X6RK76_HUMAN Loading...

Inositol 1,4,5-trisphosphate receptor interacting protein

AlphaFold DB , UniProt , Accession X6RK76, Species HUMAN (Homo sapiens, Human), Gene ITPRIP, Length 114 aa.

						>X6RK76_HUMAN|X6RK76|ITPRIP
MAMGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVARLAAEKEALEQVAEEGRQQNETRVAWDLWSTLCMILFLMIEVWRQDHQEGPSPE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.7	Low	62.6	Low	238 Å²	238	121.9 Å²	121.9	100%	1.172	66%	0.658	S	S	*	*				0	1.7	0	-57.2	-165.9	-142	0	0	114.4
2	A	54.4	Low	63.3	Low	78 Å²	78	117.8 Å²	117.8	65%	0.645	64%	0.64	S	S	*	*			trans	-91.9	-19.4	-180	0	0	0	0	0	114.9	G4	A2-G4 PolarHBondContact O-N 2.69Å
3	M	56.1	Low	64.1	Low	167 Å²	167	113.9 Å²	113.9	82%	0.823	62%	0.622	S	S	*	*	H	α-helix	trans	-71.4	-27.7	-174.4	-144.1	109.2	-161	0	0	113.8	R7	M3-R7 PolarHBondContact O-N 3.23Å
4	G	58.9	Low	64.3	Low	47 Å²	47	111.7 Å²	111.7	49%	0.485	61%	0.614	S	S	.	*	H	α-helix	trans	-73.3	-39	-179.3	0	0	0	0	0	112.9	A2 F6 R7 V8	A2-G4 PolarHBondContact O-N 2.69Å; G4-F6 VanDerWaalsContact C-N 3.29Å; G4-F6 PolarHBondContact O-N 3.5Å; G4-R7 PolarHBondContact O-N 2.95Å; G4-V8 WeakPolarHBondContact O-CG2 3.26Å; G4-V8 PolarHBondContact O-N 3.45Å; G4-V8 VanDerWaalsContact O-N 3.14Å
5	L	60.5	Low	64.4	Low	125 Å²	125	108.1 Å²	108.1	65%	0.654	61%	0.605	S	S	*	*	H	α-helix	trans	-62.4	-37.9	176.2	-72.4	166.6	0	0	0	111.6	R7 V8 C9	L5-R7 VanDerWaalsContact C-N 3.35Å; L5-R7 PolarHBondContact O-N 3.07Å; L5-V8 PolarHBondContact O-N 2.98Å; L5-C9 WeakPolarHBondContact O-CB 3.33Å; L5-C9 PolarHBondContact O-N 3.36Å
6	F	63	Low	64.5	Low	143 Å²	143	108.4 Å²	108.4	63%	0.627	60%	0.603	S	S	*	*	H	α-helix	trans	-65.8	-37.2	179.1	-150.5	-93.1	0	0	0	112.6	G4 L10	G4-F6 VanDerWaalsContact C-N 3.29Å; G4-F6 PolarHBondContact O-N 3.5Å; F6-L10 HydrophobicContact CD1-CD1 3.73Å; F6-L10 HydrophobicContact CD1-CG 4.15Å; F6-L10 HydrophobicContact CE1-CD1 3.81Å; F6-L10 HydrophobicContact CE1-CG 4.18Å; F6-L10 WeakPolarHBondContact O-CB 3.11Å; F6-L10 WeakPolarHBondContact O-CG 3.4Å; F6-L10 PolarHBondContact O-N 3.48Å
7	R	65	Low	64.5	Low	192 Å²	192	109.2 Å²	109.2	73%	0.725	61%	0.605	S	S	*	*	H	α-helix	trans	-67.3	-41.4	175.3	-72.7	-79.8	-175.7	170.6	-0.8	111.6	M3 G4 L5 L10 V11	M3-R7 PolarHBondContact O-N 3.23Å; G4-R7 PolarHBondContact O-N 2.95Å; L5-R7 VanDerWaalsContact C-N 3.35Å; L5-R7 PolarHBondContact O-N 3.07Å; R7-L10 PolarHBondContact O-N 2.85Å; R7-V11 VanDerWaalsContact O-CG2 3.32Å; R7-V11 WeakPolarHBondContact O-CG2 3.46Å; R7-V11 PolarHBondContact O-N 2.92Å; R7-V11 VanDerWaalsContact O-N 3.1Å
8	V	69.1	Low	64.3	Low	90 Å²	90	110.9 Å²	110.9	55%	0.545	61%	0.613	S	S	.	*	H	α-helix	trans	-65.1	-46.2	176.1	176.7	0	0	0	0	110.6	G4 L5 L10 V11 V12	G4-V8 WeakPolarHBondContact O-CG2 3.26Å; G4-V8 PolarHBondContact O-N 3.45Å; G4-V8 VanDerWaalsContact O-N 3.14Å; L5-V8 PolarHBondContact O-N 2.98Å; V8-L10 PolarHBondContact O-N 3.38Å; V8-V11 PolarHBondContact O-N 3.07Å; V8-V12 HydrophobicContact CG1-CG2 4.38Å; V8-V12 VanDerWaalsContact O-CG2 3.31Å; V8-V12 WeakPolarHBondContact O-CG2 3.46Å; V8-V12 PolarHBondContact O-N 3.09Å
9	C	65.3	Low	63.8	Low	76 Å²	76	111.6 Å²	111.6	51%	0.514	61%	0.61	S	S	.	*	H	α-helix	trans	-60.6	-42.4	176.5	-79.4	0	0	0	0	112.2	L5 V11 V12 V13	L5-C9 WeakPolarHBondContact O-CB 3.33Å; L5-C9 PolarHBondContact O-N 3.36Å; C9-V11 PolarHBondContact O-N 3.48Å; C9-V12 PolarHBondContact O-N 3.38Å; C9-V13 VanDerWaalsContact O-CB 3.27Å; C9-V13 WeakPolarHBondContact O-CB 3.41Å; C9-V13 WeakPolarHBondContact O-CG2 3.45Å; C9-V13 PolarHBondContact O-N 3.4Å
10	L	72.8	Confident	63.1	Low	88 Å²	88	109.9 Å²	109.9	46%	0.461	61%	0.605	S	S	.	*	H	α-helix	trans	-64.4	-39.1	177.6	-76.5	173.8	0	0	0	112.7	F6 R7 V8 V13 T14	F6-L10 HydrophobicContact CD1-CD1 3.73Å; F6-L10 HydrophobicContact CD1-CG 4.15Å; F6-L10 HydrophobicContact CE1-CD1 3.81Å; F6-L10 HydrophobicContact CE1-CG 4.18Å; F6-L10 WeakPolarHBondContact O-CB 3.11Å; F6-L10 WeakPolarHBondContact O-CG 3.4Å; F6-L10 PolarHBondContact O-N 3.48Å; R7-L10 PolarHBondContact O-N 2.85Å; V8-L10 PolarHBondContact O-N 3.38Å; L10-V13 PolarHBondContact O-N 3.48Å; L10-T14 WeakPolarHBondContact O-CB 3.37Å; L10-T14 WeakPolarHBondContact O-CG2 3.18Å; L10-T14 PolarHBondContact O-N 3.08Å; L10-T14 PolarHBondContact O-OG1 3.01Å
11	V	70.6	Confident	62.5	Low	97 Å²	97	111.9 Å²	111.9	59%	0.588	61%	0.614	S	S	*	*	H	α-helix	trans	-67.5	-39.4	176.4	171.6	0	0	0	0	111.5	R7 V8 C9 T14 A15	R7-V11 VanDerWaalsContact O-CG2 3.32Å; R7-V11 WeakPolarHBondContact O-CG2 3.46Å; R7-V11 PolarHBondContact O-N 2.92Å; R7-V11 VanDerWaalsContact O-N 3.1Å; V8-V11 PolarHBondContact O-N 3.07Å; C9-V11 PolarHBondContact O-N 3.48Å; V11-T14 WeakPolarHBondContact CA-OG1 3.38Å; V11-T14 PolarHBondContact O-OG1 3.35Å; V11-A15 VanDerWaalsContact O-CB 3.25Å; V11-A15 WeakPolarHBondContact O-CB 3.36Å; V11-A15 PolarHBondContact O-N 3.2Å
12	V	71.8	Confident	62.5	Low	73 Å²	73	106.2 Å²	106.2	44%	0.442	59%	0.588	S	S	.	*	H	α-helix	trans	-67.9	-43.3	175.9	170.9	0	0	0	0	110.5	V8 C9 A15 I16	V8-V12 HydrophobicContact CG1-CG2 4.38Å; V8-V12 VanDerWaalsContact O-CG2 3.31Å; V8-V12 WeakPolarHBondContact O-CG2 3.46Å; V8-V12 PolarHBondContact O-N 3.09Å; C9-V12 PolarHBondContact O-N 3.38Å; V12-A15 PolarHBondContact O-N 2.92Å; V12-I16 HydrophobicContact CG1-CD1 3.59Å; V12-I16 HydrophobicContact CG1-CG1 4.35Å; V12-I16 WeakPolarHBondContact O-CB 3.36Å; V12-I16 WeakPolarHBondContact O-CD1 3.36Å; V12-I16 WeakPolarHBondContact O-CG1 3.46Å; V12-I16 PolarHBondContact O-N 3.11Å
