact O-N 2.78Å; F93-L95 PolarHBondContact O-N 2.87Å; L95-Q97 VanDerWaalsContact C-N 3.35Å; L95-Q97 PolarHBondContact O-N 3Å; L95-V98 PolarHBondContact O-N 3.41Å; L95-A99 PolarHBondContact O-N 3.29Å
96	S	93.6	Very high	92	Very high	52 Å²	52	96.3 Å²	96.3	36%	0.364	52%	0.516	S	S	.	.	H	α-helix	trans	-63.9	-39.3	176.6	75.4	0	0	0	0	112.5	Q92 F93 I94 A99 L100	Q92-S96 VanDerWaalsContact O-CB 3.32Å; Q92-S96 WeakPolarHBondContact O-CB 3.26Å; Q92-S96 PolarHBondContact O-N 3.47Å; Q92-S96 PolarHBondContact O-OG 2.79Å; F93-S96 PolarHBondContact O-N 2.78Å; F93-S96 PolarHBondContact O-OG 3.42Å; I94-S96 VanDerWaalsContact C-N 3.34Å; I94-S96 PolarHBondContact O-N 3.38Å; S96-A99 PolarHBondContact O-N 3.23Å; S96-L100 WeakPolarHBondContact O-CG 3.34Å; S96-L100 PolarHBondContact O-N 3.35Å
97	Q	93.1	Very high	92.3	Very high	92 Å²	92	95.4 Å²	95.4	43%	0.43	52%	0.516	S	S	.	.	H	α-helix	trans	-67.5	-40.2	177.4	-68.9	-60.7	-41.4	0	0	111.5	F93 I94 L95 L100 L101	F93-Q97 HydrophobicContact CD1-CG 4.35Å; F93-Q97 HydrophobicContact CD2-CG 4.36Å; F93-Q97 HydrophobicContact CE1-CG 3.95Å; F93-Q97 HydrophobicContact CE2-CG 3.98Å; F93-Q97 HydrophobicContact CZ-CG 3.75Å; F93-Q97 WeakPolarHBondContact O-CG 3.47Å; F93-Q97 PolarHBondContact O-N 3.08Å; I94-Q97 PolarHBondContact O-N 3Å; L95-Q97 VanDerWaalsContact C-N 3.35Å; L95-Q97 PolarHBondContact O-N 3Å; Q97-L100 PolarHBondContact O-N 3.35Å; Q97-L101 VanDerWaalsContact O-CB 3.22Å; Q97-L101 WeakPolarHBondContact O-CB 3.45Å; Q97-L101 PolarHBondContact O-N 3.3Å
98	V	94.5	Very high	92.4	Very high	71 Å²	71	94.2 Å²	94.2	43%	0.43	51%	0.513	S	S	.	.	H	α-helix	trans	-61.6	-47.6	175	171.9	0	0	0	0	110.8	I94 L95 L100 L101 E102	I94-V98 WeakPolarHBondContact O-CG2 3.46Å; I94-V98 PolarHBondContact O-N 3.01Å; L95-V98 PolarHBondContact O-N 3.41Å; V98-L100 VanDerWaalsContact C-N 3.31Å; V98-L100 PolarHBondContact O-N 2.93Å; V98-L101 PolarHBondContact O-N 3.15Å; V98-L101 VanDerWaalsContact O-N 3.12Å; V98-E102 HydrophobicContact CG1-CG 4.46Å; V98-E102 WeakPolarHBondContact O-CG 3.29Å; V98-E102 PolarHBondContact O-N 2.91Å
99	A	94.9	Very high	92.4	Very high	42 Å²	42	94.2 Å²	94.2	35%	0.347	52%	0.519	S	S	.	.	H	α-helix	trans	-60.8	-39.7	178.8	0	0	0	0	0	112.6	L95 S96 Q103	L95-A99 PolarHBondContact O-N 3.29Å; S96-A99 PolarHBondContact O-N 3.23Å; A99-Q103 WeakPolarHBondContact O-CG 3.4Å; A99-Q103 PolarHBondContact O-N 3.41Å
100	L	94.6	Very high	92.2	Very high	91 Å²	91	96 Å²	96	48%	0.476	51%	0.514	S	S	.	.	H	α-helix	trans	-67.7	-40.9	174.4	-72.2	169.2	0	0	0	111.7	S96 Q97 V98 E102 Q103 V104	S96-L100 WeakPolarHBondContact O-CG 3.34Å; S96-L100 PolarHBondContact O-N 3.35Å; Q97-L100 PolarHBondContact O-N 3.35Å; V98-L100 VanDerWaalsContact C-N 3.31Å; V98-L100 PolarHBondContact O-N 2.93Å; L100-E102 VanDerWaalsContact C-N 3.34Å; L100-E102 PolarHBondContact O-N 3.48Å; L100-Q103 WeakPolarHBondContact O-CB 3.4Å; L100-Q103 PolarHBondContact O-N 2.97Å; L100-V104 WeakPolarHBondContact O-CG2 3.37Å; L100-V104 PolarHBondContact O-N 3.36Å
