X6RAC9_HUMAN Loading...

Eukaryotic translation initiation factor 4C

Component of the 43S pre-initiation complex (43S PIC), which binds to the mRNA cap-proximal region, scans mRNA 5'-untranslated region, and locates the initiation codon. This protein enhances formation of the cap-proximal complex. Together with EIF1, facilitates scanning, start codon recognition, promotion of the assembly of 48S complex at the initiation codon (43S PIC becomes 48S PIC after the start codon is reached), and dissociation of aberrant complexes. After start codon location, together with EIF5B orients the initiator methionine-tRNA in a conformation that allows 60S ribosomal subunit joining to form the 80S initiation complex. Is released after 80S initiation complex formation, just after GTP hydrolysis by EIF5B, and before release of EIF5B. Its globular part is located in the A site of the 40S ribosomal subunit. Its interaction with EIF5 during scanning contribute to the maintenance of EIF1 within the open 43S PIC. In contrast to yeast orthologs, does not bind EIF1.

AlphaFold DB , UniProt , Accession X6RAC9, Species HUMAN (Homo sapiens, Human), Gene EIF1AX, Length 116 aa.

						>X6RAC9_HUMAN|X6RAC9|EIF1AX
MPKNKEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.4	Low	83.6	Confident	132 Å²	132	68.4 Å²	68.4	65%	0.65	33%	0.332	S	S	*	.				0	135.4	0	-147.8	156.5	167.7	0	0	109.4	Y7 L50	M1-Y7 HydrophobicContact CE-CD1 4.49Å; M1-Y7 HydrophobicContact CE-CD2 3.82Å; M1-Y7 HydrophobicContact CE-CE1 4.01Å; M1-Y7 HydrophobicContact CE-CE2 3.28Å; M1-Y7 HydrophobicContact CE-CG 4.39Å; M1-Y7 HydrophobicContact SD-CE2 3.93Å; M1-L50 HydrophobicContact CE-CD1 3.98Å
2	P	55.2	Low	84.5	Confident	82 Å²	82	70.8 Å²	70.8	53%	0.532	34%	0.34	S	S	.	.			trans	-63.6	138.4	176.4	25.5	-32.1	0	0	0	110.3	N4 K5	P2-N4 PolarHBondContact O-N 2.62Å; P2-K5 HydrophobicContact CG-CD 3.87Å; P2-K5 HydrophobicContact CG-CG 4.22Å; P2-K5 PolarHBondContact O-N 2.98Å
3	K	69	Low	85.3	Confident	215 Å²	215	71.6 Å²	71.6	94%	0.935	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.9	-1.5	-167.1	-82.6	-174.8	173.7	-178.3	0	117.7
4	N	87.1	Confident	85.9	Confident	61 Å²	61	72.1 Å²	72.1	33%	0.326	35%	0.35	S	S	.	.	T	Hydrogen-bonded Turn	trans	-133.2	30.7	-171.1	-135.1	20.5	0	0	0	113.5	P2 G52 L53 D55	P2-N4 PolarHBondContact O-N 2.62Å; N4-G52 WeakPolarHBondContact O-CA 3.36Å; N4-L53 PolarHBondContact ND2-O 3.38Å; N4-L53 VanDerWaalsContact ND2-O 3.17Å; N4-L53 PolarHBondContact O-N 2.77Å; N4-L53 WeakPolarHBondContact OD1-CB 3.5Å; N4-D55 PolarHBondContact ND2-OD1 2.94Å; N4-D55 PolarHBondContact OD1-OD1 3.05Å
5	K	91	Very high	86.3	Confident	81 Å²	81	70.1 Å²	70.1	35%	0.352	36%	0.355	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	146.2	174.9	-57.8	-172.8	-171.8	177.7	0	109.4	P2 L50 V51 I64	P2-K5 HydrophobicContact CG-CD 3.87Å; P2-K5 HydrophobicContact CG-CG 4.22Å; P2-K5 PolarHBondContact O-N 2.98Å; K5-L50 HydrophobicContact CB-CD1 4.13Å; K5-L50 HydrophobicContact CD-CD2 3.95Å; K5-L50 HydrophobicContact CD-CG 4.38Å; K5-V51 CarbonylContact C-O 3.6Å; K5-V51 WeakPolarHBondContact CA-O 3.43Å; K5-I64 HydrophobicContact CD-CD1 3.75Å; K5-I64 HydrophobicContact CG-CD1 3.86Å
6	E	92.1	Very high	86.6	Confident	48 Å²	48	73.1 Å²	73.1	22%	0.224	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	148.9	-179.9	-170.1	50.8	-95.9	0	0	109	C23 D25 V51 L53	E6-C23 HydrophobicContact CG-CB 4.07Å; E6-D25 HydrophobicContact CG-CB 4.43Å; E6-V51 HydrophobicContact CB-CG2 4.1Å; E6-V51 PolarHBondContact N-O 3.29Å; E6-V51 WeakPolarHBondContact O-CG2 3.36Å; E6-V51 PolarHBondContact O-N 2.93Å; E6-L53 HydrophobicContact CB-CD1 4.22Å; E6-L53 HydrophobicContact CB-CD2 4.28Å; E6-L53 HydrophobicContact CB-CG 4.28Å
7	Y	93.5	Very high	86.8	Confident	22 Å²	22	69.6 Å²	69.6	9%	0.086	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.6	147.5	170.6	-62.7	-68.1	0	0	0	109.3	M1 C23 F24 L50 Y67 L75 E80 L81	M1-Y7 HydrophobicContact CE-CD1 4.49Å; M1-Y7 HydrophobicContact CE-CD2 3.82Å; M1-Y7 HydrophobicContact CE-CE1 4.01Å; M1-Y7 HydrophobicContact CE-CE2 3.28Å; M1-Y7 HydrophobicContact CE-CG 4.39Å; M1-Y7 HydrophobicContact SD-CE2 3.93Å; Y7-C23 WeakPolarHBondContact O-CA 3.25Å; Y7-F24 VanDerWaalsContact C-CD2 3.46Å; Y7-F24 VanDerWaalsContact CB-CD2 3.48Å; Y7-F24 WeakPolarHBondContact O-CD2 3.35Å; Y7-F24 PolarHBondContact O-N 3.45Å; Y7-L50 HydrophobicContact CD1-CD1 3.91Å; Y7-L50 HydrophobicContact CE1-CD1 3.91Å; Y7-Y67 AromaticContact CD1-CE2 3.8Å; Y7-Y67 HydrophobicContact CD1-CE2 3.8Å; Y7-Y67 AromaticContact CE1-CE2 3.66Å; Y7-Y67 HydrophobicContact CE1-CE2 3.66Å; Y7-Y67 AromaticContact CE1-CZ 3.78Å; Y7-Y67 WeakPolarHBondContact CE1-OH 2.84Å; Y7-L75 HydrophobicContact CD1-CD1 4.44Å; Y7-L75 HydrophobicContact CE1-CD1 4.05Å; Y7-L75 HydrophobicContact CE1-CD2 4.21Å; Y7-E80 HydrophobicContact CE2-CB 3.95Å; Y7-E80 HydrophobicContact CE2-CG 4.49Å; Y7-L81 HydrophobicContact CD2-CD2 4.47Å; Y7-L81 HydrophobicContact CG-CD2 4.24Å
8	A	94.3	Very high	87.2	Confident	0 Å²	0	73 Å²	73	0%	0	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.7	155.1	174.9	0	0	0	0	0	111.7	A21 M22 C23 I49 V51	A8-A21 HydrophobicContact CB-CB 3.8Å; A8-M22 CarbonylContact C-O 3.53Å; A8-M22 VanDerWaalsContact CA-O 3.25Å; A8-M22 WeakPolarHBondContact CA-O 3.3Å; A8-M22 WeakPolarHBondContact CB-O 2.95Å; A8-C23 HydrophobicContact CB-CB 4.36Å; A8-I49 HydrophobicContact CB-CG1 4.09Å; A8-I49 PolarHBondContact N-O 3.21Å; A8-I49 WeakPolarHBondContact O-CG1 3.3Å; A8-I49 PolarHBondContact O-N 3.31Å; A8-V51 HydrophobicContact CB-CG1 4.06Å; A8-V51 HydrophobicContact CB-CG2 4.17Å
9	Q	93.9	Very high	87.7	Confident	42 Å²	42	69.2 Å²	69.2	20%	0.196	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	132.3	170	178.7	165.4	56	0	0	110.3	I11 A21 M22 F24 S46 D47 I48 K86	Q9-I11 PolarHBondContact O-N 3.33Å; Q9-A21 CarbonylContact O-C 3.49Å; Q9-A21 WeakPolarHBondContact O-CA 3.42Å; Q9-A21 WeakPolarHBondContact O-CB 3.19Å; Q9-M22 PolarHBondContact N-O 2.86Å; Q9-M22 PolarHBondContact O-N 3.26Å; Q9-F24 HydrophobicContact CB-CZ 4.24Å; Q9-S46 PolarHBondContact NE2-O 3.46Å; Q9-D47 WeakPolarHBondContact CA-O 3.43Å; Q9-I48 HydrophobicContact CB-CD1 3.97Å; Q9-I48 HydrophobicContact CG-CD1 4.12Å; Q9-K86 PolarHBondContact NE2-O 2.89Å
10	V	94.5	Very high	88.1	Confident	1 Å²	1	67.4 Å²	67.4	1%	0.006	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.2	123.6	177.3	-177.7	0	0	0	0	110.1	M13 L19 I43 N44 S46 D47 I49	V10-M13 HydrophobicContact CG1-SD 4.11Å; V10-L19 HydrophobicContact CG1-CB 4.46Å; V10-L19 HydrophobicContact CG1-CD1 4.3Å; V10-L19 HydrophobicContact CG1-CD2 4.46Å; V10-L19 HydrophobicContact CG2-CD1 4.17Å; V10-L19 HydrophobicContact CG2-CD2 4.18Å; V10-I43 HydrophobicContact CG2-CG2 3.76Å; V10-N44 WeakPolarHBondContact CB-O 3.43Å; V10-N44 WeakPolarHBondContact CG1-O 3.49Å; V10-S46 WeakPolarHBondContact O-CA 3.44Å; V10-S46 PolarHBondContact O-N 2.71Å; V10-D47 HydrophobicContact CG2-CB 4.35Å; V10-D47 PolarHBondContact N-O 3.21Å; V10-I49 HydrophobicContact CG2-CD1 3.92Å; V10-I49 HydrophobicContact CG2-CG1 4.21Å; V10-I49 HydrophobicContact CG2-CG2 4.03Å