13	V	73.3	Confident	62.3	Low	67 Å²	67	110.8 Å²	110.8	41%	0.406	59%	0.594	S	S	.	*	H	α-helix	trans	-64.8	-42.6	177.1	169.7	0	0	0	0	110.9	C9 L10 I16 I17	C9-V13 VanDerWaalsContact O-CB 3.27Å; C9-V13 WeakPolarHBondContact O-CB 3.41Å; C9-V13 WeakPolarHBondContact O-CG2 3.45Å; C9-V13 PolarHBondContact O-N 3.4Å; L10-V13 PolarHBondContact O-N 3.48Å; V13-I16 PolarHBondContact O-N 2.87Å; V13-I17 HydrophobicContact CG1-CD1 3.42Å; V13-I17 VanDerWaalsContact CG1-CD1 3.42Å; V13-I17 HydrophobicContact CG1-CG1 4.19Å; V13-I17 VanDerWaalsContact O-CB 3.23Å; V13-I17 WeakPolarHBondContact O-CB 3.49Å; V13-I17 WeakPolarHBondContact O-CG1 3.4Å; V13-I17 PolarHBondContact O-N 2.89Å
14	T	66.8	Low	62	Low	83 Å²	83	107.4 Å²	107.4	51%	0.509	58%	0.584	S	S	.	*	H	α-helix	trans	-71.2	-30.4	174.9	54.1	0	0	0	0	112.5	L10 V11 N18	L10-T14 WeakPolarHBondContact O-CB 3.37Å; L10-T14 WeakPolarHBondContact O-CG2 3.18Å; L10-T14 PolarHBondContact O-N 3.08Å; L10-T14 PolarHBondContact O-OG1 3.01Å; V11-T14 WeakPolarHBondContact CA-OG1 3.38Å; V11-T14 PolarHBondContact O-OG1 3.35Å; T14-N18 WeakPolarHBondContact O-CA 3.27Å; T14-N18 WeakPolarHBondContact O-CB 3.46Å; T14-N18 PolarHBondContact O-N 3.41Å
15	A	66.2	Low	61.5	Low	58 Å²	58	115.9 Å²	115.9	48%	0.479	60%	0.601	S	S	.	*	H	α-helix	trans	-67.4	-39.5	170.5	0	0	0	0	0	112	V11 V12 H19	V11-A15 VanDerWaalsContact O-CB 3.25Å; V11-A15 WeakPolarHBondContact O-CB 3.36Å; V11-A15 PolarHBondContact O-N 3.2Å; V12-A15 PolarHBondContact O-N 2.92Å; A15-H19 WeakPolarHBondContact O-CB 3.48Å; A15-H19 PolarHBondContact O-N 3.28Å
16	I	66.1	Low	60.8	Low	113 Å²	113	118.1 Å²	118.1	58%	0.579	61%	0.609	S	S	*	*	H	α-helix	trans	-70.1	-38.3	176	-66.8	165.5	0	0	0	111.2	V12 V13 P20	V12-I16 HydrophobicContact CG1-CD1 3.59Å; V12-I16 HydrophobicContact CG1-CG1 4.35Å; V12-I16 WeakPolarHBondContact O-CB 3.36Å; V12-I16 WeakPolarHBondContact O-CD1 3.36Å; V12-I16 WeakPolarHBondContact O-CG1 3.46Å; V12-I16 PolarHBondContact O-N 3.11Å; V13-I16 PolarHBondContact O-N 2.87Å; I16-P20 WeakPolarHBondContact O-CD 3.25Å
17	I	64.2	Low	59.9	Low	122 Å²	122	118.2 Å²	118.2	63%	0.626	62%	0.616	S	S	*	*	H	α-helix	trans	-85	-32.2	-177.9	-66.6	174.6	0	0	0	113.1	V13 H19 P20	V13-I17 HydrophobicContact CG1-CD1 3.42Å; V13-I17 VanDerWaalsContact CG1-CD1 3.42Å; V13-I17 HydrophobicContact CG1-CG1 4.19Å; V13-I17 VanDerWaalsContact O-CB 3.23Å; V13-I17 WeakPolarHBondContact O-CB 3.49Å; V13-I17 WeakPolarHBondContact O-CG1 3.4Å; V13-I17 PolarHBondContact O-N 2.89Å; I17-H19 PolarHBondContact O-N 2.99Å; I17-P20 WeakPolarHBondContact O-CD 3.2Å
18	N	60.4	Low	59	Low	140 Å²	140	112.3 Å²	112.3	75%	0.749	61%	0.608	S	S	*	*	H	α-helix	trans	-77	-12.1	174.6	-164.8	39.3	0	0	0	111.6	T14	T14-N18 WeakPolarHBondContact O-CA 3.27Å; T14-N18 WeakPolarHBondContact O-CB 3.46Å; T14-N18 PolarHBondContact O-N 3.41Å
19	H	56	Low	58.3	Low	123 Å²	123	112.1 Å²	112.1	57%	0.569	61%	0.607	S	S	*	*	S	Bend	trans	-127.5	30.4	-175.6	-142.2	-64.5	0	0	0	117.6	A15 I17	A15-H19 WeakPolarHBondContact O-CB 3.48Å; A15-H19 PolarHBondContact O-N 3.28Å; I17-H19 PolarHBondContact O-N 2.99Å
20	P	48.2	Very low	57.5	Low	78 Å²	78	113.4 Å²	113.4	51%	0.506	61%	0.612	S	S	.	*	S	Bend	trans	-94.3	3.6	164.5	37	-28.2	0	0	0	112.2	I16 I17	I16-P20 WeakPolarHBondContact O-CD 3.25Å; I17-P20 WeakPolarHBondContact O-CD 3.2Å
21	L	50.9	Low	56.5	Low	151 Å²	151	114.3 Å²	114.3	79%	0.791	62%	0.624	S	S	*	*	S	Bend	trans	-133	9.7	-170	-94	162.5	0	0	0	115.5	F23	L21-F23 PolarHBondContact O-N 3.46Å
22	L	52.3	Low	55.7	Low	119 Å²	119	118 Å²	118	62%	0.623	63%	0.634	S	S	*	*			trans	-95.3	62.8	160.7	-71.1	176.1	0	0	0	108.6	P24	L22-P24 WeakPolarHBondContact O-CD 3.45Å
23	F	50.9	Low	55	Low	174 Å²	174	118.4 Å²	118.4	76%	0.763	63%	0.634	S	S	*	*			trans	-64.1	114	145.3	-81	-78.5	0	0	0	105.2	L21 R25	L21-F23 PolarHBondContact O-N 3.46Å; F23-R25 PolarHBondContact O-N 2.86Å
24	P	49	Very low	54.5	Low	96 Å²	96	119.9 Å²	119.9	62%	0.623	64%	0.636	S	S	*	*			trans	-54.5	119.5	172	-19.9	33	0	0	0	107.1	L22 E26	L22-P24 WeakPolarHBondContact O-CD 3.45Å; P24-E26 HydrophobicContact CB-CB 4.14Å; P24-E26 PolarHBondContact O-N 2.84Å
25	R	48.9	Very low	54.4	Low	225 Å²	225	123.6 Å²	123.6	85%	0.849	65%	0.648	S	S	*	*	G	3₁₀ helix	trans	-65.6	28.6	166.5	-80.6	-171.8	69.7	123	1.2	112	F23 A28	F23-R25 PolarHBondContact O-N 2.86Å; R25-A28 PolarHBondContact O-N 3.23Å
26	E	46.3	Very low	54.4	Low	173 Å²	173	125.7 Å²	125.7	81%	0.808	65%	0.648	S	S	*	*	G	3₁₀ helix	trans	-80.5	-7.2	175.8	-158.4	168.1	168.4	0	0	111.9	P24	P24-E26 HydrophobicContact CB-CB 4.14Å; P24-E26 PolarHBondContact O-N 2.84Å
27	N	43.9	Very low	54.7	Low	145 Å²	145	124.8 Å²	124.8	78%	0.775	64%	0.643	S	S	*	*	G	3₁₀ helix	trans	-108.2	45.2	162.8	-68	-22.4	0	0	0	110.7	T29	N27-T29 PolarHBondContact O-N 3.26Å
28	A	47.2	Very low	55.3	Low	67 Å²	67	123.7 Å²	123.7	55%	0.554	64%	0.638	S	S	*	*			trans	-69.9	78.9	150.8	0	0	0	0	0	106	R25 V30	R25-A28 PolarHBondContact O-N 3.23Å; A28-V30 PolarHBondContact O-N 2.91Å
29	T	52.6	Low	56.2	Low	86 Å²	86	126.5 Å²	126.5	53%	0.528	64%	0.638	S	S	.	*			trans	-52.1	116.1	171.4	36.8	0	0	0	0	107.1	N27 E34	N27-T29 PolarHBondContact O-N 3.26Å; T29-E34 PolarHBondContact OG1-OE1 3.38Å
30	V	49.6	Very low	57.4	Low	103 Å²	103	126.7 Å²	126.7	62%	0.624	64%	0.637	S	S	*	*			trans	-44	122.3	158.4	170.9	0	0	0	0	107	A28 E32	A28-V30 PolarHBondContact O-N 2.91Å; V30-E32 HydrophobicContact CG1-CB 3.84Å; V30-E32 PolarHBondContact O-N 3.33Å
31	P	52.1	Low	58.9	Low	108 Å²	108	128.7 Å²	128.7	70%	0.701	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.5	8.7	-173	27.4	-34	0	0	0	113.9
32	E	53.3	Low	60.5	Low	174 Å²	174	126.7 Å²	126.7	81%	0.813	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.2	-13.1	-177.9	-154.6	174.7	124.6	0	0	113.2	V30	V30-E32 HydrophobicContact CG1-CB 3.84Å; V30-E32 PolarHBondContact O-N 3.33Å