101	L	94.4	Very high	91.8	Very high	118 Å²	118	99.4 Å²	99.4	62%	0.618	53%	0.534	S	S	*	.	H	α-helix	trans	-66.6	-36.9	179.7	-170.4	143.1	0	0	0	111.7	Q97 V98 Q103 V104 N105	Q97-L101 VanDerWaalsContact O-CB 3.22Å; Q97-L101 WeakPolarHBondContact O-CB 3.45Å; Q97-L101 PolarHBondContact O-N 3.3Å; V98-L101 PolarHBondContact O-N 3.15Å; V98-L101 VanDerWaalsContact O-N 3.12Å; L101-Q103 VanDerWaalsContact C-N 3.35Å; L101-V104 PolarHBondContact O-N 2.88Å; L101-N105 WeakPolarHBondContact O-CB 3.4Å; L101-N105 PolarHBondContact O-N 2.87Å
102	E	95.7	Very high	91.5	Very high	127 Å²	127	100 Å²	100	59%	0.593	54%	0.54	S	S	*	.	H	α-helix	trans	-60.9	-43	172.2	-75.5	178.1	169.4	0	0	111.8	V98 L100 N105 A106	V98-E102 HydrophobicContact CG1-CG 4.46Å; V98-E102 WeakPolarHBondContact O-CG 3.29Å; V98-E102 PolarHBondContact O-N 2.91Å; L100-E102 VanDerWaalsContact C-N 3.34Å; L100-E102 PolarHBondContact O-N 3.48Å; E102-N105 PolarHBondContact O-N 3.31Å; E102-A106 WeakPolarHBondContact O-CB 3.3Å; E102-A106 PolarHBondContact O-N 3.19Å
103	Q	92.6	Very high	91.3	Very high	122 Å²	122	93.7 Å²	93.7	57%	0.57	51%	0.514	S	S	*	.	H	α-helix	trans	-62.5	-44.8	175.2	-68.5	172.2	31.1	0	0	111.6	A99 L100 L101 N105 A106 L107	A99-Q103 WeakPolarHBondContact O-CG 3.4Å; A99-Q103 PolarHBondContact O-N 3.41Å; L100-Q103 WeakPolarHBondContact O-CB 3.4Å; L100-Q103 PolarHBondContact O-N 2.97Å; L101-Q103 VanDerWaalsContact C-N 3.35Å; Q103-N105 VanDerWaalsContact C-N 3.34Å; Q103-N105 PolarHBondContact O-N 3.43Å; Q103-A106 PolarHBondContact O-N 3.17Å; Q103-L107 VanDerWaalsContact O-CG 3.31Å; Q103-L107 WeakPolarHBondContact O-CG 3.39Å; Q103-L107 PolarHBondContact O-N 2.99Å
104	V	92.8	Very high	90.6	Very high	94 Å²	94	91.6 Å²	91.6	57%	0.57	52%	0.519	S	S	*	.	H	α-helix	trans	-61.3	-45.9	176.7	172.5	0	0	0	0	110.3	L100 L101 A106 L107 V108	L100-V104 WeakPolarHBondContact O-CG2 3.37Å; L100-V104 PolarHBondContact O-N 3.36Å; L101-V104 PolarHBondContact O-N 2.88Å; V104-A106 VanDerWaalsContact C-N 3.3Å; V104-A106 PolarHBondContact O-N 3.01Å; V104-L107 PolarHBondContact O-N 3.14Å; V104-V108 WeakPolarHBondContact O-CG2 3.48Å; V104-V108 PolarHBondContact O-N 3.46Å; V104-V108 VanDerWaalsContact O-N 3.08Å
105	N	91.6	Very high	90.1	Very high	109 Å²	109	95.6 Å²	95.6	58%	0.583	54%	0.536	S	S	*	.	H	α-helix	trans	-62.7	-37.5	-179.6	-162.9	30.3	0	0	0	112.1	L101 E102 Q103 L107 V108	L101-N105 WeakPolarHBondContact O-CB 3.4Å; L101-N105 PolarHBondContact O-N 2.87Å; E102-N105 PolarHBondContact O-N 3.31Å; Q103-N105 VanDerWaalsContact C-N 3.34Å; Q103-N105 PolarHBondContact O-N 3.43Å; N105-L107 PolarHBondContact O-N 3.34Å; N105-V108 PolarHBondContact O-N 3.47Å