11	I	94.6	Very high	88.5	Confident	68 Å²	68	64.2 Å²	64.2	35%	0.349	32%	0.321	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.7	-52.3	175.5	-58.4	169.6	0	0	0	109.8	Q9 E20 M22 K28	Q9-I11 PolarHBondContact O-N 3.33Å; I11-E20 HydrophobicContact CD1-CG 4.32Å; I11-E20 PolarHBondContact N-O 2.83Å; I11-M22 HydrophobicContact CD1-CB 3.67Å; I11-M22 HydrophobicContact CG1-CB 3.87Å; I11-K28 HydrophobicContact CD1-CD 3.93Å; I11-K28 HydrophobicContact CD1-CG 4Å
12	K	94.6	Very high	90.4	Very high	97 Å²	97	61 Å²	61	42%	0.422	31%	0.305	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.9	147.1	-176.6	66.2	-179	-154.9	-136.9	0	112.3	L14 L19 E20	K12-L14 HydrophobicContact CD-CD2 4.31Å; K12-L14 HydrophobicContact CG-CD2 4.35Å; K12-L19 WeakPolarHBondContact O-CA 3.4Å; K12-E20 WeakPolarHBondContact CD-OE2 3.47Å; K12-E20 WeakPolarHBondContact CE-OE2 3.46Å; K12-E20 HydrophobicContact CG-CB 3.77Å; K12-E20 PolarHBondContact N-O 3.06Å; K12-E20 IonicContact NZ-OE2 2.62Å; K12-E20 PolarHBondContact NZ-OE2 3.48Å; K12-E20 PolarHBondContact O-N 2.94Å
13	M	94.4	Very high	92.2	Very high	82 Å²	82	57.1 Å²	57.1	40%	0.404	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	134.3	171.6	-61.9	-60.4	-79.7	0	0	109.6	V10 L19 I33 I43 T45	V10-M13 HydrophobicContact CG1-SD 4.11Å; M13-L19 HydrophobicContact SD-CB 3.75Å; M13-L19 HydrophobicContact SD-CD2 4.1Å; M13-I33 HydrophobicContact CE-CD1 4.22Å; M13-I43 VanDerWaalsContact CE-O 3.27Å; M13-I43 WeakPolarHBondContact CE-O 3.47Å; M13-T45 HydrophobicContact CG-CG2 4.43Å
14	L	93.8	Very high	93.2	Very high	79 Å²	79	49.3 Å²	49.3	41%	0.414	25%	0.247	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	-4.4	-179.8	-64	174.3	0	0	0	112.9	K12 R18 E20 L30	K12-L14 HydrophobicContact CD-CD2 4.31Å; K12-L14 HydrophobicContact CG-CD2 4.35Å; L14-R18 HydrophobicContact CB-CB 4.09Å; L14-R18 WeakPolarHBondContact CB-O 3.39Å; L14-R18 HydrophobicContact CD1-CB 4.47Å; L14-R18 PolarHBondContact N-O 3.49Å; L14-E20 HydrophobicContact CD1-CB 4.47Å; L14-L30 HydrophobicContact CD1-CD2 3.28Å
15	G	91.8	Very high	93.3	Very high	41 Å²	41	49.8 Å²	49.8	42%	0.423	25%	0.249	S	C	.	.	E	Extended strand (participates in β ladder)	trans	76.8	173.7	-174.3	0	0	0	0	0	113.1	G17 R18	G15-G17 PolarHBondContact O-N 2.96Å; G15-R18 PolarHBondContact N-O 2.95Å; G15-R18 PolarHBondContact O-N 2.81Å
16	N	91.1	Very high	93.2	Very high	119 Å²	119	48.3 Å²	48.3	64%	0.636	26%	0.257	S	S	*	.	T	Hydrogen-bonded Turn	trans	47.4	38	-174.1	-165	9.7	0	0	0	112.7	R18 R38	N16-R18 VanDerWaalsContact C-N 3.28Å; N16-R18 PolarHBondContact O-N 3.07Å; N16-R38 VanDerWaalsContact C-NH2 3.34Å; N16-R38 PolarHBondContact O-NH2 2.99Å
17	G	90.4	Very high	93.2	Very high	14 Å²	14	48.2 Å²	48.2	14%	0.144	26%	0.259	C	S	.	.	T	Hydrogen-bonded Turn	trans	45.5	43.4	-172.2	0	0	0	0	0	115.8	G15 I33 R38	G15-G17 PolarHBondContact O-N 2.96Å; G17-I33 WeakPolarHBondContact O-CB 3.37Å; G17-I33 WeakPolarHBondContact O-CG1 3.41Å; G17-I33 PolarHBondContact O-N 3.37Å; G17-R38 PolarHBondContact O-NH2 2.78Å
18	R	94.4	Very high	93.3	Very high	130 Å²	130	52.9 Å²	52.9	49%	0.491	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	150.1	160	-63	178.7	-177.3	116.8	1.3	108.7	L14 G15 N16 C31	L14-R18 HydrophobicContact CB-CB 4.09Å; L14-R18 WeakPolarHBondContact CB-O 3.39Å; L14-R18 HydrophobicContact CD1-CB 4.47Å; L14-R18 PolarHBondContact N-O 3.49Å; G15-R18 PolarHBondContact N-O 2.95Å; G15-R18 PolarHBondContact O-N 2.81Å; N16-R18 VanDerWaalsContact C-N 3.28Å; N16-R18 PolarHBondContact O-N 3.07Å; R18-C31 WeakPolarHBondContact CA-O 3.48Å
19	L	95.9	Very high	93.3	Very high	0 Å²	0	53.1 Å²	53.1	0%	0	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145	161	174.4	63.8	84.2	0	0	0	109.8	V10 K12 M13 A21 C31 I33 I43 I49 V63	V10-L19 HydrophobicContact CG1-CB 4.46Å; V10-L19 HydrophobicContact CG1-CD1 4.3Å; V10-L19 HydrophobicContact CG1-CD2 4.46Å; V10-L19 HydrophobicContact CG2-CD1 4.17Å; V10-L19 HydrophobicContact CG2-CD2 4.18Å; K12-L19 WeakPolarHBondContact O-CA 3.4Å; M13-L19 HydrophobicContact SD-CB 3.75Å; M13-L19 HydrophobicContact SD-CD2 4.1Å; L19-A21 HydrophobicContact CD1-CB 3.77Å; L19-C31 HydrophobicContact CD1-CB 3.57Å; L19-C31 HydrophobicContact CG-CB 4.02Å; L19-C31 PolarHBondContact N-O 2.91Å; L19-C31 PolarHBondContact O-N 3.01Å; L19-I33 HydrophobicContact CD2-CD1 4.04Å; L19-I33 HydrophobicContact CD2-CG1 3.94Å; L19-I43 HydrophobicContact CD2-CG2 3.87Å; L19-I49 HydrophobicContact CD1-CD1 4Å; L19-V63 HydrophobicContact CD2-CG2 4.23Å
20	E	96.4	Very high	93.4	Very high	34 Å²	34	55.4 Å²	55.4	16%	0.159	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	129	168.7	-173.8	-179.8	167.9	0	0	108.3	I11 K12 L14	I11-E20 HydrophobicContact CD1-CG 4.32Å; I11-E20 PolarHBondContact N-O 2.83Å; K12-E20 WeakPolarHBondContact CD-OE2 3.47Å; K12-E20 WeakPolarHBondContact CE-OE2 3.46Å; K12-E20 HydrophobicContact CG-CB 3.77Å; K12-E20 PolarHBondContact N-O 3.06Å; K12-E20 IonicContact NZ-OE2 2.62Å; K12-E20 PolarHBondContact NZ-OE2 3.48Å; K12-E20 PolarHBondContact O-N 2.94Å; L14-E20 HydrophobicContact CD1-CB 4.47Å
21	A	96.1	Very high	93.5	Very high	0 Å²	0	55.4 Å²	55.4	0%	0	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.7	144.4	178.2	0	0	0	0	0	111.1	A8 Q9 L19 K28 R29 I49	A8-A21 HydrophobicContact CB-CB 3.8Å; Q9-A21 CarbonylContact O-C 3.49Å; Q9-A21 WeakPolarHBondContact O-CA 3.42Å; Q9-A21 WeakPolarHBondContact O-CB 3.19Å; L19-A21 HydrophobicContact CD1-CB 3.77Å; A21-K28 WeakPolarHBondContact O-CA 3.29Å; A21-R29 PolarHBondContact N-O 2.74Å; A21-R29 PolarHBondContact O-N 2.69Å; A21-I49 HydrophobicContact CB-CD1 4.09Å
22	M	94.9	Very high	93.5	Very high	64 Å²	64	55.3 Å²	55.3	32%	0.315	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.4	109	169.9	-173.1	71.1	-169.3	0	0	107.3	A8 Q9 I11 G26 K28	A8-M22 CarbonylContact C-O 3.53Å; A8-M22 VanDerWaalsContact CA-O 3.25Å; A8-M22 WeakPolarHBondContact CA-O 3.3Å; A8-M22 WeakPolarHBondContact CB-O 2.95Å; Q9-M22 PolarHBondContact N-O 2.86Å; Q9-M22 PolarHBondContact O-N 3.26Å; I11-M22 HydrophobicContact CD1-CB 3.67Å; I11-M22 HydrophobicContact CG1-CB 3.87Å; M22-G26 VanDerWaalsContact CE-C 3.43Å; M22-G26 WeakPolarHBondContact CE-O 3.48Å; M22-K28 HydrophobicContact SD-CD 4.26Å; M22-K28 HydrophobicContact SD-CG 3.4Å; M22-K28 WeakPolarHBondContact SD-CG 3.42Å