33	N	57.6	Low	62	Low	82 Å²	82	123.6 Å²	123.6	44%	0.439	62%	0.619	S	S	.	*	S	Bend	trans	-113.2	-6.5	-175.9	-157.5	3.3	0	0	0	114.5	E35 E36 I37	N33-E35 PolarHBondContact O-N 3.31Å; N33-E36 PolarHBondContact O-N 3.45Å; N33-I37 WeakPolarHBondContact O-CB 3.24Å; N33-I37 WeakPolarHBondContact O-CD1 3.36Å; N33-I37 WeakPolarHBondContact O-CG1 3.23Å; N33-I37 PolarHBondContact O-N 3.38Å
34	E	62.3	Low	63.5	Low	97 Å²	97	121.8 Å²	121.8	45%	0.453	61%	0.613	S	S	.	*	H	α-helix	trans	-65.8	-39.9	179.9	-65.2	-176.4	177.3	0	0	111.3	T29 E36 I37 I38	T29-E34 PolarHBondContact OG1-OE1 3.38Å; E34-E36 PolarHBondContact O-N 2.99Å; E34-I37 PolarHBondContact O-N 2.81Å; E34-I38 WeakPolarHBondContact O-CB 3.47Å; E34-I38 WeakPolarHBondContact O-CD1 3.43Å; E34-I38 WeakPolarHBondContact O-CG1 3.32Å; E34-I38 PolarHBondContact O-N 3.16Å
35	E	65.2	Low	65.3	Low	161 Å²	161	122.1 Å²	122.1	75%	0.752	61%	0.606	S	S	*	*	H	α-helix	trans	-65.5	-37.5	176.9	-66.2	-174.9	163.9	0	0	112.5	N33 R39	N33-E35 PolarHBondContact O-N 3.31Å; E35-R39 VanDerWaalsContact O-CB 3.26Å; E35-R39 WeakPolarHBondContact O-CB 3.49Å; E35-R39 PolarHBondContact O-N 3.4Å
36	E	66.4	Low	67.1	Low	102 Å²	102	117.4 Å²	117.4	48%	0.477	59%	0.594	S	S	.	*	H	α-helix	trans	-72.3	-37.1	177.6	-155.6	-166.7	137.2	0	0	111.7	N33 E34 R39 K40	N33-E36 PolarHBondContact O-N 3.45Å; E34-E36 PolarHBondContact O-N 2.99Å; E36-R39 PolarHBondContact O-N 3.02Å; E36-K40 PolarHBondContact O-N 3.17Å; E36-K40 IonicContact OE1-NZ 2.69Å; E36-K40 PolarHBondContact OE1-NZ 2.92Å
37	I	70.7	Confident	69.1	Low	94 Å²	94	115.4 Å²	115.4	48%	0.482	58%	0.582	S	S	.	*	H	α-helix	trans	-64.8	-48.2	173.4	-67.7	165.3	0	0	0	110.3	N33 E34 R39 K40 M41	N33-I37 WeakPolarHBondContact O-CB 3.24Å; N33-I37 WeakPolarHBondContact O-CD1 3.36Å; N33-I37 WeakPolarHBondContact O-CG1 3.23Å; N33-I37 PolarHBondContact O-N 3.38Å; E34-I37 PolarHBondContact O-N 2.81Å; I37-R39 VanDerWaalsContact C-N 3.27Å; I37-R39 PolarHBondContact O-N 2.95Å; I37-K40 PolarHBondContact O-N 2.89Å; I37-M41 WeakPolarHBondContact O-CB 3.49Å; I37-M41 PolarHBondContact O-N 3.29Å
38	I	78.3	Confident	71.3	Confident	99 Å²	99	113.3 Å²	113.3	51%	0.508	57%	0.571	S	S	.	*	H	α-helix	trans	-57.2	-45	177.1	-70.3	162.3	0	0	0	109.7	E34 K40 M41 Q42	E34-I38 WeakPolarHBondContact O-CB 3.47Å; E34-I38 WeakPolarHBondContact O-CD1 3.43Å; E34-I38 WeakPolarHBondContact O-CG1 3.32Å; E34-I38 PolarHBondContact O-N 3.16Å; I38-K40 PolarHBondContact O-N 3.42Å; I38-M41 PolarHBondContact O-N 3.03Å; I38-Q42 WeakPolarHBondContact O-CB 3.45Å; I38-Q42 PolarHBondContact O-N 3.36Å
39	R	78.9	Confident	73.3	Confident	200 Å²	200	115.6 Å²	115.6	76%	0.755	57%	0.57	S	S	*	*	H	α-helix	trans	-66.1	-39.1	-179.8	-163.6	175.4	172	-174.6	-2.9	112.9	E35 E36 I37 A43	E35-R39 VanDerWaalsContact O-CB 3.26Å; E35-R39 WeakPolarHBondContact O-CB 3.49Å; E35-R39 PolarHBondContact O-N 3.4Å; E36-R39 PolarHBondContact O-N 3.02Å; I37-R39 VanDerWaalsContact C-N 3.27Å; I37-R39 PolarHBondContact O-N 2.95Å; R39-A43 PolarHBondContact O-N 2.92Å; R39-A43 VanDerWaalsContact O-N 3.07Å
40	K	80.1	Confident	75.2	Confident	127 Å²	127	117.9 Å²	117.9	55%	0.552	58%	0.578	S	S	*	*	H	α-helix	trans	-66.1	-39.9	172.4	-82.3	178.4	-177.2	143.5	0	112.1	E36 I37 I38 Q42 A43 H44	E36-K40 PolarHBondContact O-N 3.17Å; E36-K40 IonicContact OE1-NZ 2.69Å; E36-K40 PolarHBondContact OE1-NZ 2.92Å; I37-K40 PolarHBondContact O-N 2.89Å; I38-K40 PolarHBondContact O-N 3.42Å; K40-Q42 VanDerWaalsContact C-N 3.34Å; K40-A43 PolarHBondContact O-N 3.47Å; K40-H44 PolarHBondContact O-N 2.94Å
41	M	81.5	Confident	77.1	Confident	119 Å²	119	117.5 Å²	117.5	59%	0.586	57%	0.57	S	S	*	*	H	α-helix	trans	-64.4	-42.8	178.2	-148.1	177.5	77.3	0	0	110.4	I37 I38 H44 Q45	I37-M41 WeakPolarHBondContact O-CB 3.49Å; I37-M41 PolarHBondContact O-N 3.29Å; I38-M41 PolarHBondContact O-N 3.03Å; M41-H44 PolarHBondContact O-N 3.48Å; M41-Q45 WeakPolarHBondContact O-CB 3.27Å; M41-Q45 PolarHBondContact O-N 2.83Å
42	Q	84.4	Confident	78.9	Confident	109 Å²	109	117.8 Å²	117.8	51%	0.509	56%	0.561	S	S	.	*	H	α-helix	trans	-63	-45.9	177.2	-143.7	173.4	-9.1	0	0	111.9	I38 K40 H44 Q45 E46	I38-Q42 WeakPolarHBondContact O-CB 3.45Å; I38-Q42 PolarHBondContact O-N 3.36Å; K40-Q42 VanDerWaalsContact C-N 3.34Å; Q42-H44 VanDerWaalsContact C-N 3.32Å; Q42-H44 PolarHBondContact O-N 3.33Å; Q42-Q45 WeakPolarHBondContact O-CB 3.42Å; Q42-Q45 PolarHBondContact O-N 3.46Å; Q42-Q45 VanDerWaalsContact O-N 3.11Å; Q42-E46 WeakPolarHBondContact O-CG 3.22Å; Q42-E46 PolarHBondContact O-N 3.48Å
43	A	82.6	Confident	80.7	Confident	55 Å²	55	115 Å²	115	46%	0.455	55%	0.552	S	S	.	*	H	α-helix	trans	-63	-37	176	0	0	0	0	0	112.7	R39 K40 K47	R39-A43 PolarHBondContact O-N 2.92Å; R39-A43 VanDerWaalsContact O-N 3.07Å; K40-A43 PolarHBondContact O-N 3.47Å; A43-K47 PolarHBondContact O-N 2.83Å
44	H	83.5	Confident	82.4	Confident	135 Å²	135	118.9 Å²	118.9	63%	0.625	56%	0.56	S	S	*	*	H	α-helix	trans	-66.6	-40.3	172.2	-105.4	52.6	0	0	0	112	K40 M41 Q42 K47 L48	K40-H44 PolarHBondContact O-N 2.94Å; M41-H44 PolarHBondContact O-N 3.48Å; Q42-H44 VanDerWaalsContact C-N 3.32Å; Q42-H44 PolarHBondContact O-N 3.33Å; H44-K47 PolarHBondContact O-N 3.39Å; H44-L48 WeakPolarHBondContact O-CB 3.15Å; H44-L48 PolarHBondContact O-N 3.07Å
45	Q	85.1	Confident	84	Confident	104 Å²	104	119.2 Å²	119.2	49%	0.486	57%	0.565	S	S	.	*	H	α-helix	trans	-65.9	-42	-179	-149.1	175.5	-26.9	0	0	111.6	M41 Q42 L48 Q49	M41-Q45 WeakPolarHBondContact O-CB 3.27Å; M41-Q45 PolarHBondContact O-N 2.83Å; Q42-Q45 WeakPolarHBondContact O-CB 3.42Å; Q42-Q45 PolarHBondContact O-N 3.46Å; Q42-Q45 VanDerWaalsContact O-N 3.11Å; Q45-L48 PolarHBondContact O-N 2.98Å; Q45-Q49 WeakPolarHBondContact O-CB 2.9Å; Q45-Q49 WeakPolarHBondContact O-CG 3.25Å; Q45-Q49 PolarHBondContact O-N 3.36Å