106	A	91.6	Very high	89.5	Confident	75 Å²	75	95.5 Å²	95.5	62%	0.62	54%	0.535	S	S	*	.	H	α-helix	trans	-64	-28.6	173.7	0	0	0	0	0	113.1	E102 Q103 V104 P109	E102-A106 WeakPolarHBondContact O-CB 3.3Å; E102-A106 PolarHBondContact O-N 3.19Å; Q103-A106 PolarHBondContact O-N 3.17Å; V104-A106 VanDerWaalsContact C-N 3.3Å; V104-A106 PolarHBondContact O-N 3.01Å; A106-P109 WeakPolarHBondContact O-CD 3.29Å
107	L	89.7	Confident	89	Confident	100 Å²	100	99.2 Å²	99.2	52%	0.524	54%	0.544	S	S	.	.	H	α-helix	trans	-88.8	-16.7	-179.3	-67.4	166.9	0	0	0	113.6	Q103 V104 N105 P109 M110	Q103-L107 VanDerWaalsContact O-CG 3.31Å; Q103-L107 WeakPolarHBondContact O-CG 3.39Å; Q103-L107 PolarHBondContact O-N 2.99Å; V104-L107 PolarHBondContact O-N 3.14Å; N105-L107 PolarHBondContact O-N 3.34Å; L107-P109 VanDerWaalsContact C-CD 3.43Å; L107-P109 VanDerWaalsContact C-N 3.34Å; L107-M110 HydrophobicContact CD2-SD 3.78Å; L107-M110 WeakPolarHBondContact O-CB 3.38Å; L107-M110 PolarHBondContact O-N 2.75Å
108	V	90.1	Very high	88.6	Confident	74 Å²	74	96.1 Å²	96.1	45%	0.448	53%	0.534	S	S	.	.	H	α-helix	trans	-50	-45.2	178.3	171.5	0	0	0	0	112.9	V104 N105 M110 L111	V104-V108 WeakPolarHBondContact O-CG2 3.48Å; V104-V108 PolarHBondContact O-N 3.46Å; V104-V108 VanDerWaalsContact O-N 3.08Å; N105-V108 PolarHBondContact O-N 3.47Å; V108-M110 PolarHBondContact O-N 3.23Å; V108-M110 VanDerWaalsContact O-N 3.17Å; V108-L111 WeakPolarHBondContact O-CB 3.31Å; V108-L111 PolarHBondContact O-N 3.05Å
109	P	86.9	Confident	88.2	Confident	93 Å²	93	96.8 Å²	96.8	60%	0.604	54%	0.538	S	S	*	.	H	α-helix	trans	-64.1	-21	-179.8	-22.4	34.9	0	0	0	114.5	A106 L107 L111 D112	A106-P109 WeakPolarHBondContact O-CD 3.29Å; L107-P109 VanDerWaalsContact C-CD 3.43Å; L107-P109 VanDerWaalsContact C-N 3.34Å; P109-L111 VanDerWaalsContact C-N 3.29Å; P109-L111 PolarHBondContact O-N 3.27Å; P109-D112 PolarHBondContact O-N 3.23Å
110	M	85.1	Confident	87.8	Confident	121 Å²	121	99 Å²	99	60%	0.596	55%	0.549	S	S	*	.	H	α-helix	trans	-71.7	-25.9	179.1	-60.7	-166.3	75.2	0	0	112.6	L107 V108 D112 S113	L107-M110 HydrophobicContact CD2-SD 3.78Å; L107-M110 WeakPolarHBondContact O-CB 3.38Å; L107-M110 PolarHBondContact O-N 2.75Å; V108-M110 PolarHBondContact O-N 3.23Å; V108-M110 VanDerWaalsContact O-N 3.17Å; M110-D112 PolarHBondContact O-N 3.18Å; M110-S113 VanDerWaalsContact O-CB 3.3Å; M110-S113 WeakPolarHBondContact O-CB 3.22Å; M110-S113 PolarHBondContact O-N 3.21Å; M110-S113 PolarHBondContact O-OG 3.4Å
111	L	83.1	Confident	87.4	Confident	137 Å²	137	101.1 Å²	101.1	72%	0.717	56%	0.556	S	S	*	*	H	α-helix	trans	-62.8	-31.8	177.4	-61.6	175.6	0	0	0	111.8	V108 P109	V108-L111 WeakPolarHBondContact O-CB 3.31Å; V108-L111 PolarHBondContact O-N 3.05Å; P109-L111 VanDerWaalsContact C-N 3.29Å; P109-L111 PolarHBondContact O-N 3.27Å