23	C	93.2	Very high	93.5	Very high	1 Å²	1	51.3 Å²	51.3	1%	0.007	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	148.3	173	-65.9	0	0	0	0	109.9	E6 Y7 A8 D25 G26 V27 R29	E6-C23 HydrophobicContact CG-CB 4.07Å; Y7-C23 WeakPolarHBondContact O-CA 3.25Å; A8-C23 HydrophobicContact CB-CB 4.36Å; C23-D25 WeakPolarHBondContact CB-OD1 3.25Å; C23-D25 PolarHBondContact O-N 3Å; C23-G26 PolarHBondContact O-N 3.24Å; C23-V27 VanDerWaalsContact CB-O 3.3Å; C23-V27 WeakPolarHBondContact CB-O 3.36Å; C23-V27 PolarHBondContact N-O 2.79Å; C23-R29 PolarHBondContact SG-NH1 2.95Å
24	F	90.4	Very high	93.3	Very high	52 Å²	52	53.7 Å²	53.7	23%	0.228	28%	0.28	C	S	.	.	T	Hydrogen-bonded Turn	trans	-73.9	-5.6	-178.2	-72.6	-74.1	0	0	0	113.7	Y7 Q9 G26 I48 L81 P82 A85	Y7-F24 VanDerWaalsContact C-CD2 3.46Å; Y7-F24 VanDerWaalsContact CB-CD2 3.48Å; Y7-F24 WeakPolarHBondContact O-CD2 3.35Å; Y7-F24 PolarHBondContact O-N 3.45Å; Q9-F24 HydrophobicContact CB-CZ 4.24Å; F24-G26 PolarHBondContact O-N 3.05Å; F24-I48 HydrophobicContact CE2-CD1 4.36Å; F24-I48 HydrophobicContact CZ-CD1 4.06Å; F24-L81 HydrophobicContact CD2-CD2 3.66Å; F24-L81 HydrophobicContact CE1-CD2 4.32Å; F24-L81 HydrophobicContact CE2-CD2 3.38Å; F24-L81 HydrophobicContact CG-CD2 4.25Å; F24-L81 HydrophobicContact CZ-CD2 3.74Å; F24-P82 HydrophobicContact CD1-CG 3.5Å; F24-P82 VanDerWaalsContact CD1-CG 3.5Å; F24-P82 HydrophobicContact CE1-CG 3.79Å; F24-A85 HydrophobicContact CE1-CB 3.98Å; F24-A85 HydrophobicContact CZ-CB 4.14Å
25	D	89	Confident	93.1	Very high	70 Å²	70	52.3 Å²	52.3	37%	0.374	29%	0.285	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.8	-2.8	164.9	68.5	-8.4	0	0	0	113.6	E6 C23 V27 R29	E6-D25 HydrophobicContact CG-CB 4.43Å; C23-D25 WeakPolarHBondContact CB-OD1 3.25Å; C23-D25 PolarHBondContact O-N 3Å; D25-V27 PolarHBondContact OD1-N 3.04Å; D25-R29 IonicContact OD1-CZ 3.93Å; D25-R29 IonicContact OD1-NH1 2.95Å; D25-R29 PolarHBondContact OD1-NH1 3.17Å; D25-R29 IonicContact OD2-CZ 3.15Å; D25-R29 IonicContact OD2-NH1 2.73Å; D25-R29 PolarHBondContact OD2-NH1 3.05Å; D25-R29 IonicContact OD2-NH2 2.69Å; D25-R29 PolarHBondContact OD2-NH2 2.81Å
26	G	88.8	Confident	92.9	Very high	50 Å²	50	58.2 Å²	58.2	52%	0.515	30%	0.299	S	S	.	.	S	Bend	trans	96.3	-0.9	177.7	0	0	0	0	0	114.8	M22 C23 F24	M22-G26 VanDerWaalsContact CE-C 3.43Å; M22-G26 WeakPolarHBondContact CE-O 3.48Å; C23-G26 PolarHBondContact O-N 3.24Å; F24-G26 PolarHBondContact O-N 3.05Å
27	V	91.9	Very high	92.7	Very high	46 Å²	46	53.5 Å²	53.5	28%	0.279	27%	0.273	S	S	.	.			trans	-101.8	135.6	-176	-179.1	0	0	0	0	111.3	C23 D25 R29	C23-V27 VanDerWaalsContact CB-O 3.3Å; C23-V27 WeakPolarHBondContact CB-O 3.36Å; C23-V27 PolarHBondContact N-O 2.79Å; D25-V27 PolarHBondContact OD1-N 3.04Å; V27-R29 HydrophobicContact CG1-CG 4Å
28	K	95.1	Very high	92.3	Very high	121 Å²	121	57.9 Å²	57.9	53%	0.526	29%	0.286	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.2	123.7	170.7	-67.1	-176.9	-176.8	-178.9	0	109.9	I11 A21 M22	I11-K28 HydrophobicContact CD1-CD 3.93Å; I11-K28 HydrophobicContact CD1-CG 4Å; A21-K28 WeakPolarHBondContact O-CA 3.29Å; M22-K28 HydrophobicContact SD-CD 4.26Å; M22-K28 HydrophobicContact SD-CG 3.4Å; M22-K28 WeakPolarHBondContact SD-CG 3.42Å
29	R	95.1	Very high	91.7	Very high	5 Å²	5	61.2 Å²	61.2	2%	0.019	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	147.1	-178.6	-62.5	-173.3	175.5	87.8	-0.8	111.6	A21 C23 D25 V27 C31 D58 A61	A21-R29 PolarHBondContact N-O 2.74Å; A21-R29 PolarHBondContact O-N 2.69Å; C23-R29 PolarHBondContact SG-NH1 2.95Å; D25-R29 IonicContact OD1-CZ 3.93Å; D25-R29 IonicContact OD1-NH1 2.95Å; D25-R29 PolarHBondContact OD1-NH1 3.17Å; D25-R29 IonicContact OD2-CZ 3.15Å; D25-R29 IonicContact OD2-NH1 2.73Å; D25-R29 PolarHBondContact OD2-NH1 3.05Å; D25-R29 IonicContact OD2-NH2 2.69Å; D25-R29 PolarHBondContact OD2-NH2 2.81Å; V27-R29 HydrophobicContact CG1-CG 4Å; R29-C31 PolarHBondContact O-N 3.22Å; R29-D58 WeakPolarHBondContact CD-O 3.4Å; R29-D58 WeakPolarHBondContact CG-O 3.47Å; R29-D58 IonicContact CZ-OD1 3.29Å; R29-D58 VanDerWaalsContact CZ-OD1 3.29Å; R29-D58 PolarHBondContact NE-O 2.96Å; R29-D58 IonicContact NE-OD1 3.05Å; R29-D58 PolarHBondContact NE-OD1 2.73Å; R29-D58 VanDerWaalsContact NH2-CG 3.34Å; R29-D58 IonicContact NH2-OD1 2.74Å; R29-D58 PolarHBondContact NH2-OD1 3.03Å; R29-D58 IonicContact NH2-OD2 3.22Å; R29-D58 PolarHBondContact NH2-OD2 3.06Å; R29-A61 HydrophobicContact CB-CB 4.44Å
30	L	95.8	Very high	91.1	Very high	89 Å²	89	68.7 Å²	68.7	47%	0.466	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83	111.6	168.6	-75.8	165.7	0	0	0	108.8	L14 N59 K60 A61	L14-L30 HydrophobicContact CD1-CD2 3.28Å; L30-N59 PolarHBondContact N-O 3.44Å; L30-K60 WeakPolarHBondContact O-CA 3.02Å; L30-A61 PolarHBondContact O-N 2.72Å
31	C	96.2	Very high	90.7	Very high	1 Å²	1	69.5 Å²	69.5	1%	0.007	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	138.3	-176.6	-53.1	0	0	0	0	111.4	R18 L19 R29 A61 V63	R18-C31 WeakPolarHBondContact CA-O 3.48Å; L19-C31 HydrophobicContact CD1-CB 3.57Å; L19-C31 HydrophobicContact CG-CB 4.02Å; L19-C31 PolarHBondContact N-O 2.91Å; L19-C31 PolarHBondContact O-N 3.01Å; R29-C31 PolarHBondContact O-N 3.22Å; C31-A61 CarbonylContact C-O 3.56Å; C31-A61 VanDerWaalsContact CA-O 3.25Å; C31-A61 WeakPolarHBondContact CA-O 3.36Å; C31-V63 HydrophobicContact CB-CG2 3.78Å
32	H	94.9	Very high	90.4	Very high	67 Å²	67	79.8 Å²	79.8	31%	0.31	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.9	125.7	172.7	-178.2	-103.1	0	0	0	110.8	R34 R38 A61 D62 V63	H32-R34 PolarHBondContact O-N 3.46Å; H32-R38 PolarHBondContact NE2-NH2 3.5Å; H32-A61 PolarHBondContact N-O 2.8Å; H32-D62 IonicContact ND1-OD1 3.81Å; H32-D62 WeakPolarHBondContact O-CA 3.4Å; H32-V63 PolarHBondContact O-N 2.99Å
33	I	94.4	Very high	90.1	Very high	12 Å²	12	77.3 Å²	77.3	6%	0.062	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.2	115.6	-179.5	-52.8	172.9	0	0	0	108.7	M13 G17 L19 G35 L37 R38 I43 V63	M13-I33 HydrophobicContact CE-CD1 4.22Å; G17-I33 WeakPolarHBondContact O-CB 3.37Å; G17-I33 WeakPolarHBondContact O-CG1 3.41Å; G17-I33 PolarHBondContact O-N 3.37Å; L19-I33 HydrophobicContact CD2-CD1 4.04Å; L19-I33 HydrophobicContact CD2-CG1 3.94Å; I33-G35 PolarHBondContact O-N 3Å; I33-L37 HydrophobicContact CG2-CB 3.96Å; I33-R38 HydrophobicContact CB-CG 4.17Å; I33-R38 HydrophobicContact CG2-CG 3.75Å; I33-R38 PolarHBondContact O-NE 3Å; I33-I43 HydrophobicContact CD1-CD1 4.24Å; I33-I43 HydrophobicContact CG1-CD1 4.3Å; I33-I43 HydrophobicContact CG2-CD1 4.12Å; I33-V63 HydrophobicContact CG1-CG2 4.24Å