46	E	87.4	Confident	85.3	Confident	125 Å²	125	118 Å²	118	58%	0.584	56%	0.559	S	S	*	*	H	α-helix	trans	-61.4	-44.7	174	-72.9	178.7	168.8	0	0	111.7	Q42 L48 Q49 L50	Q42-E46 WeakPolarHBondContact O-CG 3.22Å; Q42-E46 PolarHBondContact O-N 3.48Å; E46-L48 VanDerWaalsContact C-N 3.34Å; E46-L48 PolarHBondContact O-N 2.99Å; E46-Q49 PolarHBondContact O-N 2.86Å; E46-L50 PolarHBondContact O-N 3.33Å; E46-L50 VanDerWaalsContact O-N 3.09Å
47	K	88.9	Confident	86.5	Confident	131 Å²	131	119.6 Å²	119.6	57%	0.57	57%	0.566	S	S	*	*	H	α-helix	trans	-61.9	-43.4	175.7	-173	-177.2	174.1	-169.8	0	111.5	A43 H44 L50 E51	A43-K47 PolarHBondContact O-N 2.83Å; H44-K47 PolarHBondContact O-N 3.39Å; K47-L50 PolarHBondContact O-N 3.47Å; K47-E51 VanDerWaalsContact CE-OE1 3.25Å; K47-E51 WeakPolarHBondContact CE-OE1 3.45Å; K47-E51 IonicContact NZ-OE1 3.7Å; K47-E51 PolarHBondContact O-N 3.47Å; K47-E51 VanDerWaalsContact O-N 3.08Å
48	L	89.3	Confident	87.6	Confident	101 Å²	101	118.7 Å²	118.7	53%	0.529	56%	0.56	S	S	.	*	H	α-helix	trans	-64.1	-41.4	179.9	-140.8	90.9	0	0	0	111.7	H44 Q45 E46 E51 Q52	H44-L48 WeakPolarHBondContact O-CB 3.15Å; H44-L48 PolarHBondContact O-N 3.07Å; Q45-L48 PolarHBondContact O-N 2.98Å; E46-L48 VanDerWaalsContact C-N 3.34Å; E46-L48 PolarHBondContact O-N 2.99Å; L48-E51 PolarHBondContact O-N 3.43Å; L48-Q52 WeakPolarHBondContact O-CB 2.9Å; L48-Q52 WeakPolarHBondContact O-CG 3.41Å; L48-Q52 PolarHBondContact O-N 3.43Å
49	Q	90.6	Very high	88.4	Confident	116 Å²	116	118.2 Å²	118.2	54%	0.542	56%	0.561	S	S	.	*	H	α-helix	trans	-64.3	-40.7	177.8	-77.9	-177.7	-12.2	0	0	111.9	Q45 E46 Q52 L53	Q45-Q49 WeakPolarHBondContact O-CB 2.9Å; Q45-Q49 WeakPolarHBondContact O-CG 3.25Å; Q45-Q49 PolarHBondContact O-N 3.36Å; E46-Q49 PolarHBondContact O-N 2.86Å; Q49-Q52 PolarHBondContact O-N 3Å; Q49-L53 WeakPolarHBondContact O-CB 3.39Å; Q49-L53 PolarHBondContact O-N 3.29Å
50	L	91	Very high	89	Confident	134 Å²	134	111.6 Å²	111.6	70%	0.702	55%	0.549	S	S	*	.	H	α-helix	trans	-66.2	-41.3	177.8	-162.8	110.5	0	0	0	111.8	E46 K47 R54	E46-L50 PolarHBondContact O-N 3.33Å; E46-L50 VanDerWaalsContact O-N 3.09Å; K47-L50 PolarHBondContact O-N 3.47Å; L50-R54 PolarHBondContact O-N 2.8Å; L50-R54 VanDerWaalsContact O-N 3.16Å
51	E	90.6	Very high	89.7	Confident	95 Å²	95	113.3 Å²	113.3	44%	0.444	55%	0.552	S	S	.	*	H	α-helix	trans	-66	-42	174.7	-73.8	-174.6	-174.7	0	0	111.6	K47 L48 L53 R54 L55	K47-E51 VanDerWaalsContact CE-OE1 3.25Å; K47-E51 WeakPolarHBondContact CE-OE1 3.45Å; K47-E51 IonicContact NZ-OE1 3.7Å; K47-E51 PolarHBondContact O-N 3.47Å; K47-E51 VanDerWaalsContact O-N 3.08Å; L48-E51 PolarHBondContact O-N 3.43Å; E51-L53 PolarHBondContact O-N 2.96Å; E51-R54 PolarHBondContact O-N 3.29Å; E51-L55 VanDerWaalsContact O-CD1 3.27Å; E51-L55 WeakPolarHBondContact O-CD1 3.34Å; E51-L55 PolarHBondContact O-N 2.75Å
52	Q	89.4	Confident	90.2	Very high	113 Å²	113	112.2 Å²	112.2	53%	0.528	55%	0.548	S	S	.	.	H	α-helix	trans	-58.1	-46.8	174.8	-83.5	-168.5	-18.5	0	0	112.2	L48 Q49 R54 L55 E56	L48-Q52 WeakPolarHBondContact O-CB 2.9Å; L48-Q52 WeakPolarHBondContact O-CG 3.41Å; L48-Q52 PolarHBondContact O-N 3.43Å; Q49-Q52 PolarHBondContact O-N 3Å; Q52-R54 VanDerWaalsContact C-N 3.29Å; Q52-R54 PolarHBondContact O-N 3.45Å; Q52-L55 PolarHBondContact O-N 3.15Å; Q52-L55 VanDerWaalsContact O-N 3.17Å; Q52-E56 WeakPolarHBondContact O-CG 3.47Å; Q52-E56 PolarHBondContact O-N 3.03Å
53	L	91.9	Very high	90.7	Very high	116 Å²	116	109.5 Å²	109.5	61%	0.607	55%	0.545	S	S	*	.	H	α-helix	trans	-63.6	-38.1	-178.5	-163.6	142.9	0	0	0	111.6	Q49 E51 E56 E57	Q49-L53 WeakPolarHBondContact O-CB 3.39Å; Q49-L53 PolarHBondContact O-N 3.29Å; E51-L53 PolarHBondContact O-N 2.96Å; L53-E56 PolarHBondContact O-N 3.03Å; L53-E57 PolarHBondContact O-N 3.32Å
54	R	93.3	Very high	91.2	Very high	164 Å²	164	109.6 Å²	109.6	62%	0.619	55%	0.545	S	S	*	.	H	α-helix	trans	-65.7	-43.7	173.4	-175	-177.4	177.6	137.8	2.6	112.3	L50 E51 Q52 E56 E57 E58	L50-R54 PolarHBondContact O-N 2.8Å; L50-R54 VanDerWaalsContact O-N 3.16Å; E51-R54 PolarHBondContact O-N 3.29Å; Q52-R54 VanDerWaalsContact C-N 3.29Å; Q52-R54 PolarHBondContact O-N 3.45Å; R54-E56 VanDerWaalsContact C-N 3.34Å; R54-E57 PolarHBondContact O-N 2.98Å; R54-E58 IonicContact CZ-OE1 3.86Å; R54-E58 IonicContact NE-OE1 2.68Å; R54-E58 PolarHBondContact NE-OE1 2.8Å; R54-E58 IonicContact NH2-OE1 3.78Å; R54-E58 WeakPolarHBondContact O-CG 3.16Å; R54-E58 PolarHBondContact O-N 3.33Å
55	L	94.3	Very high	91.6	Very high	104 Å²	104	109.2 Å²	109.2	55%	0.545	54%	0.544	S	S	.	.	H	α-helix	trans	-62.9	-41.8	176.5	-95.6	120.7	0	0	0	111.4	E51 Q52 E57 E58 V59	E51-L55 VanDerWaalsContact O-CD1 3.27Å; E51-L55 WeakPolarHBondContact O-CD1 3.34Å; E51-L55 PolarHBondContact O-N 2.75Å; Q52-L55 PolarHBondContact O-N 3.15Å; Q52-L55 VanDerWaalsContact O-N 3.17Å; L55-E57 VanDerWaalsContact C-N 3.33Å; L55-E57 PolarHBondContact O-N 3.45Å; L55-E58 PolarHBondContact O-N 2.89Å; L55-V59 WeakPolarHBondContact O-CB 3.43Å; L55-V59 VanDerWaalsContact O-CG2 3.23Å; L55-V59 WeakPolarHBondContact O-CG2 3.43Å; L55-V59 PolarHBondContact O-N 3.35Å
56	E	93.1	Very high	91.9	Very high	134 Å²	134	111 Å²	111	63%	0.626	55%	0.55	S	S	*	*	H	α-helix	trans	-61	-41.9	175.5	-78	-177.3	170.3	0	0	111.7	Q52 L53 R54 V59 A60	Q52-E56 WeakPolarHBondContact O-CG 3.47Å; Q52-E56 PolarHBondContact O-N 3.03Å; L53-E56 PolarHBondContact O-N 3.03Å; R54-E56 VanDerWaalsContact C-N 3.34Å; E56-V59 PolarHBondContact O-N 3.46Å; E56-A60 VanDerWaalsContact O-CB 3.24Å; E56-A60 WeakPolarHBondContact O-CB 3.47Å; E56-A60 PolarHBondContact O-N 3.48Å