112	D	83.6	Confident	87	Confident	116 Å²	116	100.9 Å²	100.9	62%	0.62	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.8	10.9	-179.7	-98.8	-37.4	0	0	0	114.3	P109 M110 A114 K117	P109-D112 PolarHBondContact O-N 3.23Å; M110-D112 PolarHBondContact O-N 3.18Å; D112-A114 PolarHBondContact O-N 3.26Å; D112-K117 PolarHBondContact O-NZ 3.23Å; D112-K117 IonicContact OD1-NZ 3.67Å; D112-K117 PolarHBondContact OD1-NZ 3.43Å
113	S	86.6	Confident	86.6	Confident	32 Å²	32	97 Å²	97	22%	0.224	54%	0.542	C	S	.	.			trans	-60.7	132.9	-174.4	66.6	0	0	0	0	113.1	M110 H115 I116 K117	M110-S113 VanDerWaalsContact O-CB 3.3Å; M110-S113 WeakPolarHBondContact O-CB 3.22Å; M110-S113 PolarHBondContact O-N 3.21Å; M110-S113 PolarHBondContact O-OG 3.4Å; S113-H115 PolarHBondContact O-N 3.42Å; S113-I116 PolarHBondContact O-N 2.72Å; S113-I116 WeakPolarHBondContact OG-CD1 3.5Å; S113-I116 WeakPolarHBondContact OG-CG1 3.31Å; S113-K117 PolarHBondContact O-N 3.21Å
114	A	80.6	Confident	86.4	Confident	73 Å²	73	94.2 Å²	94.2	60%	0.603	54%	0.539	S	S	*	.	H	α-helix	trans	-60	-31.5	179.6	0	0	0	0	0	112.5	D112 K117 A118	D112-A114 PolarHBondContact O-N 3.26Å; A114-K117 PolarHBondContact O-N 3.48Å; A114-A118 WeakPolarHBondContact O-CB 3.18Å; A114-A118 PolarHBondContact O-N 2.9Å
115	H	82.3	Confident	86.2	Confident	161 Å²	161	98.4 Å²	98.4	75%	0.745	55%	0.545	S	S	*	.	H	α-helix	trans	-65.4	-40.4	177.9	-56.2	96.7	0	0	0	112.5	S113 K117 A118 V119	S113-H115 PolarHBondContact O-N 3.42Å; H115-K117 VanDerWaalsContact C-N 3.35Å; H115-A118 PolarHBondContact O-N 3.28Å; H115-V119 WeakPolarHBondContact O-CG2 3.29Å; H115-V119 PolarHBondContact O-N 3.47Å
116	I	82.2	Confident	86.1	Confident	106 Å²	106	98.8 Å²	98.8	54%	0.544	55%	0.547	S	S	.	.	H	α-helix	trans	-67.3	-39.6	174.7	-66.8	175.2	0	0	0	110	S113 A118 V119	S113-I116 PolarHBondContact O-N 2.72Å; S113-I116 WeakPolarHBondContact OG-CD1 3.5Å; S113-I116 WeakPolarHBondContact OG-CG1 3.31Å; I116-A118 VanDerWaalsContact C-N 3.32Å; I116-A118 PolarHBondContact O-N 3.39Å; I116-V119 WeakPolarHBondContact O-CB 3.35Å; I116-V119 VanDerWaalsContact O-CG2 3.31Å; I116-V119 WeakPolarHBondContact O-CG2 3.46Å; I116-V119 PolarHBondContact O-N 3.39Å
117	K	82.9	Confident	86.1	Confident	130 Å²	130	102.2 Å²	102.2	57%	0.565	55%	0.55	S	S	*	.	H	α-helix	trans	-66.2	-31.1	176.7	-69.4	176	179.2	163.9	0	113.1	D112 S113 A114 H115 P120	D112-K117 PolarHBondContact O-NZ 3.23Å; D112-K117 IonicContact OD1-NZ 3.67Å; D112-K117 PolarHBondContact OD1-NZ 3.43Å; S113-K117 PolarHBondContact O-N 3.21Å; A114-K117 PolarHBondContact O-N 3.48Å; H115-K117 VanDerWaalsContact C-N 3.35Å; K117-P120 VanDerWaalsContact O-CD 3.29Å; K117-P120 WeakPolarHBondContact O-CD 3.48Å