34	R	90.1	Very high	90	Very high	133 Å²	133	80.8 Å²	80.8	50%	0.502	39%	0.389	S	S	.	.			trans	-55.6	139	176.6	-74.2	177.2	75.1	157.3	2.6	110.2	H32 K36 L37 R38 D62 V63	H32-R34 PolarHBondContact O-N 3.46Å; R34-K36 PolarHBondContact O-N 2.84Å; R34-L37 HydrophobicContact CB-CD1 4.44Å; R34-L37 PolarHBondContact O-N 2.75Å; R34-R38 PolarHBondContact O-N 3.47Å; R34-D62 HydrophobicContact CG-CB 4.45Å; R34-V63 WeakPolarHBondContact CB-O 3.41Å; R34-V63 WeakPolarHBondContact CD-O 3.37Å; R34-V63 WeakPolarHBondContact CG-O 3.42Å
35	G	88.9	Confident	90.1	Very high	50 Å²	50	81.6 Å²	81.6	52%	0.515	40%	0.398	S	S	.	.	H	α-helix	trans	-54.9	-31.8	-176.2	0	0	0	0	0	114.3	I33 L37 R38	I33-G35 PolarHBondContact O-N 3Å; G35-L37 VanDerWaalsContact C-N 3.3Å; G35-L37 PolarHBondContact O-N 3.1Å; G35-R38 PolarHBondContact O-N 2.96Å
36	K	88.1	Confident	90.2	Very high	165 Å²	165	80.7 Å²	80.7	72%	0.717	40%	0.397	S	S	*	.	H	α-helix	trans	-60.8	-36.1	175.6	-171.7	176.8	-180	-179.1	0	112.8	R34	R34-K36 PolarHBondContact O-N 2.84Å
37	L	86.1	Confident	90.4	Very high	19 Å²	19	78.8 Å²	78.8	10%	0.099	38%	0.375	C	S	.	.	H	α-helix	trans	-79.6	-36.4	-179.4	-86.1	72.7	0	0	0	111.6	I33 R34 G35 K39 K40 V41 I43 V63 I64	I33-L37 HydrophobicContact CG2-CB 3.96Å; R34-L37 HydrophobicContact CB-CD1 4.44Å; R34-L37 PolarHBondContact O-N 2.75Å; G35-L37 VanDerWaalsContact C-N 3.3Å; G35-L37 PolarHBondContact O-N 3.1Å; L37-K39 PolarHBondContact O-N 3.42Å; L37-K40 PolarHBondContact O-N 2.96Å; L37-V41 PolarHBondContact O-N 2.8Å; L37-I43 HydrophobicContact CD2-CD1 4.46Å; L37-V63 HydrophobicContact CD2-CG1 3.97Å; L37-I64 WeakPolarHBondContact CD1-O 3.16Å
38	R	83.4	Confident	90.4	Very high	107 Å²	107	76.8 Å²	76.8	40%	0.404	36%	0.362	S	S	.	.	H	α-helix	trans	-54	-26.7	-177	-70.6	-176.6	174.3	-128.7	11.4	114.9	N16 G17 H32 I33 R34 G35	N16-R38 VanDerWaalsContact C-NH2 3.34Å; N16-R38 PolarHBondContact O-NH2 2.99Å; G17-R38 PolarHBondContact O-NH2 2.78Å; H32-R38 PolarHBondContact NE2-NH2 3.5Å; I33-R38 HydrophobicContact CB-CG 4.17Å; I33-R38 HydrophobicContact CG2-CG 3.75Å; I33-R38 PolarHBondContact O-NE 3Å; R34-R38 PolarHBondContact O-N 3.47Å; G35-R38 PolarHBondContact O-N 2.96Å
39	K	80.7	Confident	90.3	Very high	199 Å²	199	71 Å²	71	87%	0.865	34%	0.337	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.5	-17.6	179.9	-67.6	-170.2	175	-171.5	0	114.1	L37	L37-K39 PolarHBondContact O-N 3.42Å
40	K	84.8	Confident	90.3	Very high	158 Å²	158	71.4 Å²	71.4	69%	0.687	34%	0.34	S	S	*	.	T	Hydrogen-bonded Turn	trans	-118.5	-26.3	-168.2	-68.1	-164.2	172.7	-150.9	0	113.8	L37	L37-K40 PolarHBondContact O-N 2.96Å
41	V	87.4	Confident	90.2	Very high	50 Å²	50	67.1 Å²	67.1	30%	0.303	32%	0.317	S	S	.	.			trans	-134.6	123.6	-167.5	-177.7	0	0	0	0	109.2	L37 I43 K66	L37-V41 PolarHBondContact O-N 2.8Å; V41-I43 HydrophobicContact CG1-CG1 4.29Å; V41-K66 HydrophobicContact CG1-CB 3.72Å; V41-K66 HydrophobicContact CG1-CD 3.38Å; V41-K66 HydrophobicContact CG1-CG 4.18Å
42	W	88.3	Confident	90.2	Very high	217 Å²	217	67.6 Å²	67.6	82%	0.822	32%	0.322	S	S	*	.			trans	-87.1	127.1	170.3	-70.7	76.9	0	0	0	109.2	K66	W42-K66 WeakPolarHBondContact O-CD 3.27Å; W42-K66 PolarHBondContact O-NZ 2.84Å
43	I	90.5	Very high	90	Very high	11 Å²	11	66 Å²	66	6%	0.056	32%	0.316	C	S	.	.			trans	-113.3	125	179.8	-59.1	174.2	0	0	0	107.5	V10 M13 L19 I33 L37 V41 I49 V63	V10-I43 HydrophobicContact CG2-CG2 3.76Å; M13-I43 VanDerWaalsContact CE-O 3.27Å; M13-I43 WeakPolarHBondContact CE-O 3.47Å; L19-I43 HydrophobicContact CD2-CG2 3.87Å; I33-I43 HydrophobicContact CD1-CD1 4.24Å; I33-I43 HydrophobicContact CG1-CD1 4.3Å; I33-I43 HydrophobicContact CG2-CD1 4.12Å; L37-I43 HydrophobicContact CD2-CD1 4.46Å; V41-I43 HydrophobicContact CG1-CG1 4.29Å; I43-I49 HydrophobicContact CG2-CG2 4.3Å; I43-V63 HydrophobicContact CD1-CG1 3.99Å
44	N	90.6	Very high	89.8	Confident	75 Å²	75	68.2 Å²	68.2	40%	0.401	32%	0.323	S	S	.	.			trans	-113.7	172.7	179.2	-69.7	-50.4	0	0	0	111.3	V10 D47	V10-N44 WeakPolarHBondContact CB-O 3.43Å; V10-N44 WeakPolarHBondContact CG1-O 3.49Å; N44-D47 PolarHBondContact N-OD2 2.95Å; N44-D47 WeakPolarHBondContact O-CB 3.38Å; N44-D47 PolarHBondContact O-N 3.29Å
45	T	91.9	Very high	89.6	Confident	68 Å²	68	68.7 Å²	68.7	42%	0.417	34%	0.336	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.1	143.9	171.8	49.8	0	0	0	0	111	M13 D47 N88	M13-T45 HydrophobicContact CG-CG2 4.43Å; T45-D47 PolarHBondContact O-N 2.84Å; T45-N88 PolarHBondContact O-ND2 2.87Å
46	S	91.2	Very high	89.3	Confident	51 Å²	51	74.2 Å²	74.2	36%	0.357	34%	0.342	S	S	.	.	T	Hydrogen-bonded Turn	trans	72.2	-0.2	-176.3	-54.1	0	0	0	0	116.4	Q9 V10	Q9-S46 PolarHBondContact NE2-O 3.46Å; V10-S46 WeakPolarHBondContact O-CA 3.44Å; V10-S46 PolarHBondContact O-N 2.71Å
47	D	92.1	Very high	89.3	Confident	10 Å²	10	70 Å²	70	5%	0.053	33%	0.325	C	S	.	.			trans	-66.3	148.9	172.5	-70	-2.7	0	0	0	111.7	Q9 V10 N44 T45 K66	Q9-D47 WeakPolarHBondContact CA-O 3.43Å; V10-D47 HydrophobicContact CG2-CB 4.35Å; V10-D47 PolarHBondContact N-O 3.21Å; N44-D47 PolarHBondContact N-OD2 2.95Å; N44-D47 WeakPolarHBondContact O-CB 3.38Å; N44-D47 PolarHBondContact O-N 3.29Å; T45-D47 PolarHBondContact O-N 2.84Å; D47-K66 WeakPolarHBondContact OD2-CE 3.21Å; D47-K66 IonicContact OD2-NZ 3.67Å
48	I	92.9	Very high	89.4	Confident	4 Å²	4	72.8 Å²	72.8	2%	0.021	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	128.6	173.6	-54.6	-55	0	0	0	109.1	Q9 F24 Y67 A72 L81	Q9-I48 HydrophobicContact CB-CD1 3.97Å; Q9-I48 HydrophobicContact CG-CD1 4.12Å; F24-I48 HydrophobicContact CE2-CD1 4.36Å; F24-I48 HydrophobicContact CZ-CD1 4.06Å; I48-Y67 HydrophobicContact CG2-CD2 4.09Å; I48-Y67 PolarHBondContact O-N 2.87Å; I48-A72 HydrophobicContact CB-CB 4.21Å; I48-A72 HydrophobicContact CG1-CB 3.87Å; I48-L81 HydrophobicContact CG2-CD1 4.27Å
49	I	93.8	Very high	89.8	Confident	0 Å²	0	73.3 Å²	73.3	0%	0	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.1	153.3	-175.8	59.7	167.1	0	0	0	111.2	A8 V10 L19 A21 I43 V51 V63 L65 K66	A8-I49 HydrophobicContact CB-CG1 4.09Å; A8-I49 PolarHBondContact N-O 3.21Å; A8-I49 WeakPolarHBondContact O-CG1 3.3Å; A8-I49 PolarHBondContact O-N 3.31Å; V10-I49 HydrophobicContact CG2-CD1 3.92Å; V10-I49 HydrophobicContact CG2-CG1 4.21Å; V10-I49 HydrophobicContact CG2-CG2 4.03Å; L19-I49 HydrophobicContact CD1-CD1 4Å; A21-I49 HydrophobicContact CB-CD1 4.09Å; I43-I49 HydrophobicContact CG2-CG2 4.3Å; I49-V51 HydrophobicContact CD1-CG1 3.7Å; I49-V51 HydrophobicContact CG1-CG1 4.1Å; I49-V63 HydrophobicContact CB-CG1 4.25Å; I49-V63 HydrophobicContact CD1-CG1 4.24Å; I49-V63 HydrophobicContact CD1-CG2 4.02Å; I49-V63 HydrophobicContact CG2-CG1 4.44Å; I49-L65 CarbonylContact C-O 3.57Å; I49-L65 WeakPolarHBondContact CA-O 3.44Å; I49-K66 HydrophobicContact CG2-CB 4.43Å