57	E	92.5	Very high	92	Very high	137 Å²	137	110.6 Å²	110.6	64%	0.64	55%	0.548	S	S	*	.	H	α-helix	trans	-64.1	-45.5	175.1	-172	-176.8	177.1	0	0	112	L53 R54 L55 V59 A60 R61	L53-E57 PolarHBondContact O-N 3.32Å; R54-E57 PolarHBondContact O-N 2.98Å; L55-E57 VanDerWaalsContact C-N 3.33Å; L55-E57 PolarHBondContact O-N 3.45Å; E57-V59 VanDerWaalsContact C-N 3.34Å; E57-V59 PolarHBondContact O-N 3.47Å; E57-A60 PolarHBondContact O-N 2.99Å; E57-R61 WeakPolarHBondContact O-CB 3.23Å; E57-R61 PolarHBondContact O-N 3.17Å
58	E	92.7	Very high	92.1	Very high	74 Å²	74	106.9 Å²	106.9	35%	0.346	54%	0.542	S	S	.	.	H	α-helix	trans	-63	-40.6	177.7	-73	178.2	-165.3	0	0	111.6	R54 L55 L62	R54-E58 IonicContact CZ-OE1 3.86Å; R54-E58 IonicContact NE-OE1 2.68Å; R54-E58 PolarHBondContact NE-OE1 2.8Å; R54-E58 IonicContact NH2-OE1 3.78Å; R54-E58 WeakPolarHBondContact O-CG 3.16Å; R54-E58 PolarHBondContact O-N 3.33Å; L55-E58 PolarHBondContact O-N 2.89Å; E58-L62 WeakPolarHBondContact O-CB 3.39Å; E58-L62 WeakPolarHBondContact O-CD1 3.48Å; E58-L62 VanDerWaalsContact O-CG 3.32Å; E58-L62 WeakPolarHBondContact O-CG 3.38Å; E58-L62 PolarHBondContact O-N 2.9Å
59	V	94.3	Very high	92.1	Very high	89 Å²	89	108.2 Å²	108.2	54%	0.539	55%	0.549	S	S	.	.	H	α-helix	trans	-68.1	-43.5	175.9	169.8	0	0	0	0	111.3	L55 E56 E57 R61 L62 A63	L55-V59 WeakPolarHBondContact O-CB 3.43Å; L55-V59 VanDerWaalsContact O-CG2 3.23Å; L55-V59 WeakPolarHBondContact O-CG2 3.43Å; L55-V59 PolarHBondContact O-N 3.35Å; E56-V59 PolarHBondContact O-N 3.46Å; E57-V59 VanDerWaalsContact C-N 3.34Å; E57-V59 PolarHBondContact O-N 3.47Å; V59-R61 VanDerWaalsContact C-N 3.3Å; V59-R61 PolarHBondContact O-N 3.28Å; V59-L62 PolarHBondContact O-N 2.86Å; V59-A63 VanDerWaalsContact O-CB 3.27Å; V59-A63 WeakPolarHBondContact O-CB 3.47Å; V59-A63 PolarHBondContact O-N 3.48Å
60	A	93.4	Very high	92.1	Very high	61 Å²	61	108.6 Å²	108.6	50%	0.504	55%	0.551	S	S	.	*	H	α-helix	trans	-61.3	-41.2	177.2	0	0	0	0	0	111.2	E56 E57 A63 A64	E56-A60 VanDerWaalsContact O-CB 3.24Å; E56-A60 WeakPolarHBondContact O-CB 3.47Å; E56-A60 PolarHBondContact O-N 3.48Å; E57-A60 PolarHBondContact O-N 2.99Å; A60-A63 PolarHBondContact O-N 2.84Å; A60-A64 WeakPolarHBondContact O-CB 3.31Å; A60-A64 PolarHBondContact O-N 2.81Å
61	R	93.3	Very high	91.9	Very high	163 Å²	163	107 Å²	107	62%	0.615	54%	0.54	S	S	*	.	H	α-helix	trans	-64.3	-46.9	175.3	-170.2	-178.3	72.4	-155.3	-2.1	111.9	E57 V59 A63 A64 E65	E57-R61 WeakPolarHBondContact O-CB 3.23Å; E57-R61 PolarHBondContact O-N 3.17Å; V59-R61 VanDerWaalsContact C-N 3.3Å; V59-R61 PolarHBondContact O-N 3.28Å; R61-A63 VanDerWaalsContact C-N 3.31Å; R61-A63 PolarHBondContact O-N 2.87Å; R61-A64 PolarHBondContact O-N 2.94Å; R61-E65 PolarHBondContact O-N 2.95Å
62	L	92.9	Very high	91.8	Very high	96 Å²	96	107 Å²	107	50%	0.503	55%	0.546	S	S	.	.	H	α-helix	trans	-63.8	-37.1	177.7	-77.5	164.2	0	0	0	112.1	E58 V59 K66	E58-L62 WeakPolarHBondContact O-CB 3.39Å; E58-L62 WeakPolarHBondContact O-CD1 3.48Å; E58-L62 VanDerWaalsContact O-CG 3.32Å; E58-L62 WeakPolarHBondContact O-CG 3.38Å; E58-L62 PolarHBondContact O-N 2.9Å; V59-L62 PolarHBondContact O-N 2.86Å; L62-K66 WeakPolarHBondContact O-CB 3.45Å; L62-K66 WeakPolarHBondContact O-CG 3.15Å; L62-K66 PolarHBondContact O-N 3.43Å
63	A	94.2	Very high	91.7	Very high	53 Å²	53	104.7 Å²	104.7	44%	0.438	55%	0.546	S	S	.	.	H	α-helix	trans	-64.3	-46.7	175.9	0	0	0	0	0	111.1	V59 A60 R61 E65 K66 E67	V59-A63 VanDerWaalsContact O-CB 3.27Å; V59-A63 WeakPolarHBondContact O-CB 3.47Å; V59-A63 PolarHBondContact O-N 3.48Å; A60-A63 PolarHBondContact O-N 2.84Å; R61-A63 VanDerWaalsContact C-N 3.31Å; R61-A63 PolarHBondContact O-N 2.87Å; A63-E65 PolarHBondContact O-N 3.26Å; A63-K66 PolarHBondContact O-N 3.44Å; A63-E67 WeakPolarHBondContact O-CB 3.47Å; A63-E67 PolarHBondContact O-N 2.9Å
64	A	92.9	Very high	91.4	Very high	56 Å²	56	105.8 Å²	105.8	46%	0.463	55%	0.548	S	S	.	.	H	α-helix	trans	-62.8	-40.8	176.7	0	0	0	0	0	112.5	A60 R61 E67 A68	A60-A64 WeakPolarHBondContact O-CB 3.31Å; A60-A64 PolarHBondContact O-N 2.81Å; R61-A64 PolarHBondContact O-N 2.94Å; A64-E67 PolarHBondContact O-N 3.16Å; A64-A68 WeakPolarHBondContact O-CB 3.4Å; A64-A68 PolarHBondContact O-N 2.95Å
65	E	92.4	Very high	90.9	Very high	127 Å²	127	104 Å²	104	59%	0.593	55%	0.547	S	S	*	.	H	α-helix	trans	-64.3	-42.4	176.1	-173.5	179.7	173.2	0	0	111.7	R61 A63 A68 L69	R61-E65 PolarHBondContact O-N 2.95Å; A63-E65 PolarHBondContact O-N 3.26Å; E65-A68 PolarHBondContact O-N 3.44Å; E65-L69 PolarHBondContact O-N 3.1Å
66	K	91.1	Very high	90.3	Very high	143 Å²	143	100.9 Å²	100.9	62%	0.622	54%	0.54	S	S	*	.	H	α-helix	trans	-64	-44.8	175.6	-83.1	-155.8	168.6	-148.9	0	112.7	L62 A63 A68 L69 E70	L62-K66 WeakPolarHBondContact O-CB 3.45Å; L62-K66 WeakPolarHBondContact O-CG 3.15Å; L62-K66 PolarHBondContact O-N 3.43Å; A63-K66 PolarHBondContact O-N 3.44Å; K66-A68 VanDerWaalsContact C-N 3.32Å; K66-A68 PolarHBondContact O-N 2.95Å; K66-L69 WeakPolarHBondContact O-CB 3.49Å; K66-L69 PolarHBondContact O-N 3.15Å; K66-L69 VanDerWaalsContact O-N 3.17Å; K66-E70 WeakPolarHBondContact O-CG 3.32Å; K66-E70 PolarHBondContact O-N 3.48Å
67	E	90.3	Very high	89.9	Confident	116 Å²	116	102.6 Å²	102.6	54%	0.542	54%	0.541	S	S	.	.	H	α-helix	trans	-61.6	-42.4	178.9	-171.4	178.6	175.7	0	0	111.1	A63 A64 L69 E70 Q71	A63-E67 WeakPolarHBondContact O-CB 3.47Å; A63-E67 PolarHBondContact O-N 2.9Å; A64-E67 PolarHBondContact O-N 3.16Å; E67-L69 VanDerWaalsContact C-N 3.34Å; E67-L69 PolarHBondContact O-N 3.28Å; E67-E70 PolarHBondContact O-N 3.39Å; E67-Q71 WeakPolarHBondContact O-CG 3.35Å; E67-Q71 PolarHBondContact O-N 3.49Å
68	A	90.2	Very high	89.3	Confident	52 Å²	52	102.2 Å²	102.2	43%	0.43	54%	0.539	S	S	.	.	H	α-helix	trans	-62	-40.7	174.2	0	0	0	0	0	112.2	A64 E65 K66 V72	A64-A68 WeakPolarHBondContact O-CB 3.4Å; A64-A68 PolarHBondContact O-N 2.95Å; E65-A68 PolarHBondContact O-N 3.44Å; K66-A68 VanDerWaalsContact C-N 3.32Å; K66-A68 PolarHBondContact O-N 2.95Å; A68-V72 WeakPolarHBondContact O-CG2 3.27Å; A68-V72 PolarHBondContact O-N 2.87Å; A68-V72 VanDerWaalsContact O-N 3.15Å