118	A	84.8	Confident	86.1	Confident	26 Å²	26	106.5 Å²	106.5	22%	0.215	56%	0.559	C	S	.	*	T	Hydrogen-bonded Turn	trans	-82.4	-4.9	-179.8	0	0	0	0	0	114.5	A114 H115 I116 P120 E121 H122	A114-A118 WeakPolarHBondContact O-CB 3.18Å; A114-A118 PolarHBondContact O-N 2.9Å; H115-A118 PolarHBondContact O-N 3.28Å; I116-A118 VanDerWaalsContact C-N 3.32Å; I116-A118 PolarHBondContact O-N 3.39Å; A118-P120 VanDerWaalsContact C-CD 3.46Å; A118-E121 WeakPolarHBondContact O-CB 3.29Å; A118-E121 PolarHBondContact O-N 3.12Å; A118-E121 VanDerWaalsContact O-N 3.12Å; A118-H122 PolarHBondContact O-CD2 2.83Å; A118-H122 VanDerWaalsContact O-CD2 3.24Å; A118-H122 PolarHBondContact O-N 2.91Å
119	V	86.6	Confident	86.2	Confident	85 Å²	85	108.5 Å²	108.5	52%	0.515	57%	0.567	S	S	.	*	H	α-helix	trans	-53.8	-42.9	-179.6	174.3	0	0	0	0	113.7	H115 I116 E121 H122 A123	H115-V119 WeakPolarHBondContact O-CG2 3.29Å; H115-V119 PolarHBondContact O-N 3.47Å; I116-V119 WeakPolarHBondContact O-CB 3.35Å; I116-V119 VanDerWaalsContact O-CG2 3.31Å; I116-V119 WeakPolarHBondContact O-CG2 3.46Å; I116-V119 PolarHBondContact O-N 3.39Å; V119-E121 VanDerWaalsContact C-N 3.28Å; V119-E121 PolarHBondContact O-N 3.31Å; V119-H122 PolarHBondContact O-N 3.3Å; V119-A123 PolarHBondContact O-N 3.24Å
120	P	86.8	Confident	86.4	Confident	90 Å²	90	106.1 Å²	106.1	58%	0.584	56%	0.555	S	S	*	*	H	α-helix	trans	-61.2	-33.2	178.8	-24.2	35.9	0	0	0	113.8	K117 A118 A123 A124	K117-P120 VanDerWaalsContact O-CD 3.29Å; K117-P120 WeakPolarHBondContact O-CD 3.48Å; A118-P120 VanDerWaalsContact C-CD 3.46Å; P120-A123 PolarHBondContact O-N 3.21Å; P120-A124 PolarHBondContact O-N 3.41Å
121	E	84.8	Confident	86.7	Confident	134 Å²	134	105.4 Å²	105.4	63%	0.626	55%	0.55	S	S	*	.	H	α-helix	trans	-67.5	-40.1	177.5	-61.8	-173	172.5	0	0	111.6	A118 V119	A118-E121 WeakPolarHBondContact O-CB 3.29Å; A118-E121 PolarHBondContact O-N 3.12Å; A118-E121 VanDerWaalsContact O-N 3.12Å; V119-E121 VanDerWaalsContact C-N 3.28Å; V119-E121 PolarHBondContact O-N 3.31Å
122	H	86.3	Confident	87.2	Confident	113 Å²	113	102.6 Å²	102.6	52%	0.523	54%	0.535	S	S	.	.	H	α-helix	trans	-71.6	-34.1	175.6	-64	-59.9	0	0	0	112.1	A118 V119 A124 R125 L126	A118-H122 PolarHBondContact O-CD2 2.83Å; A118-H122 VanDerWaalsContact O-CD2 3.24Å; A118-H122 PolarHBondContact O-N 2.91Å; V119-H122 PolarHBondContact O-N 3.3Å; H122-A124 VanDerWaalsContact C-N 3.35Å; H122-A124 PolarHBondContact O-N 3.38Å; H122-R125 PolarHBondContact O-N 2.89Å; H122-L126 WeakPolarHBondContact O-CB 3.34Å; H122-L126 PolarHBondContact O-N 3.26Å
123	A	87.9	Confident	87.5	Confident	47 Å²	47	101.7 Å²	101.7	39%	0.388	53%	0.527	S	S	.	.	H	α-helix	trans	-60.5	-41.2	177.3	0	0	0	0	0	112.4	V119 P120 R125 L126 Q127	V119-A123 PolarHBondContact O-N 3.24Å; P120-A123 PolarHBondContact O-N 3.21Å; A123-R125 PolarHBondContact O-N 3.31Å; A123-L126 PolarHBondContact O-N 3.46Å; A123-Q127 WeakPolarHBondContact O-CB 3.38Å; A123-Q127 PolarHBondContact O-N 2.81Å