50	L	94.1	Very high	90.4	Very high	13 Å²	13	68 Å²	68	7%	0.068	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	122.9	167.2	-170.5	64.6	0	0	0	109	M1 K5 Y7 I64 L65 Y67	M1-L50 HydrophobicContact CE-CD1 3.98Å; K5-L50 HydrophobicContact CB-CD1 4.13Å; K5-L50 HydrophobicContact CD-CD2 3.95Å; K5-L50 HydrophobicContact CD-CG 4.38Å; Y7-L50 HydrophobicContact CD1-CD1 3.91Å; Y7-L50 HydrophobicContact CE1-CD1 3.91Å; L50-I64 HydrophobicContact CB-CB 4.48Å; L50-I64 HydrophobicContact CD2-CB 4.41Å; L50-I64 HydrophobicContact CD2-CG2 4.3Å; L50-I64 HydrophobicContact CG-CB 4.43Å; L50-I64 PolarHBondContact O-N 3.33Å; L50-L65 HydrophobicContact CB-CB 4.08Å; L50-L65 PolarHBondContact N-O 3.34Å; L50-L65 PolarHBondContact O-N 3.27Å; L50-Y67 HydrophobicContact CB-CE2 3.87Å
51	V	94.7	Very high	90.9	Very high	0 Å²	0	60.4 Å²	60.4	0%	0	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.4	144.3	176	-61.5	0	0	0	0	111	K5 E6 A8 I49 A61 D62	K5-V51 CarbonylContact C-O 3.6Å; K5-V51 WeakPolarHBondContact CA-O 3.43Å; E6-V51 HydrophobicContact CB-CG2 4.1Å; E6-V51 PolarHBondContact N-O 3.29Å; E6-V51 WeakPolarHBondContact O-CG2 3.36Å; E6-V51 PolarHBondContact O-N 2.93Å; A8-V51 HydrophobicContact CB-CG1 4.06Å; A8-V51 HydrophobicContact CB-CG2 4.17Å; I49-V51 HydrophobicContact CD1-CG1 3.7Å; I49-V51 HydrophobicContact CG1-CG1 4.1Å; V51-A61 HydrophobicContact CB-CB 3.9Å; V51-A61 HydrophobicContact CG2-CB 4.22Å; V51-D62 CarbonylContact C-O 3.55Å; V51-D62 WeakPolarHBondContact CA-O 3.44Å
52	G	94.4	Very high	91.2	Very high	10 Å²	10	59.9 Å²	59.9	10%	0.103	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.7	122.7	167.9	0	0	0	0	0	109.6	N4 A61 D62	N4-G52 WeakPolarHBondContact O-CA 3.36Å; G52-A61 CarbonylContact O-C 3.58Å; G52-A61 VanDerWaalsContact O-CA 3.29Å; G52-A61 WeakPolarHBondContact O-CA 3.19Å; G52-A61 WeakPolarHBondContact O-CB 3.2Å; G52-D62 PolarHBondContact N-O 3.23Å; G52-D62 PolarHBondContact O-N 2.76Å
53	L	92.4	Very high	91.5	Very high	33 Å²	33	49.6 Å²	49.6	17%	0.173	25%	0.251	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	160.5	176.5	-58.8	179.2	0	0	0	110.4	N4 E6 A61	N4-L53 PolarHBondContact ND2-O 3.38Å; N4-L53 VanDerWaalsContact ND2-O 3.17Å; N4-L53 PolarHBondContact O-N 2.77Å; N4-L53 WeakPolarHBondContact OD1-CB 3.5Å; E6-L53 HydrophobicContact CB-CD1 4.22Å; E6-L53 HydrophobicContact CB-CD2 4.28Å; E6-L53 HydrophobicContact CB-CG 4.28Å; L53-A61 HydrophobicContact CD2-CB 4.48Å
54	R	89.6	Confident	91.6	Very high	60 Å²	60	51 Å²	51	23%	0.226	26%	0.258	C	S	.	.			trans	-117.8	127.6	176.9	-64.9	177.9	178.1	-169.7	4	109.1	Y56 Q57 D62	R54-Y56 HydrophobicContact CB-CD1 4.4Å; R54-Y56 HydrophobicContact CB-CE1 4.1Å; R54-Y56 PolarHBondContact O-N 2.83Å; R54-Q57 PolarHBondContact O-N 2.98Å; R54-D62 IonicContact CZ-OD2 3.24Å; R54-D62 VanDerWaalsContact CZ-OD2 3.24Å; R54-D62 IonicContact NE-OD2 2.81Å; R54-D62 PolarHBondContact NE-OD2 2.87Å; R54-D62 VanDerWaalsContact NH2-CG 3.29Å; R54-D62 IonicContact NH2-OD1 2.76Å; R54-D62 PolarHBondContact NH2-OD1 2.99Å; R54-D62 IonicContact NH2-OD2 3.6Å; R54-D62 PolarHBondContact NH2-OD2 2.87Å
55	D	85.4	Confident	91.7	Very high	143 Å²	143	51.2 Å²	51.2	77%	0.765	26%	0.259	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.1	-25.8	-175.4	-51.1	-23.6	0	0	0	113.7	N4	N4-D55 PolarHBondContact ND2-OD1 2.94Å; N4-D55 PolarHBondContact OD1-OD1 3.05Å
56	Y	83.4	Confident	91.7	Very high	166 Å²	166	48.9 Å²	48.9	65%	0.651	24%	0.243	S	C	*	.	T	Hydrogen-bonded Turn	trans	-106.2	-12.4	-173	61.3	-89.1	0	0	0	114.3	R54	R54-Y56 HydrophobicContact CB-CD1 4.4Å; R54-Y56 HydrophobicContact CB-CE1 4.1Å; R54-Y56 PolarHBondContact O-N 2.83Å
57	Q	87.6	Confident	91.7	Very high	75 Å²	75	48 Å²	48	35%	0.35	23%	0.233	S	C	.	.			trans	-147.5	82.7	-175.9	-88	176.8	27.7	0	0	109.9	R54 N59 K60	R54-Q57 PolarHBondContact O-N 2.98Å; Q57-N59 PolarHBondContact O-N 2.9Å; Q57-K60 PolarHBondContact O-N 3.36Å; Q57-K60 VanDerWaalsContact O-O 3.04Å
58	D	88.6	Confident	91.6	Very high	79 Å²	79	50.5 Å²	50.5	42%	0.422	25%	0.246	S	C	.	.	T	Hydrogen-bonded Turn	trans	-62.6	-27.4	-178.3	-169.2	36	0	0	0	113.2	R29 K60	R29-D58 WeakPolarHBondContact CD-O 3.4Å; R29-D58 WeakPolarHBondContact CG-O 3.47Å; R29-D58 IonicContact CZ-OD1 3.29Å; R29-D58 VanDerWaalsContact CZ-OD1 3.29Å; R29-D58 PolarHBondContact NE-O 2.96Å; R29-D58 IonicContact NE-OD1 3.05Å; R29-D58 PolarHBondContact NE-OD1 2.73Å; R29-D58 VanDerWaalsContact NH2-CG 3.34Å; R29-D58 IonicContact NH2-OD1 2.74Å; R29-D58 PolarHBondContact NH2-OD1 3.03Å; R29-D58 IonicContact NH2-OD2 3.22Å; R29-D58 PolarHBondContact NH2-OD2 3.06Å; D58-K60 PolarHBondContact O-N 3.17Å
59	N	91.6	Very high	91.3	Very high	117 Å²	117	50.9 Å²	50.9	63%	0.626	25%	0.25	S	C	*	.	T	Hydrogen-bonded Turn	trans	-66.6	-7.9	175.5	-66.4	-46.2	0	0	0	114.2	L30 Q57	L30-N59 PolarHBondContact N-O 3.44Å; Q57-N59 PolarHBondContact O-N 2.9Å
60	K	93.5	Very high	91	Very high	87 Å²	87	55.8 Å²	55.8	38%	0.378	28%	0.276	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	141.5	-178.1	-63.3	-172	-167	154.9	0	111.5	L30 Q57 D58	L30-K60 WeakPolarHBondContact O-CA 3.02Å; Q57-K60 PolarHBondContact O-N 3.36Å; Q57-K60 VanDerWaalsContact O-O 3.04Å; D58-K60 PolarHBondContact O-N 3.17Å
61	A	95.3	Very high	90.8	Very high	0 Å²	0	59.5 Å²	59.5	0%	0	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.2	167.2	176.8	0	0	0	0	0	111	R29 L30 C31 H32 V51 G52 L53	R29-A61 HydrophobicContact CB-CB 4.44Å; L30-A61 PolarHBondContact O-N 2.72Å; C31-A61 CarbonylContact C-O 3.56Å; C31-A61 VanDerWaalsContact CA-O 3.25Å; C31-A61 WeakPolarHBondContact CA-O 3.36Å; H32-A61 PolarHBondContact N-O 2.8Å; V51-A61 HydrophobicContact CB-CB 3.9Å; V51-A61 HydrophobicContact CG2-CB 4.22Å; G52-A61 CarbonylContact O-C 3.58Å; G52-A61 VanDerWaalsContact O-CA 3.29Å; G52-A61 WeakPolarHBondContact O-CA 3.19Å; G52-A61 WeakPolarHBondContact O-CB 3.2Å; L53-A61 HydrophobicContact CD2-CB 4.48Å
62	D	94.2	Very high	90.5	Very high	39 Å²	39	59.6 Å²	59.6	21%	0.209	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	132.2	175.2	-67.7	-80.5	0	0	0	110.1	H32 R34 V51 G52 R54 I64	H32-D62 IonicContact ND1-OD1 3.81Å; H32-D62 WeakPolarHBondContact O-CA 3.4Å; R34-D62 HydrophobicContact CG-CB 4.45Å; V51-D62 CarbonylContact C-O 3.55Å; V51-D62 WeakPolarHBondContact CA-O 3.44Å; G52-D62 PolarHBondContact N-O 3.23Å; G52-D62 PolarHBondContact O-N 2.76Å; R54-D62 IonicContact CZ-OD2 3.24Å; R54-D62 VanDerWaalsContact CZ-OD2 3.24Å; R54-D62 IonicContact NE-OD2 2.81Å; R54-D62 PolarHBondContact NE-OD2 2.87Å; R54-D62 VanDerWaalsContact NH2-CG 3.29Å; R54-D62 IonicContact NH2-OD1 2.76Å; R54-D62 PolarHBondContact NH2-OD1 2.99Å; R54-D62 IonicContact NH2-OD2 3.6Å; R54-D62 PolarHBondContact NH2-OD2 2.87Å; D62-I64 PolarHBondContact O-N 2.81Å