69	L	90.7	Very high	88.8	Confident	129 Å²	129	105.7 Å²	105.7	68%	0.675	56%	0.555	S	S	*	*	H	α-helix	trans	-65.6	-40.9	177	-162.8	94	0	0	0	111.9	E65 K66 E67 V72 A73	E65-L69 PolarHBondContact O-N 3.1Å; K66-L69 WeakPolarHBondContact O-CB 3.49Å; K66-L69 PolarHBondContact O-N 3.15Å; K66-L69 VanDerWaalsContact O-N 3.17Å; E67-L69 VanDerWaalsContact C-N 3.34Å; E67-L69 PolarHBondContact O-N 3.28Å; L69-V72 PolarHBondContact O-N 2.89Å; L69-A73 WeakPolarHBondContact O-CB 3.49Å; L69-A73 PolarHBondContact O-N 3.35Å
70	E	89.1	Confident	88.4	Confident	125 Å²	125	106.3 Å²	106.3	58%	0.584	56%	0.555	S	S	*	*	H	α-helix	trans	-64.9	-43.6	177.8	-76.5	179.4	175.9	0	0	111.5	K66 E67 V72 A73 E74	K66-E70 WeakPolarHBondContact O-CG 3.32Å; K66-E70 PolarHBondContact O-N 3.48Å; E67-E70 PolarHBondContact O-N 3.39Å; E70-V72 PolarHBondContact O-N 3.31Å; E70-A73 WeakPolarHBondContact O-CB 3.34Å; E70-A73 PolarHBondContact O-N 3.14Å; E70-A73 VanDerWaalsContact O-N 3.15Å; E70-E74 WeakPolarHBondContact O-CG 3.14Å; E70-E74 PolarHBondContact O-N 3.45Å
71	Q	87.9	Confident	88.1	Confident	100 Å²	100	108.5 Å²	108.5	47%	0.467	56%	0.555	S	S	.	*	H	α-helix	trans	-58.8	-46	174.9	-72.9	177.2	14.1	0	0	111.9	E67 A73 E74 E75	E67-Q71 WeakPolarHBondContact O-CG 3.35Å; E67-Q71 PolarHBondContact O-N 3.49Å; Q71-A73 VanDerWaalsContact C-N 3.3Å; Q71-A73 PolarHBondContact O-N 3.42Å; Q71-E74 PolarHBondContact O-N 3.46Å; Q71-E75 WeakPolarHBondContact O-CB 3.46Å; Q71-E75 WeakPolarHBondContact O-CG 3.44Å; Q71-E75 PolarHBondContact O-N 2.97Å
72	V	87.9	Confident	87.8	Confident	96 Å²	96	104 Å²	104	58%	0.582	55%	0.546	S	S	*	.	H	α-helix	trans	-63.1	-37.8	177	173	0	0	0	0	111.5	A68 L69 E70 G76	A68-V72 WeakPolarHBondContact O-CG2 3.27Å; A68-V72 PolarHBondContact O-N 2.87Å; A68-V72 VanDerWaalsContact O-N 3.15Å; L69-V72 PolarHBondContact O-N 2.89Å; E70-V72 PolarHBondContact O-N 3.31Å; V72-G76 PolarHBondContact O-N 3.42Å
73	A	88.3	Confident	87.6	Confident	63 Å²	63	107.5 Å²	107.5	52%	0.521	55%	0.552	S	S	.	*	H	α-helix	trans	-67.7	-40.6	177	0	0	0	0	0	112.2	L69 E70 Q71 G76 R77	L69-A73 WeakPolarHBondContact O-CB 3.49Å; L69-A73 PolarHBondContact O-N 3.35Å; E70-A73 WeakPolarHBondContact O-CB 3.34Å; E70-A73 PolarHBondContact O-N 3.14Å; E70-A73 VanDerWaalsContact O-N 3.15Å; Q71-A73 VanDerWaalsContact C-N 3.3Å; Q71-A73 PolarHBondContact O-N 3.42Å; A73-G76 PolarHBondContact O-N 3.15Å; A73-R77 WeakPolarHBondContact O-CB 3.49Å; A73-R77 PolarHBondContact O-N 3.5Å
74	E	85.1	Confident	87.5	Confident	139 Å²	139	108.5 Å²	108.5	65%	0.65	55%	0.553	S	S	*	*	H	α-helix	trans	-66	-45.8	175.6	-74.9	-171.4	165.5	0	0	111.9	E70 Q71 G76 R77 Q78	E70-E74 WeakPolarHBondContact O-CG 3.14Å; E70-E74 PolarHBondContact O-N 3.45Å; Q71-E74 PolarHBondContact O-N 3.46Å; E74-G76 VanDerWaalsContact C-N 3.33Å; E74-G76 PolarHBondContact O-N 3.09Å; E74-R77 WeakPolarHBondContact O-CB 3.43Å; E74-R77 PolarHBondContact O-N 3Å; E74-R77 VanDerWaalsContact O-N 3.16Å; E74-Q78 WeakPolarHBondContact O-CB 3.34Å; E74-Q78 PolarHBondContact O-N 2.9Å
75	E	82.8	Confident	87.4	Confident	127 Å²	127	107.6 Å²	107.6	59%	0.593	55%	0.546	S	S	*	.	H	α-helix	trans	-59.3	-44.8	174.7	-73.9	-179.7	177.6	0	0	111.4	Q71 R77 Q78 Q79	Q71-E75 WeakPolarHBondContact O-CB 3.46Å; Q71-E75 WeakPolarHBondContact O-CG 3.44Å; Q71-E75 PolarHBondContact O-N 2.97Å; E75-R77 VanDerWaalsContact C-N 3.31Å; E75-R77 PolarHBondContact O-N 3.28Å; E75-Q78 PolarHBondContact O-N 2.92Å; E75-Q79 WeakPolarHBondContact O-CB 3.49Å; E75-Q79 PolarHBondContact O-N 3.32Å
76	G	82.2	Confident	87.5	Confident	39 Å²	39	110.2 Å²	110.2	40%	0.402	55%	0.55	S	S	.	*	H	α-helix	trans	-61.5	-38.3	175.9	0	0	0	0	0	112.6	V72 A73 E74 N80	V72-G76 PolarHBondContact O-N 3.42Å; A73-G76 PolarHBondContact O-N 3.15Å; E74-G76 VanDerWaalsContact C-N 3.33Å; E74-G76 PolarHBondContact O-N 3.09Å; G76-N80 WeakPolarHBondContact O-CB 3.47Å; G76-N80 PolarHBondContact O-N 3.4Å; G76-N80 VanDerWaalsContact O-N 3.09Å
77	R	83.8	Confident	87.6	Confident	170 Å²	170	107.7 Å²	107.7	64%	0.642	54%	0.543	S	S	*	.	H	α-helix	trans	-67.9	-45.4	175.7	-176.1	179.3	177.2	164.5	3.7	111.8	A73 E74 E75 Q79 N80 E81	A73-R77 WeakPolarHBondContact O-CB 3.49Å; A73-R77 PolarHBondContact O-N 3.5Å; E74-R77 WeakPolarHBondContact O-CB 3.43Å; E74-R77 PolarHBondContact O-N 3Å; E74-R77 VanDerWaalsContact O-N 3.16Å; E75-R77 VanDerWaalsContact C-N 3.31Å; E75-R77 PolarHBondContact O-N 3.28Å; R77-Q79 VanDerWaalsContact C-N 3.33Å; R77-Q79 PolarHBondContact O-N 3.16Å; R77-N80 PolarHBondContact O-N 3.43Å; R77-N80 VanDerWaalsContact O-N 3.15Å; R77-E81 IonicContact CZ-OE1 3.96Å; R77-E81 IonicContact NE-OE1 3.02Å; R77-E81 PolarHBondContact NE-OE1 2.88Å; R77-E81 IonicContact NH2-OE1 3.46Å; R77-E81 WeakPolarHBondContact O-CG 3.46Å; R77-E81 PolarHBondContact O-N 3.45Å
78	Q	80.2	Confident	87.8	Confident	129 Å²	129	107.7 Å²	107.7	60%	0.603	55%	0.546	S	S	*	.	H	α-helix	trans	-65.1	-37.5	179.6	-166.2	172.2	11.3	0	0	111.8	E74 E75 N80 E81 T82	E74-Q78 WeakPolarHBondContact O-CB 3.34Å; E74-Q78 PolarHBondContact O-N 2.9Å; E75-Q78 PolarHBondContact O-N 2.92Å; Q78-N80 VanDerWaalsContact C-N 3.34Å; Q78-E81 PolarHBondContact O-N 2.9Å; Q78-T82 WeakPolarHBondContact O-CG2 3.45Å; Q78-T82 PolarHBondContact O-N 3.44Å; Q78-T82 PolarHBondContact O-OG1 3.43Å
79	Q	82.5	Confident	88.1	Confident	146 Å²	146	113.1 Å²	113.1	68%	0.682	56%	0.556	S	S	*	*	H	α-helix	trans	-64.7	-38.8	172.7	-169	-174.3	91.8	0	0	111.8	E75 R77 T82 R83	E75-Q79 WeakPolarHBondContact O-CB 3.49Å; E75-Q79 PolarHBondContact O-N 3.32Å; R77-Q79 VanDerWaalsContact C-N 3.33Å; R77-Q79 PolarHBondContact O-N 3.16Å; Q79-T82 WeakPolarHBondContact CA-OG1 3.32Å; Q79-T82 PolarHBondContact O-OG1 3.25Å; Q79-R83 WeakPolarHBondContact O-CB 3.42Å; Q79-R83 PolarHBondContact O-N 3.06Å