124	A	87.5	Confident	87.8	Confident	62 Å²	62	104.6 Å²	104.6	51%	0.512	54%	0.539	S	S	.	.	H	α-helix	trans	-63.1	-40.7	177.4	0	0	0	0	0	112.6	P120 H122 R128	P120-A124 PolarHBondContact O-N 3.41Å; H122-A124 VanDerWaalsContact C-N 3.35Å; H122-A124 PolarHBondContact O-N 3.38Å; A124-R128 PolarHBondContact O-N 3.04Å
125	R	88.1	Confident	88.2	Confident	183 Å²	183	106.1 Å²	106.1	69%	0.691	53%	0.533	S	S	*	.	H	α-helix	trans	-68.5	-42	175.7	-65.1	-176.4	-172.3	173.7	5.2	111.4	H122 A123 R128 L129	H122-R125 PolarHBondContact O-N 2.89Å; A123-R125 PolarHBondContact O-N 3.31Å; R125-R128 PolarHBondContact O-N 3.21Å; R125-L129 PolarHBondContact O-N 3.46Å
126	L	91.4	Very high	88.5	Confident	117 Å²	117	103.3 Å²	103.3	61%	0.613	52%	0.521	S	S	*	.	H	α-helix	trans	-63.6	-41.7	177.4	-173.4	67	0	0	0	111.7	H122 A123 R128 L129 A130	H122-L126 WeakPolarHBondContact O-CB 3.34Å; H122-L126 PolarHBondContact O-N 3.26Å; A123-L126 PolarHBondContact O-N 3.46Å; L126-R128 PolarHBondContact O-N 3.37Å; L126-L129 PolarHBondContact O-N 2.86Å; L126-A130 WeakPolarHBondContact O-CB 3.38Å; L126-A130 PolarHBondContact O-N 3.43Å
127	Q	90.2	Very high	88.5	Confident	147 Å²	147	103.3 Å²	103.3	69%	0.687	52%	0.518	S	S	*	.	H	α-helix	trans	-62.1	-42	177.2	-175.5	179.6	-10.9	0	0	111.8	A123 A130 Q131	A123-Q127 WeakPolarHBondContact O-CB 3.38Å; A123-Q127 PolarHBondContact O-N 2.81Å; Q127-A130 PolarHBondContact O-N 3.44Å; Q127-Q131 PolarHBondContact O-N 3.34Å
128	R	89.8	Confident	88.6	Confident	189 Å²	189	101.3 Å²	101.3	71%	0.713	52%	0.517	S	S	*	.	H	α-helix	trans	-62.8	-43.2	174.5	179.9	178.1	-83.7	-157.3	-4.1	111.4	A124 R125 L126 Q131 I132	A124-R128 PolarHBondContact O-N 3.04Å; R125-R128 PolarHBondContact O-N 3.21Å; L126-R128 PolarHBondContact O-N 3.37Å; R128-Q131 PolarHBondContact O-N 2.99Å; R128-I132 HydrophobicContact CG-CD1 4.21Å; R128-I132 WeakPolarHBondContact O-CG1 3.4Å; R128-I132 PolarHBondContact O-N 3.22Å; R128-I132 VanDerWaalsContact O-N 3.1Å
129	L	92.7	Very high	87.8	Confident	117 Å²	117	109.3 Å²	109.3	61%	0.613	54%	0.541	S	S	*	.	H	α-helix	trans	-65.9	-41.2	178.4	-169.1	129.8	0	0	0	111.8	R125 L126 Q131 I132 H133	R125-L129 PolarHBondContact O-N 3.46Å; L126-L129 PolarHBondContact O-N 2.86Å; L129-Q131 VanDerWaalsContact C-N 3.32Å; L129-Q131 PolarHBondContact O-N 3.3Å; L129-I132 PolarHBondContact O-N 3.26Å; L129-H133 WeakPolarHBondContact O-CB 3.39Å; L129-H133 PolarHBondContact O-N 3.48Å
130	A	91.8	Very high	86.6	Confident	43 Å²	43	112.5 Å²	112.5	36%	0.355	55%	0.551	S	S	.	*	H	α-helix	trans	-60.4	-41.2	174.2	0	0	0	0	0	111.7	L126 Q127 H133 I134	L126-A130 WeakPolarHBondContact O-CB 3.38Å; L126-A130 PolarHBondContact O-N 3.43Å; Q127-A130 PolarHBondContact O-N 3.44Å; A130-H133 PolarHBondContact O-N 3.05Å; A130-I134 VanDerWaalsContact O-CG1 3.26Å; A130-I134 WeakPolarHBondContact O-CG1 3.32Å; A130-I134 PolarHBondContact O-N 3.46Å