63	V	94.3	Very high	90.1	Very high	0 Å²	0	64.1 Å²	64.1	0%	0	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.5	124	179.4	-172.2	0	0	0	0	109.6	L19 C31 H32 I33 R34 L37 I43 I49	L19-V63 HydrophobicContact CD2-CG2 4.23Å; C31-V63 HydrophobicContact CB-CG2 3.78Å; H32-V63 PolarHBondContact O-N 2.99Å; I33-V63 HydrophobicContact CG1-CG2 4.24Å; R34-V63 WeakPolarHBondContact CB-O 3.41Å; R34-V63 WeakPolarHBondContact CD-O 3.37Å; R34-V63 WeakPolarHBondContact CG-O 3.42Å; L37-V63 HydrophobicContact CD2-CG1 3.97Å; I43-V63 HydrophobicContact CD1-CG1 3.99Å; I49-V63 HydrophobicContact CB-CG1 4.25Å; I49-V63 HydrophobicContact CD1-CG1 4.24Å; I49-V63 HydrophobicContact CD1-CG2 4.02Å; I49-V63 HydrophobicContact CG2-CG1 4.44Å
64	I	93.1	Very high	90	Very high	40 Å²	40	65.4 Å²	65.4	21%	0.205	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	-45.4	-178.3	-60	176	0	0	0	111.1	K5 L37 L50 D62	K5-I64 HydrophobicContact CD-CD1 3.75Å; K5-I64 HydrophobicContact CG-CD1 3.86Å; L37-I64 WeakPolarHBondContact CD1-O 3.16Å; L50-I64 HydrophobicContact CB-CB 4.48Å; L50-I64 HydrophobicContact CD2-CB 4.41Å; L50-I64 HydrophobicContact CD2-CG2 4.3Å; L50-I64 HydrophobicContact CG-CB 4.43Å; L50-I64 PolarHBondContact O-N 3.33Å; D62-I64 PolarHBondContact O-N 2.81Å
65	L	91.9	Very high	89.9	Confident	80 Å²	80	63.4 Å²	63.4	42%	0.419	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.8	150.5	-173.6	-174.9	64.7	0	0	0	109.8	I49 L50 Y67	I49-L65 CarbonylContact C-O 3.57Å; I49-L65 WeakPolarHBondContact CA-O 3.44Å; L50-L65 HydrophobicContact CB-CB 4.08Å; L50-L65 PolarHBondContact N-O 3.34Å; L50-L65 PolarHBondContact O-N 3.27Å; L65-Y67 HydrophobicContact CD2-CE1 4.09Å
66	K	91.9	Very high	89.9	Confident	19 Å²	19	60.6 Å²	60.6	8%	0.083	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.6	136.3	165.5	176.3	-162.5	170.9	-174.3	0	107.6	V41 W42 D47 I49 D91	V41-K66 HydrophobicContact CG1-CB 3.72Å; V41-K66 HydrophobicContact CG1-CD 3.38Å; V41-K66 HydrophobicContact CG1-CG 4.18Å; W42-K66 WeakPolarHBondContact O-CD 3.27Å; W42-K66 PolarHBondContact O-NZ 2.84Å; D47-K66 WeakPolarHBondContact OD2-CE 3.21Å; D47-K66 IonicContact OD2-NZ 3.67Å; I49-K66 HydrophobicContact CG2-CB 4.43Å; K66-D91 WeakPolarHBondContact CE-OD2 3.36Å; K66-D91 IonicContact NZ-OD1 2.62Å; K66-D91 PolarHBondContact NZ-OD1 2.87Å; K66-D91 IonicContact NZ-OD2 3.01Å; K66-D91 PolarHBondContact NZ-OD2 2.95Å
67	Y	91.1	Very high	90	Very high	34 Å²	34	57 Å²	57	13%	0.133	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.6	140	170.4	-68.4	-78.3	0	0	0	110.2	Y7 I48 L50 L65 E71 L75	Y7-Y67 AromaticContact CD1-CE2 3.8Å; Y7-Y67 HydrophobicContact CD1-CE2 3.8Å; Y7-Y67 AromaticContact CE1-CE2 3.66Å; Y7-Y67 HydrophobicContact CE1-CE2 3.66Å; Y7-Y67 AromaticContact CE1-CZ 3.78Å; Y7-Y67 WeakPolarHBondContact CE1-OH 2.84Å; I48-Y67 HydrophobicContact CG2-CD2 4.09Å; I48-Y67 PolarHBondContact O-N 2.87Å; L50-Y67 HydrophobicContact CB-CE2 3.87Å; L65-Y67 HydrophobicContact CD2-CE1 4.09Å; Y67-E71 WeakPolarHBondContact CA-OE2 3.42Å; Y67-E71 HydrophobicContact CD1-CB 3.95Å; Y67-L75 HydrophobicContact CD1-CD1 3.88Å; Y67-L75 HydrophobicContact CD2-CD1 4.02Å; Y67-L75 HydrophobicContact CE1-CD1 3.95Å; Y67-L75 HydrophobicContact CE2-CD1 4.08Å; Y67-L75 HydrophobicContact CG-CD1 3.91Å
68	N	89.6	Confident	90	Very high	62 Å²	62	62.2 Å²	62.2	33%	0.332	32%	0.316	S	S	.	.			trans	-73	166.3	169.7	-72.8	-1.3	0	0	0	110.8	D70 E71 A72	N68-D70 VanDerWaalsContact C-N 3.27Å; N68-D70 PolarHBondContact O-N 3.06Å; N68-E71 HydrophobicContact CB-CG 4.4Å; N68-E71 PolarHBondContact N-OE2 3.07Å; N68-E71 PolarHBondContact O-N 3.49Å; N68-A72 WeakPolarHBondContact O-CB 3.49Å; N68-A72 PolarHBondContact O-N 3.25Å
69	A	87.1	Confident	89.7	Confident	12 Å²	12	61.4 Å²	61.4	10%	0.099	33%	0.326	C	S	.	.	H	α-helix	trans	-55.7	-42.5	178.6	0	0	0	0	0	112.2	A72 R73 I87 N88	A69-A72 PolarHBondContact O-N 3.28Å; A69-R73 WeakPolarHBondContact O-CG 3.41Å; A69-R73 PolarHBondContact O-N 3.38Å; A69-I87 HydrophobicContact CB-CG2 4.06Å; A69-N88 WeakPolarHBondContact CB-O 3.44Å
70	D	87.3	Confident	89.4	Confident	103 Å²	103	60.5 Å²	60.5	55%	0.551	32%	0.318	S	S	*	.	H	α-helix	trans	-65.7	-46	179.1	-62.9	-30.8	0	0	0	112	N68 A72 R73 S74	N68-D70 VanDerWaalsContact C-N 3.27Å; N68-D70 PolarHBondContact O-N 3.06Å; D70-A72 VanDerWaalsContact C-N 3.29Å; D70-A72 PolarHBondContact O-N 3.36Å; D70-R73 WeakPolarHBondContact O-CB 3.19Å; D70-R73 PolarHBondContact O-N 3.44Å; D70-R73 VanDerWaalsContact O-N 3.09Å; D70-R73 IonicContact OD1-CZ 2.83Å; D70-R73 IonicContact OD1-NH1 3.88Å; D70-R73 PolarHBondContact OD1-NH1 3.48Å; D70-R73 IonicContact OD1-NH2 2.98Å; D70-S74 PolarHBondContact O-N 3.42Å; D70-S74 PolarHBondContact O-OG 2.83Å
71	E	89.6	Confident	88.8	Confident	91 Å²	91	56.6 Å²	56.6	43%	0.425	30%	0.302	S	S	.	.	H	α-helix	trans	-62.4	-38.6	176.9	-61.7	178.6	130.8	0	0	111.3	Y67 N68 R73 S74 L75	Y67-E71 WeakPolarHBondContact CA-OE2 3.42Å; Y67-E71 HydrophobicContact CD1-CB 3.95Å; N68-E71 HydrophobicContact CB-CG 4.4Å; N68-E71 PolarHBondContact N-OE2 3.07Å; N68-E71 PolarHBondContact O-N 3.49Å; E71-R73 VanDerWaalsContact C-N 3.33Å; E71-R73 PolarHBondContact O-N 2.91Å; E71-S74 WeakPolarHBondContact O-CB 3.17Å; E71-S74 PolarHBondContact O-N 3.43Å; E71-L75 WeakPolarHBondContact O-CG 3.37Å; E71-L75 PolarHBondContact O-N 3.28Å
72	A	88.3	Confident	88	Confident	1 Å²	1	58.6 Å²	58.6	1%	0.008	32%	0.315	C	S	.	.	H	α-helix	trans	-63.6	-37.1	174.4	0	0	0	0	0	112.1	I48 N68 A69 D70 L75 K76 I87	I48-A72 HydrophobicContact CB-CB 4.21Å; I48-A72 HydrophobicContact CG1-CB 3.87Å; N68-A72 WeakPolarHBondContact O-CB 3.49Å; N68-A72 PolarHBondContact O-N 3.25Å; A69-A72 PolarHBondContact O-N 3.28Å; D70-A72 VanDerWaalsContact C-N 3.29Å; D70-A72 PolarHBondContact O-N 3.36Å; A72-L75 PolarHBondContact O-N 3.4Å; A72-K76 PolarHBondContact O-N 3.01Å; A72-I87 HydrophobicContact CB-CD1 3.88Å; A72-I87 HydrophobicContact CB-CG1 4.02Å; A72-I87 HydrophobicContact CB-CG2 3.89Å
73	R	86.6	Confident	87	Confident	106 Å²	106	65.1 Å²	65.1	40%	0.4	34%	0.344	S	S	.	.	H	α-helix	trans	-66.3	-40.4	173.2	-69.5	-172.3	-149.9	115.6	2.9	111.2	A69 D70 E71 K76 A77 I87 E89	A69-R73 WeakPolarHBondContact O-CG 3.41Å; A69-R73 PolarHBondContact O-N 3.38Å; D70-R73 WeakPolarHBondContact O-CB 3.19Å; D70-R73 PolarHBondContact O-N 3.44Å; D70-R73 VanDerWaalsContact O-N 3.09Å; D70-R73 IonicContact OD1-CZ 2.83Å; D70-R73 IonicContact OD1-NH1 3.88Å; D70-R73 PolarHBondContact OD1-NH1 3.48Å; D70-R73 IonicContact OD1-NH2 2.98Å; E71-R73 VanDerWaalsContact C-N 3.33Å; E71-R73 PolarHBondContact O-N 2.91Å; R73-K76 WeakPolarHBondContact O-CB 3.45Å; R73-K76 PolarHBondContact O-N 2.62Å; R73-A77 PolarHBondContact O-N 3.06Å; R73-I87 HydrophobicContact CB-CD1 4.39Å; R73-I87 HydrophobicContact CG-CD1 3.79Å; R73-E89 IonicContact CZ-OE1 3.57Å; R73-E89 IonicContact NE-OE1 2.63Å; R73-E89 IonicContact NH2-OE1 3.93Å; R73-E89 PolarHBondContact NH2-OE1 2.94Å