80	N	86	Confident	88.3	Confident	102 Å²	102	110 Å²	110	55%	0.545	55%	0.545	S	S	.	.	H	α-helix	trans	-68.6	-43.9	177.3	-165.3	13.5	0	0	0	111.8	G76 R77 Q78 T82 R83 V84	G76-N80 WeakPolarHBondContact O-CB 3.47Å; G76-N80 PolarHBondContact O-N 3.4Å; G76-N80 VanDerWaalsContact O-N 3.09Å; R77-N80 PolarHBondContact O-N 3.43Å; R77-N80 VanDerWaalsContact O-N 3.15Å; Q78-N80 VanDerWaalsContact C-N 3.34Å; N80-T82 PolarHBondContact O-N 2.89Å; N80-R83 PolarHBondContact O-N 3.3Å; N80-V84 WeakPolarHBondContact O-CG2 3.34Å; N80-V84 PolarHBondContact O-N 2.96Å
81	E	86.5	Confident	88.7	Confident	108 Å²	108	107.9 Å²	107.9	51%	0.505	54%	0.54	S	S	.	.	H	α-helix	trans	-61.5	-42.7	176.8	-72.8	175.4	-174.9	0	0	112	R77 Q78 V84 A85	R77-E81 IonicContact CZ-OE1 3.96Å; R77-E81 IonicContact NE-OE1 3.02Å; R77-E81 PolarHBondContact NE-OE1 2.88Å; R77-E81 IonicContact NH2-OE1 3.46Å; R77-E81 WeakPolarHBondContact O-CG 3.46Å; R77-E81 PolarHBondContact O-N 3.45Å; Q78-E81 PolarHBondContact O-N 2.9Å; E81-V84 PolarHBondContact O-N 3.5Å; E81-A85 WeakPolarHBondContact O-CB 3.4Å; E81-A85 PolarHBondContact O-N 2.87Å
82	T	87.4	Confident	89.1	Confident	69 Å²	69	107 Å²	107	42%	0.423	54%	0.538	S	S	.	.	H	α-helix	trans	-64.7	-41.9	175	47.3	0	0	0	0	111.9	Q78 Q79 N80 A85 W86	Q78-T82 WeakPolarHBondContact O-CG2 3.45Å; Q78-T82 PolarHBondContact O-N 3.44Å; Q78-T82 PolarHBondContact O-OG1 3.43Å; Q79-T82 WeakPolarHBondContact CA-OG1 3.32Å; Q79-T82 PolarHBondContact O-OG1 3.25Å; N80-T82 PolarHBondContact O-N 2.89Å; T82-A85 PolarHBondContact O-N 2.93Å; T82-W86 PolarHBondContact O-N 3.22Å
83	R	88.9	Confident	89.5	Confident	168 Å²	168	105.5 Å²	105.5	63%	0.634	53%	0.532	S	S	*	.	H	α-helix	trans	-61.3	-46	175.6	-174.4	175.1	178.3	175.6	0.2	112.1	Q79 N80 A85 W86 D87	Q79-R83 WeakPolarHBondContact O-CB 3.42Å; Q79-R83 PolarHBondContact O-N 3.06Å; N80-R83 PolarHBondContact O-N 3.3Å; R83-A85 VanDerWaalsContact C-N 3.32Å; R83-A85 PolarHBondContact O-N 2.94Å; R83-W86 PolarHBondContact O-N 3.46Å; R83-D87 PolarHBondContact O-N 2.99Å
84	V	91.1	Very high	89.8	Confident	74 Å²	74	108.9 Å²	108.9	45%	0.448	54%	0.538	S	S	.	.	H	α-helix	trans	-60.9	-42.3	176.3	170.3	0	0	0	0	111.1	N80 E81 D87 L88	N80-V84 WeakPolarHBondContact O-CG2 3.34Å; N80-V84 PolarHBondContact O-N 2.96Å; E81-V84 PolarHBondContact O-N 3.5Å; V84-D87 PolarHBondContact O-N 3.32Å; V84-L88 HydrophobicContact CG1-CD1 3.82Å; V84-L88 WeakPolarHBondContact O-CB 3.4Å; V84-L88 WeakPolarHBondContact O-CD1 3.4Å; V84-L88 WeakPolarHBondContact O-CG 3.44Å; V84-L88 PolarHBondContact O-N 2.98Å
85	A	91.9	Very high	90.4	Very high	38 Å²	38	106.6 Å²	106.6	31%	0.314	53%	0.53	S	S	.	.	H	α-helix	trans	-61.6	-44.9	175.3	0	0	0	0	0	111.8	E81 T82 R83 D87 L88 W89	E81-A85 WeakPolarHBondContact O-CB 3.4Å; E81-A85 PolarHBondContact O-N 2.87Å; T82-A85 PolarHBondContact O-N 2.93Å; R83-A85 VanDerWaalsContact C-N 3.32Å; R83-A85 PolarHBondContact O-N 2.94Å; A85-D87 PolarHBondContact O-N 2.74Å; A85-L88 WeakPolarHBondContact O-CB 3.45Å; A85-L88 PolarHBondContact O-N 2.9Å; A85-W89 PolarHBondContact O-N 3.47Å
86	W	93.2	Very high	91	Very high	182 Å²	182	105.1 Å²	105.1	69%	0.689	53%	0.525	S	S	*	.	H	α-helix	trans	-61.6	-41.6	176.3	-85.9	108.7	0	0	0	112.9	T82 R83 W89 S90	T82-W86 PolarHBondContact O-N 3.22Å; R83-W86 PolarHBondContact O-N 3.46Å; W86-W89 PolarHBondContact O-N 2.88Å; W86-S90 VanDerWaalsContact O-CB 3.3Å; W86-S90 WeakPolarHBondContact O-CB 3.43Å; W86-S90 PolarHBondContact O-N 3.43Å; W86-S90 PolarHBondContact O-OG 2.91Å
87	D	93.6	Very high	91.6	Very high	90 Å²	90	109.7 Å²	109.7	48%	0.481	53%	0.534	S	S	.	.	H	α-helix	trans	-64.8	-41.3	176.9	-71.9	-19.3	0	0	0	111.1	R83 V84 A85 S90 T91	R83-D87 PolarHBondContact O-N 2.99Å; V84-D87 PolarHBondContact O-N 3.32Å; A85-D87 PolarHBondContact O-N 2.74Å; D87-S90 PolarHBondContact O-N 2.92Å; D87-T91 WeakPolarHBondContact O-CB 3.3Å; D87-T91 PolarHBondContact O-N 2.98Å; D87-T91 PolarHBondContact O-OG1 3.34Å
88	L	95.3	Very high	92.1	Very high	115 Å²	115	107.1 Å²	107.1	60%	0.602	53%	0.533	S	S	*	.	H	α-helix	trans	-61.8	-48.6	174.4	-81.9	156	0	0	0	112	V84 A85 S90 T91 L92	V84-L88 HydrophobicContact CG1-CD1 3.82Å; V84-L88 WeakPolarHBondContact O-CB 3.4Å; V84-L88 WeakPolarHBondContact O-CD1 3.4Å; V84-L88 WeakPolarHBondContact O-CG 3.44Å; V84-L88 PolarHBondContact O-N 2.98Å; A85-L88 WeakPolarHBondContact O-CB 3.45Å; A85-L88 PolarHBondContact O-N 2.9Å; L88-S90 VanDerWaalsContact C-N 3.33Å; L88-S90 PolarHBondContact O-N 3.5Å; L88-T91 PolarHBondContact O-N 3.21Å; L88-L92 WeakPolarHBondContact O-CB 3.49Å; L88-L92 PolarHBondContact O-N 3.42Å
89	W	96.4	Very high	92.7	Very high	167 Å²	167	105.8 Å²	105.8	63%	0.633	53%	0.528	S	S	*	.	H	α-helix	trans	-61.8	-42.1	177.1	-75.1	118.8	0	0	0	111.7	A85 W86 L92 C93	A85-W89 PolarHBondContact O-N 3.47Å; W86-W89 PolarHBondContact O-N 2.88Å; W89-L92 HydrophobicContact CE3-CD2 3.98Å; W89-L92 HydrophobicContact CZ3-CD2 3.86Å; W89-L92 PolarHBondContact O-N 2.72Å; W89-C93 PolarHBondContact O-N 3.47Å; W89-C93 PolarHBondContact O-SG 3.32Å
90	S	94.7	Very high	93.2	Very high	63 Å²	63	103.9 Å²	103.9	44%	0.441	52%	0.521	S	S	.	.	H	α-helix	trans	-63.6	-42.6	177.4	-58.6	0	0	0	0	111.7	W86 D87 L88 C93 M94	W86-S90 VanDerWaalsContact O-CB 3.3Å; W86-S90 WeakPolarHBondContact O-CB 3.43Å; W86-S90 PolarHBondContact O-N 3.43Å; W86-S90 PolarHBondContact O-OG 2.91Å; D87-S90 PolarHBondContact O-N 2.92Å; L88-S90 VanDerWaalsContact C-N 3.33Å; L88-S90 PolarHBondContact O-N 3.5Å; S90-C93 PolarHBondContact O-N 3.38Å; S90-M94 WeakPolarHBondContact O-CG 3.49Å; S90-M94 PolarHBondContact O-N 3.32Å