131	Q	90.8	Very high	85.3	Confident	106 Å²	106	111.6 Å²	111.6	50%	0.495	56%	0.558	S	S	.	*	H	α-helix	trans	-62.7	-43.4	176.1	-172.8	63.7	23.1	0	0	112.2	Q127 R128 L129 H133 I134 Q135	Q127-Q131 PolarHBondContact O-N 3.34Å; R128-Q131 PolarHBondContact O-N 2.99Å; L129-Q131 VanDerWaalsContact C-N 3.32Å; L129-Q131 PolarHBondContact O-N 3.3Å; Q131-H133 VanDerWaalsContact C-N 3.34Å; Q131-I134 PolarHBondContact O-N 3.43Å; Q131-Q135 WeakPolarHBondContact O-CG 3.26Å; Q131-Q135 PolarHBondContact O-N 3.1Å
132	I	93.1	Very high	83.6	Confident	78 Å²	78	117.1 Å²	117.1	40%	0.4	57%	0.573	S	S	.	*	H	α-helix	trans	-64.4	-42.6	176.1	-66.6	166	0	0	0	110.2	R128 L129 I134 Q135 Q136	R128-I132 HydrophobicContact CG-CD1 4.21Å; R128-I132 WeakPolarHBondContact O-CG1 3.4Å; R128-I132 PolarHBondContact O-N 3.22Å; R128-I132 VanDerWaalsContact O-N 3.1Å; L129-I132 PolarHBondContact O-N 3.26Å; I132-I134 PolarHBondContact O-N 2.91Å; I132-Q135 WeakPolarHBondContact O-CB 3.44Å; I132-Q135 PolarHBondContact O-N 2.87Å; I132-Q135 VanDerWaalsContact O-N 3.16Å; I132-Q136 HydrophobicContact CG2-CG 4.4Å; I132-Q136 WeakPolarHBondContact O-CG 3.4Å; I132-Q136 PolarHBondContact O-N 3.16Å
133	H	90.8	Very high	83.5	Confident	97 Å²	97	117.3 Å²	117.3	45%	0.449	58%	0.575	S	S	.	*	H	α-helix	trans	-61.4	-44.4	178.1	-177.7	66.8	0	0	0	111.9	L129 A130 Q131 Q135 Q136 Q137	L129-H133 WeakPolarHBondContact O-CB 3.39Å; L129-H133 PolarHBondContact O-N 3.48Å; A130-H133 PolarHBondContact O-N 3.05Å; Q131-H133 VanDerWaalsContact C-N 3.34Å; H133-Q135 VanDerWaalsContact C-N 3.3Å; H133-Q135 PolarHBondContact O-N 3.05Å; H133-Q136 PolarHBondContact O-N 2.93Å; H133-Q137 WeakPolarHBondContact O-CG 3.37Å; H133-Q137 PolarHBondContact O-N 3.17Å
134	I	92.9	Very high	83.2	Confident	92 Å²	92	121 Å²	121	47%	0.472	59%	0.585	S	S	.	*	H	α-helix	trans	-59.4	-43	174.1	-68.7	163.4	0	0	0	110.6	A130 Q131 I132 Q136 Q137 V138	A130-I134 VanDerWaalsContact O-CG1 3.26Å; A130-I134 WeakPolarHBondContact O-CG1 3.32Å; A130-I134 PolarHBondContact O-N 3.46Å; Q131-I134 PolarHBondContact O-N 3.43Å; I132-I134 PolarHBondContact O-N 2.91Å; I134-Q136 PolarHBondContact O-N 3.5Å; I134-Q137 PolarHBondContact O-N 3.48Å; I134-V138 VanDerWaalsContact O-CG2 3.28Å; I134-V138 WeakPolarHBondContact O-CG2 3.28Å; I134-V138 PolarHBondContact O-N 2.85Å
135	Q	89	Confident	83	Confident	105 Å²	105	124.3 Å²	124.3	49%	0.491	59%	0.589	S	S	.	*	H	α-helix	trans	-63	-41.6	176.8	-74.1	178.9	-21.2	0	0	112.3	Q131 I132 H133 V138 W139	Q131-Q135 WeakPolarHBondContact O-CG 3.26Å; Q131-Q135 PolarHBondContact O-N 3.1Å; I132-Q135 WeakPolarHBondContact O-CB 3.44Å; I132-Q135 PolarHBondContact O-N 2.87Å; I132-Q135 VanDerWaalsContact O-N 3.16Å; H133-Q135 VanDerWaalsContact C-N 3.3Å; H133-Q135 PolarHBondContact O-N 3.05Å; Q135-V138 PolarHBondContact O-N 3.38Å; Q135-W139 WeakPolarHBondContact O-CB 3.44Å; Q135-W139 PolarHBondContact O-N 3.42Å