74	S	88.9	Confident	86	Confident	60 Å²	60	72.2 Å²	72.2	42%	0.42	38%	0.377	S	S	.	.	H	α-helix	trans	-60.5	-46.1	173.4	-58.6	0	0	0	0	111.2	D70 E71 K76 A77 Y78	D70-S74 PolarHBondContact O-N 3.42Å; D70-S74 PolarHBondContact O-OG 2.83Å; E71-S74 WeakPolarHBondContact O-CB 3.17Å; E71-S74 PolarHBondContact O-N 3.43Å; S74-K76 VanDerWaalsContact C-N 3.27Å; S74-K76 PolarHBondContact O-N 3.3Å; S74-A77 CarbonylContact O-C 3.58Å; S74-A77 WeakPolarHBondContact O-CA 3.49Å; S74-A77 WeakPolarHBondContact O-CB 2.99Å; S74-A77 PolarHBondContact O-N 2.81Å; S74-Y78 WeakPolarHBondContact O-CD2 3.46Å; S74-Y78 PolarHBondContact O-N 3.22Å
75	L	87.6	Confident	85.2	Confident	18 Å²	18	70.7 Å²	70.7	9%	0.094	37%	0.37	C	S	.	.	H	α-helix	trans	-59	-38.3	176.2	-72.8	171.4	0	0	0	112.5	Y7 Y67 E71 A72 Y78 G79 E80 L81	Y7-L75 HydrophobicContact CD1-CD1 4.44Å; Y7-L75 HydrophobicContact CE1-CD1 4.05Å; Y7-L75 HydrophobicContact CE1-CD2 4.21Å; Y67-L75 HydrophobicContact CD1-CD1 3.88Å; Y67-L75 HydrophobicContact CD2-CD1 4.02Å; Y67-L75 HydrophobicContact CE1-CD1 3.95Å; Y67-L75 HydrophobicContact CE2-CD1 4.08Å; Y67-L75 HydrophobicContact CG-CD1 3.91Å; E71-L75 WeakPolarHBondContact O-CG 3.37Å; E71-L75 PolarHBondContact O-N 3.28Å; A72-L75 PolarHBondContact O-N 3.4Å; L75-Y78 PolarHBondContact O-N 2.76Å; L75-G79 PolarHBondContact O-N 3.01Å; L75-E80 HydrophobicContact CD2-CB 4.22Å; L75-E80 HydrophobicContact CD2-CG 4.41Å; L75-E80 PolarHBondContact O-N 2.63Å; L75-E80 VanDerWaalsContact O-N 3.07Å; L75-L81 HydrophobicContact CB-CD1 3.67Å; L75-L81 HydrophobicContact CB-CG 3.87Å; L75-L81 HydrophobicContact CD1-CD1 4.32Å
76	K	86.7	Confident	84.5	Confident	84 Å²	84	75 Å²	75	37%	0.365	39%	0.385	S	S	.	.	H	α-helix	trans	-63.3	-43.3	172.4	-169.5	-178.8	-172.4	173	0	111.8	A72 R73 S74 Y78 G79 L81 E83	A72-K76 PolarHBondContact O-N 3.01Å; R73-K76 WeakPolarHBondContact O-CB 3.45Å; R73-K76 PolarHBondContact O-N 2.62Å; S74-K76 VanDerWaalsContact C-N 3.27Å; S74-K76 PolarHBondContact O-N 3.3Å; K76-Y78 VanDerWaalsContact C-N 3.28Å; K76-Y78 PolarHBondContact O-N 3.37Å; K76-G79 PolarHBondContact O-N 3.02Å; K76-L81 HydrophobicContact CB-CB 4.5Å; K76-E83 WeakPolarHBondContact CE-O 3.33Å; K76-E83 PolarHBondContact NZ-O 2.91Å
77	A	85.6	Confident	84	Confident	90 Å²	90	76 Å²	76	74%	0.744	39%	0.391	S	S	*	.	H	α-helix	trans	-65.2	-31.4	176.8	0	0	0	0	0	112.7	R73 S74 G79	R73-A77 PolarHBondContact O-N 3.06Å; S74-A77 CarbonylContact O-C 3.58Å; S74-A77 WeakPolarHBondContact O-CA 3.49Å; S74-A77 WeakPolarHBondContact O-CB 2.99Å; S74-A77 PolarHBondContact O-N 2.81Å; A77-G79 PolarHBondContact O-N 2.9Å
78	Y	86.4	Confident	83.4	Confident	184 Å²	184	76.8 Å²	76.8	72%	0.722	40%	0.398	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.4	-8.5	173	-69.4	-61.4	0	0	0	113.9	S74 L75 K76 E80	S74-Y78 WeakPolarHBondContact O-CD2 3.46Å; S74-Y78 PolarHBondContact O-N 3.22Å; L75-Y78 PolarHBondContact O-N 2.76Å; K76-Y78 VanDerWaalsContact C-N 3.28Å; K76-Y78 PolarHBondContact O-N 3.37Å; Y78-E80 VanDerWaalsContact C-N 3.27Å; Y78-E80 PolarHBondContact O-N 3.39Å
79	G	84	Confident	82.2	Confident	62 Å²	62	79.6 Å²	79.6	64%	0.639	41%	0.409	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.3	12.6	-177.2	0	0	0	0	0	114.3	L75 K76 A77 L81	L75-G79 PolarHBondContact O-N 3.01Å; K76-G79 PolarHBondContact O-N 3.02Å; A77-G79 PolarHBondContact O-N 2.9Å; G79-L81 VanDerWaalsContact C-N 3.33Å
80	E	83.6	Confident	80.9	Confident	98 Å²	98	83.8 Å²	83.8	46%	0.458	43%	0.433	S	S	.	.	S	Bend	trans	-78.5	-23	176.6	-65.8	-73.7	175	0	0	111.7	Y7 L75 Y78	Y7-E80 HydrophobicContact CE2-CB 3.95Å; Y7-E80 HydrophobicContact CE2-CG 4.49Å; L75-E80 HydrophobicContact CD2-CB 4.22Å; L75-E80 HydrophobicContact CD2-CG 4.41Å; L75-E80 PolarHBondContact O-N 2.63Å; L75-E80 VanDerWaalsContact O-N 3.07Å; Y78-E80 VanDerWaalsContact C-N 3.27Å; Y78-E80 PolarHBondContact O-N 3.39Å
81	L	81.8	Confident	79.4	Confident	6 Å²	6	81.1 Å²	81.1	3%	0.031	42%	0.419	C	S	.	.	S	Bend	trans	-114.1	139.6	174.9	-61.3	177.6	0	0	0	110	Y7 F24 I48 L75 K76 G79 A85	Y7-L81 HydrophobicContact CD2-CD2 4.47Å; Y7-L81 HydrophobicContact CG-CD2 4.24Å; F24-L81 HydrophobicContact CD2-CD2 3.66Å; F24-L81 HydrophobicContact CE1-CD2 4.32Å; F24-L81 HydrophobicContact CE2-CD2 3.38Å; F24-L81 HydrophobicContact CG-CD2 4.25Å; F24-L81 HydrophobicContact CZ-CD2 3.74Å; I48-L81 HydrophobicContact CG2-CD1 4.27Å; L75-L81 HydrophobicContact CB-CD1 3.67Å; L75-L81 HydrophobicContact CB-CG 3.87Å; L75-L81 HydrophobicContact CD1-CD1 4.32Å; K76-L81 HydrophobicContact CB-CB 4.5Å; G79-L81 VanDerWaalsContact C-N 3.33Å; L81-A85 HydrophobicContact CB-CB 4.37Å
82	P	79.1	Confident	77.4	Confident	42 Å²	42	82.1 Å²	82.1	27%	0.273	43%	0.432	S	S	.	.			trans	-66.7	151.1	176.5	28.5	-34.1	0	0	0	111.3	F24 H84 A85	F24-P82 HydrophobicContact CD1-CG 3.5Å; F24-P82 VanDerWaalsContact CD1-CG 3.5Å; F24-P82 HydrophobicContact CE1-CG 3.79Å; P82-H84 WeakPolarHBondContact CB-CE1 2.96Å; P82-H84 VanDerWaalsContact CG-CE1 3.47Å; P82-H84 WeakPolarHBondContact CG-CE1 3.4Å; P82-H84 PolarHBondContact O-N 3.26Å; P82-A85 VanDerWaalsContact O-CB 3.3Å; P82-A85 WeakPolarHBondContact O-CB 3.47Å; P82-A85 PolarHBondContact O-N 3.32Å
83	E	73	Confident	75.4	Confident	175 Å²	175	90.5 Å²	90.5	82%	0.818	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.2	-25.7	-173.6	-75.8	-166.2	141.7	0	0	114.4	K76 A85	K76-E83 WeakPolarHBondContact CE-O 3.33Å; K76-E83 PolarHBondContact NZ-O 2.91Å; E83-A85 VanDerWaalsContact C-N 3.3Å; E83-A85 PolarHBondContact O-N 2.98Å
84	H	71.8	Confident	73.7	Confident	150 Å²	150	87.6 Å²	87.6	69%	0.694	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.5	-1.4	-179.7	67	-95.9	0	0	0	114	P82 K86	P82-H84 WeakPolarHBondContact CB-CE1 2.96Å; P82-H84 VanDerWaalsContact CG-CE1 3.47Å; P82-H84 WeakPolarHBondContact CG-CE1 3.4Å; P82-H84 PolarHBondContact O-N 3.26Å; H84-K86 PolarHBondContact O-N 2.87Å; H84-K86 VanDerWaalsContact O-N 3.1Å
85	A	76.8	Confident	71.9	Confident	7 Å²	7	90.4 Å²	90.4	6%	0.058	49%	0.488	C	S	.	.			trans	-61.5	114.6	175.2	0	0	0	0	0	109.8	F24 L81 P82 E83 I87	F24-A85 HydrophobicContact CE1-CB 3.98Å; F24-A85 HydrophobicContact CZ-CB 4.14Å; L81-A85 HydrophobicContact CB-CB 4.37Å; P82-A85 VanDerWaalsContact O-CB 3.3Å; P82-A85 WeakPolarHBondContact O-CB 3.47Å; P82-A85 PolarHBondContact O-N 3.32Å; E83-A85 VanDerWaalsContact C-N 3.3Å; E83-A85 PolarHBondContact O-N 2.98Å; A85-I87 PolarHBondContact O-N 3.09Å
86	K	77.8	Confident	69.9	Low	170 Å²	170	92.5 Å²	92.5	74%	0.739	51%	0.514	S	S	*	.			trans	-83.8	106.5	176.7	-67.8	-174.8	-179.5	-176.5	0	108.9	Q9 H84	Q9-K86 PolarHBondContact NE2-O 2.89Å; H84-K86 PolarHBondContact O-N 2.87Å; H84-K86 VanDerWaalsContact O-N 3.1Å