136	Q	88.1	Confident	82.7	Confident	103 Å²	103	120.8 Å²	120.8	48%	0.481	58%	0.583	S	S	.	*	H	α-helix	trans	-63.8	-45.2	176.4	-73.6	173.7	-20.5	0	0	111.8	I132 H133 I134 V138 W139 E140	I132-Q136 HydrophobicContact CG2-CG 4.4Å; I132-Q136 WeakPolarHBondContact O-CG 3.4Å; I132-Q136 PolarHBondContact O-N 3.16Å; H133-Q136 PolarHBondContact O-N 2.93Å; I134-Q136 PolarHBondContact O-N 3.5Å; Q136-V138 VanDerWaalsContact C-N 3.32Å; Q136-V138 PolarHBondContact O-N 3.21Å; Q136-W139 PolarHBondContact O-N 3.4Å; Q136-E140 PolarHBondContact O-N 3.04Å
137	Q	83	Confident	82.2	Confident	106 Å²	106	121.1 Å²	121.1	50%	0.495	58%	0.581	S	S	.	*	H	α-helix	trans	-61.1	-39.3	177	-70.1	-69.9	-63.3	0	0	112.4	H133 I134 W139 G141	H133-Q137 WeakPolarHBondContact O-CG 3.37Å; H133-Q137 PolarHBondContact O-N 3.17Å; I134-Q137 PolarHBondContact O-N 3.48Å; Q137-W139 VanDerWaalsContact C-N 3.29Å; Q137-W139 PolarHBondContact O-N 3.02Å; Q137-G141 PolarHBondContact O-N 3.42Å
138	V	83.8	Confident	81.6	Confident	87 Å²	87	119.3 Å²	119.3	53%	0.527	57%	0.574	S	S	.	*	H	α-helix	trans	-71.3	-24.7	175.4	173.1	0	0	0	0	112.4	I134 Q135 Q136	I134-V138 VanDerWaalsContact O-CG2 3.28Å; I134-V138 WeakPolarHBondContact O-CG2 3.28Å; I134-V138 PolarHBondContact O-N 2.85Å; Q135-V138 PolarHBondContact O-N 3.38Å; Q136-V138 VanDerWaalsContact C-N 3.32Å; Q136-V138 PolarHBondContact O-N 3.21Å
139	W	68.4	Low	81	Confident	195 Å²	195	114.4 Å²	114.4	74%	0.739	56%	0.564	S	S	*	*	H	α-helix	trans	-83.4	-39.1	176.3	-87.7	56.2	0	0	0	113.1	Q135 Q136 Q137 G141	Q135-W139 WeakPolarHBondContact O-CB 3.44Å; Q135-W139 PolarHBondContact O-N 3.42Å; Q136-W139 PolarHBondContact O-N 3.4Å; Q137-W139 VanDerWaalsContact C-N 3.29Å; Q137-W139 PolarHBondContact O-N 3.02Å; W139-G141 VanDerWaalsContact C-N 3.34Å
140	E	61.9	Low	80.1	Confident	152 Å²	152	114.2 Å²	114.2	71%	0.71	56%	0.561	S	S	*	*	H	α-helix	trans	-75.9	-21.3	177.8	-72.4	178.1	161.8	0	0	113.1	Q136 R142	Q136-E140 PolarHBondContact O-N 3.04Å; E140-R142 VanDerWaalsContact C-N 3.29Å; E140-R142 PolarHBondContact O-N 3.45Å
141	G	58.9	Low	79.2	Confident	71 Å²	71	120.1 Å²	120.1	73%	0.732	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.6	13.5	175.4	0	0	0	0	0	115.4	Q137 W139	Q137-G141 PolarHBondContact O-N 3.42Å; W139-G141 VanDerWaalsContact C-N 3.34Å
142	R	49.4	Very low	78.1	Confident	249 Å²	249	121.4 Å²	121.4	94%	0.94	59%	0.585	S	S	*	*			trans	-114.9	0	177.3	-101.5	-167.1	-70.7	-159.4	-0.3	112.7	E140	E140-R142 VanDerWaalsContact C-N 3.29Å; E140-R142 PolarHBondContact O-N 3.45Å

Retrieved 142 of 142 residues in 29.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).