87	I	81.6	Confident	67.9	Low	42 Å²	42	96 Å²	96	22%	0.215	54%	0.536	C	S	.	.			trans	-84.4	130.2	179.3	-58.1	167.7	0	0	0	108.2	A69 A72 R73 A85	A69-I87 HydrophobicContact CB-CG2 4.06Å; A72-I87 HydrophobicContact CB-CD1 3.88Å; A72-I87 HydrophobicContact CB-CG1 4.02Å; A72-I87 HydrophobicContact CB-CG2 3.89Å; R73-I87 HydrophobicContact CB-CD1 4.39Å; R73-I87 HydrophobicContact CG-CD1 3.79Å; A85-I87 PolarHBondContact O-N 3.09Å
88	N	77.4	Confident	66.3	Low	50 Å²	50	99 Å²	99	27%	0.267	54%	0.54	S	S	.	.			trans	-83.5	130.5	174.3	-168.1	-9.2	0	0	0	109.4	T45 A69 T90	T45-N88 PolarHBondContact O-ND2 2.87Å; A69-N88 WeakPolarHBondContact CB-O 3.44Å; N88-T90 WeakPolarHBondContact OD1-CB 3.37Å; N88-T90 PolarHBondContact OD1-N 3.02Å; N88-T90 PolarHBondContact OD1-OG1 3.48Å
89	E	65.6	Low	64.6	Low	120 Å²	120	97.8 Å²	97.8	56%	0.561	55%	0.546	S	S	*	.			trans	-95	11.2	-178	-60.6	-164.8	144.2	0	0	113.4	R73 D91 T92	R73-E89 IonicContact CZ-OE1 3.57Å; R73-E89 IonicContact NE-OE1 2.63Å; R73-E89 IonicContact NH2-OE1 3.93Å; R73-E89 PolarHBondContact NH2-OE1 2.94Å; E89-D91 VanDerWaalsContact C-N 3.28Å; E89-D91 PolarHBondContact O-N 3.23Å; E89-T92 PolarHBondContact O-OG1 3.39Å
90	T	59.4	Low	63.3	Low	100 Å²	100	102.5 Å²	102.5	61%	0.613	55%	0.552	S	S	*	*			trans	-70.7	-15.3	-173	-61.6	0	0	0	0	114.2	N88 T92	N88-T90 WeakPolarHBondContact OD1-CB 3.37Å; N88-T90 PolarHBondContact OD1-N 3.02Å; N88-T90 PolarHBondContact OD1-OG1 3.48Å; T90-T92 PolarHBondContact O-N 2.98Å
91	D	54.9	Low	62.2	Low	48 Å²	48	104.9 Å²	104.9	26%	0.257	57%	0.566	S	S	.	*			trans	-82.2	50.3	174.7	-79.7	-48.8	0	0	0	112.4	K66 E89 F93	K66-D91 WeakPolarHBondContact CE-OD2 3.36Å; K66-D91 IonicContact NZ-OD1 2.62Å; K66-D91 PolarHBondContact NZ-OD1 2.87Å; K66-D91 IonicContact NZ-OD2 3.01Å; K66-D91 PolarHBondContact NZ-OD2 2.95Å; E89-D91 VanDerWaalsContact C-N 3.28Å; E89-D91 PolarHBondContact O-N 3.23Å; D91-F93 PolarHBondContact O-N 2.79Å
92	T	47.9	Very low	61	Low	112 Å²	112	111.7 Å²	111.7	69%	0.687	60%	0.598	S	S	*	*			trans	-71	-2.5	173.8	-36.3	0	0	0	0	112.7	E89 T90	E89-T92 PolarHBondContact O-OG1 3.39Å; T90-T92 PolarHBondContact O-N 2.98Å
93	F	47.5	Very low	60.2	Low	177 Å²	177	118.1 Å²	118.1	78%	0.776	62%	0.621	S	S	*	*	S	Bend	trans	-124.9	114.1	170.9	-59.1	-85.4	0	0	0	106.7	D91	D91-F93 PolarHBondContact O-N 2.79Å
94	G	50.2	Low	59.2	Low	45 Å²	45	116.2 Å²	116.2	46%	0.464	62%	0.617	S	S	.	*			trans	-55.1	176.8	165.3	0	0	0	0	0	110.5	G96	G94-G96 PolarHBondContact O-N 3.18Å
95	P	51.4	Low	58.6	Low	118 Å²	118	116 Å²	116	77%	0.766	62%	0.621	S	S	*	*	S	Bend	trans	-50.4	112.5	163.2	24.7	-31	0	0	0	106.3	D97	P95-D97 PolarHBondContact O-N 3.43Å
96	G	45.6	Very low	57.7	Low	62 Å²	62	123.1 Å²	123.1	64%	0.639	66%	0.656	S	S	*	*			trans	-55	112.2	172.6	0	0	0	0	0	106	G94 D98	G94-G96 PolarHBondContact O-N 3.18Å; G96-D98 PolarHBondContact O-N 2.92Å
97	D	45.4	Very low	56.6	Low	157 Å²	157	117.1 Å²	117.1	84%	0.84	64%	0.643	S	S	*	*			trans	-60	75.4	136.2	-80.8	-39.7	0	0	0	105.6	P95 D99	P95-D97 PolarHBondContact O-N 3.43Å; D97-D99 PolarHBondContact O-N 2.88Å
98	D	51.2	Low	55.4	Low	154 Å²	154	122.5 Å²	122.5	82%	0.824	67%	0.672	S	S	*	*			trans	-92.8	31.1	174.4	-138.4	9.3	0	0	0	108.7	G96	G96-D98 PolarHBondContact O-N 2.92Å
99	D	51.2	Low	54.4	Low	159 Å²	159	125.7 Å²	125.7	85%	0.85	69%	0.689	S	S	*	*	S	Bend	trans	-135.6	23.5	-179.5	-88.1	-36.7	0	0	0	112.2	D97	D97-D99 PolarHBondContact O-N 2.88Å
100	E	55.7	Low	54	Low	161 Å²	161	128.2 Å²	128.2	75%	0.752	71%	0.706	S	S	*	*			trans	-134.1	71.5	164.2	-74.4	-168.3	179.5	0	0	111.7	Q102	E100-Q102 PolarHBondContact O-N 3.44Å
101	I	61.1	Low	53.9	Low	147 Å²	147	130.7 Å²	130.7	75%	0.754	71%	0.711	S	S	*	*			trans	-83	92.1	144	-55.7	176	0	0	0	105.8	F103	I101-F103 HydrophobicContact CG2-CD2 3.66Å; I101-F103 HydrophobicContact CG2-CE2 3.92Å; I101-F103 PolarHBondContact O-N 2.96Å; I101-F103 VanDerWaalsContact O-N 3.11Å
102	Q	57.1	Low	54	Low	150 Å²	150	134.5 Å²	134.5	70%	0.701	73%	0.731	S	S	*	*			trans	-67.6	101.7	157.2	-88.8	-176.8	-25.9	0	0	106.8	E100 D104	E100-Q102 PolarHBondContact O-N 3.44Å; Q102-D104 PolarHBondContact O-N 3.11Å
103	F	61.3	Low	54.5	Low	176 Å²	176	137.3 Å²	137.3	77%	0.772	74%	0.74	S	S	*	*			trans	-67.3	89.7	155.9	-99.9	-94.1	0	0	0	106.4	I101 D105	I101-F103 HydrophobicContact CG2-CD2 3.66Å; I101-F103 HydrophobicContact CG2-CE2 3.92Å; I101-F103 PolarHBondContact O-N 2.96Å; I101-F103 VanDerWaalsContact O-N 3.11Å; F103-D105 PolarHBondContact O-N 3.22Å
104	D	51.9	Low	55	Low	136 Å²	136	135.6 Å²	135.6	73%	0.727	74%	0.739	S	S	*	*			trans	-66	110.5	159.9	-98.5	-7.9	0	0	0	107	Q102	Q102-D104 PolarHBondContact O-N 3.11Å
105	D	59.4	Low	55.4	Low	144 Å²	144	141.2 Å²	141.2	77%	0.77	76%	0.759	S	S	*	*			trans	46.5	83.8	140.6	-147	30.7	0	0	0	115.5	F103 G107	F103-D105 PolarHBondContact O-N 3.22Å; D105-G107 PolarHBondContact O-N 2.89Å
106	I	59.1	Low	55.3	Low	157 Å²	157	147 Å²	147	81%	0.805	78%	0.781	S	S	*	*			trans	-70.6	81.7	146.4	-63.3	174.8	0	0	0	105
107	G	53.9	Low	55.8	Low	44 Å²	44	151.3 Å²	151.3	45%	0.454	79%	0.788	S	S	.	*			trans	-60.3	138.6	164.2	0	0	0	0	0	109.3	D105	D105-G107 PolarHBondContact O-N 2.89Å
108	D	56.5	Low	56.3	Low	155 Å²	155	151 Å²	151	83%	0.829	79%	0.785	S	S	*	*			trans	-37.6	159.5	169.9	-105.4	-26.3	0	0	0	115.5
109	D	56.8	Low	56.6	Low	117 Å²	117	150.8 Å²	150.8	63%	0.626	78%	0.783	S	S	*	*			trans	73.2	97.6	160.4	-73.9	-15.2	0	0	0	118.5
110	D	56	Low	56.9	Low	173 Å²	173	150.4 Å²	150.4	93%	0.925	78%	0.779	S	S	*	*				-137.2	101.1	116.3	-91.8	-37.4	0	0	0	107.8
111	E	57.8	Low	57	Low	153 Å²	153	149.7 Å²	149.7	72%	0.715	78%	0.781	S	S	*	*			trans	-54.4	164.9	158.8	-71.1	-174.1	-155.3	0	0	110.5
112	D	57.5	Low	56.7	Low	128 Å²	128	149.9 Å²	149.9	68%	0.684	78%	0.783	S	S	*	*			trans	89.7	65.9	167.6	-47.3	-29.9	0	0	0	117.9	D114	D112-D114 VanDerWaalsContact C-N 3.32Å; D112-D114 PolarHBondContact O-N 3.2Å
113	I	58.7	Low	56.7	Low	171 Å²	171	149.9 Å²	149.9	88%	0.877	79%	0.789	S	S	*	*			trans	-78.3	93.5	138.3	-71.7	175.3	0	0	0	106.6	D115	I113-D115 PolarHBondContact O-N 3.41Å
114	D	57.3	Low	56.3	Low	140 Å²	140	147.8 Å²	147.8	75%	0.749	79%	0.79	S	S	*	*			trans	-66	120.7	164.9	-87.6	-32.1	0	0	0	109.4	D112 I116	D112-D114 VanDerWaalsContact C-N 3.32Å; D112-D114 PolarHBondContact O-N 3.2Å; D114-I116 PolarHBondContact O-N 3.34Å
115	D	58.1	Low	56.7	Low	163 Å²	163	148.8 Å²	148.8	87%	0.872	80%	0.795	S	S	*	*			trans	-60.1	108.2	161.1	-98.3	-31.3	0	0	0	109.5	I113	I113-D115 PolarHBondContact O-N 3.41Å
116	I	48.9	Very low	56.4	Low	241 Å²	241	149.3 Å²	149.3	100%	1.236	80%	0.797	S	S	*	*			trans	-155.7	0	149.1	-122.9	167.6	0	0	0	113.5	D114	D114-I116 PolarHBondContact O-N 3.34Å

Retrieved 116 of 116 residues in 21.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).