91	T	96.6	Very high	93.3	Very high	80 Å²	80	102.5 Å²	102.5	49%	0.491	51%	0.511	S	S	.	.	H	α-helix	trans	-63.5	-43.8	176.1	-53.7	0	0	0	0	111	D87 L88 C93 M94 I95	D87-T91 WeakPolarHBondContact O-CB 3.3Å; D87-T91 PolarHBondContact O-N 2.98Å; D87-T91 PolarHBondContact O-OG1 3.34Å; L88-T91 PolarHBondContact O-N 3.21Å; T91-C93 VanDerWaalsContact C-N 3.34Å; T91-C93 PolarHBondContact O-N 3.29Å; T91-M94 WeakPolarHBondContact O-CB 3.33Å; T91-M94 PolarHBondContact O-N 3.32Å; T91-I95 HydrophobicContact CG2-CD1 4.1Å; T91-I95 VanDerWaalsContact O-CG1 3.31Å; T91-I95 WeakPolarHBondContact O-CG1 3.38Å; T91-I95 PolarHBondContact O-N 3.5Å
92	L	96.8	Very high	93.4	Very high	81 Å²	81	101.3 Å²	101.3	42%	0.424	51%	0.511	S	S	.	.	H	α-helix	trans	-61.4	-42.5	176.6	-174.9	66.7	0	0	0	111.6	L88 W89 I95 L96	L88-L92 WeakPolarHBondContact O-CB 3.49Å; L88-L92 PolarHBondContact O-N 3.42Å; W89-L92 HydrophobicContact CE3-CD2 3.98Å; W89-L92 HydrophobicContact CZ3-CD2 3.86Å; W89-L92 PolarHBondContact O-N 2.72Å; L92-I95 PolarHBondContact O-N 2.95Å; L92-L96 HydrophobicContact CG-CD1 4.34Å; L92-L96 WeakPolarHBondContact O-CG 3.45Å; L92-L96 PolarHBondContact O-N 3.3Å
93	C	95.7	Very high	93.5	Very high	66 Å²	66	106.2 Å²	106.2	45%	0.446	52%	0.522	S	S	.	.	H	α-helix	trans	-60.8	-44.1	174.2	-71.6	0	0	0	0	111.8	W89 S90 T91 I95 L96 F97	W89-C93 PolarHBondContact O-N 3.47Å; W89-C93 PolarHBondContact O-SG 3.32Å; S90-C93 PolarHBondContact O-N 3.38Å; T91-C93 VanDerWaalsContact C-N 3.34Å; T91-C93 PolarHBondContact O-N 3.29Å; C93-I95 PolarHBondContact O-N 2.93Å; C93-L96 PolarHBondContact O-N 3.46Å; C93-F97 WeakPolarHBondContact O-CD2 3.31Å; C93-F97 PolarHBondContact O-N 2.93Å
94	M	95.9	Very high	93.1	Very high	133 Å²	133	104 Å²	104	66%	0.655	51%	0.514	S	S	*	.	H	α-helix	trans	-60.2	-44.4	175.9	-74.8	-65.7	-167.3	0	0	112	S90 T91 L96 F97 L98	S90-M94 WeakPolarHBondContact O-CG 3.49Å; S90-M94 PolarHBondContact O-N 3.32Å; T91-M94 WeakPolarHBondContact O-CB 3.33Å; T91-M94 PolarHBondContact O-N 3.32Å; M94-L96 PolarHBondContact O-N 2.96Å; M94-F97 PolarHBondContact O-N 3.46Å; M94-L98 WeakPolarHBondContact O-CG 3.45Å; M94-L98 PolarHBondContact O-N 3.47Å
95	I	96.6	Very high	92.5	Very high	91 Å²	91	105.8 Å²	105.8	47%	0.467	52%	0.517	S	S	.	.	H	α-helix	trans	-62.1	-44.6	177.3	-66.3	166.5	0	0	0	110.8	T91 L92 C93 F97 L98 M99	T91-I95 HydrophobicContact CG2-CD1 4.1Å; T91-I95 VanDerWaalsContact O-CG1 3.31Å; T91-I95 WeakPolarHBondContact O-CG1 3.38Å; T91-I95 PolarHBondContact O-N 3.5Å; L92-I95 PolarHBondContact O-N 2.95Å; C93-I95 PolarHBondContact O-N 2.93Å; I95-F97 PolarHBondContact O-N 3.11Å; I95-L98 PolarHBondContact O-N 3.3Å; I95-M99 HydrophobicContact CG2-CG 4.43Å; I95-M99 WeakPolarHBondContact O-CG 3.47Å; I95-M99 PolarHBondContact O-N 3.22Å
96	L	96.6	Very high	91.8	Very high	96 Å²	96	109.6 Å²	109.6	50%	0.503	53%	0.532	S	S	.	.	H	α-helix	trans	-61.1	-43.9	177.2	-76	169.2	0	0	0	111.8	L92 C93 M94 M99 I100	L92-L96 HydrophobicContact CG-CD1 4.34Å; L92-L96 WeakPolarHBondContact O-CG 3.45Å; L92-L96 PolarHBondContact O-N 3.3Å; C93-L96 PolarHBondContact O-N 3.46Å; M94-L96 PolarHBondContact O-N 2.96Å; L96-M99 PolarHBondContact O-N 2.68Å; L96-I100 VanDerWaalsContact O-CG1 3.25Å; L96-I100 WeakPolarHBondContact O-CG1 3.35Å; L96-I100 PolarHBondContact O-N 3.49Å
97	F	94.3	Very high	90.7	Very high	136 Å²	136	108.5 Å²	108.5	60%	0.596	53%	0.534	S	S	*	.	H	α-helix	trans	-61.2	-44.5	174.8	-91.9	-71.6	0	0	0	112.2	C93 M94 I95 M99 I100 E101	C93-F97 WeakPolarHBondContact O-CD2 3.31Å; C93-F97 PolarHBondContact O-N 2.93Å; M94-F97 PolarHBondContact O-N 3.46Å; I95-F97 PolarHBondContact O-N 3.11Å; F97-M99 VanDerWaalsContact C-N 3.34Å; F97-M99 PolarHBondContact O-N 2.83Å; F97-I100 PolarHBondContact O-N 2.91Å; F97-E101 WeakPolarHBondContact O-CB 3.25Å; F97-E101 WeakPolarHBondContact O-CG 3.24Å; F97-E101 PolarHBondContact O-N 3.47Å
98	L	94.5	Very high	89.3	Confident	116 Å²	116	110.9 Å²	110.9	61%	0.607	54%	0.543	S	S	*	.	H	α-helix	trans	-61.7	-42.5	176.4	-72.6	172.6	0	0	0	111.7	M94 I95 I100 E101 V102	M94-L98 WeakPolarHBondContact O-CG 3.45Å; M94-L98 PolarHBondContact O-N 3.47Å; I95-L98 PolarHBondContact O-N 3.3Å; L98-I100 VanDerWaalsContact C-N 3.34Å; L98-I100 PolarHBondContact O-N 3.28Å; L98-E101 PolarHBondContact O-N 3.49Å; L98-V102 WeakPolarHBondContact O-CB 3.39Å; L98-V102 VanDerWaalsContact O-CG2 3.24Å; L98-V102 WeakPolarHBondContact O-CG2 3.37Å; L98-V102 PolarHBondContact O-N 2.84Å
99	M	92.6	Very high	87.6	Confident	100 Å²	100	113.2 Å²	113.2	49%	0.493	55%	0.551	S	S	.	*	H	α-helix	trans	-60.6	-45.5	174.5	-72.7	-68.1	-71.3	0	0	110.8	I95 L96 F97 E101 V102 W103	I95-M99 HydrophobicContact CG2-CG 4.43Å; I95-M99 WeakPolarHBondContact O-CG 3.47Å; I95-M99 PolarHBondContact O-N 3.22Å; L96-M99 PolarHBondContact O-N 2.68Å; F97-M99 VanDerWaalsContact C-N 3.34Å; F97-M99 PolarHBondContact O-N 2.83Å; M99-E101 PolarHBondContact O-N 3.33Å; M99-V102 PolarHBondContact O-N 3.39Å; M99-W103 WeakPolarHBondContact O-CB 3.3Å; M99-W103 PolarHBondContact O-N 2.87Å
100	I	91.8	Very high	85.8	Confident	106 Å²	106	107.3 Å²	107.3	54%	0.544	54%	0.542	S	S	.	.	H	α-helix	trans	-62.5	-42.4	177.2	-66.6	163	0	0	0	111.2	L96 F97 L98 W103 R104	L96-I100 VanDerWaalsContact O-CG1 3.25Å; L96-I100 WeakPolarHBondContact O-CG1 3.35Å; L96-I100 PolarHBondContact O-N 3.49Å; F97-I100 PolarHBondContact O-N 2.91Å; L98-I100 VanDerWaalsContact C-N 3.34Å; L98-I100 PolarHBondContact O-N 3.28Å; I100-W103 PolarHBondContact O-N 2.94Å; I100-R104 VanDerWaalsContact O-CB 3.22Å; I100-R104 WeakPolarHBondContact O-CB 3.5Å; I100-R104 PolarHBondContact O-N 3.43Å
101	E	89.1	Confident	84	Confident	73 Å²	73	110.3 Å²	110.3	34%	0.341	56%	0.56	S	S	.	*	H	α-helix	trans	-64.8	-43.4	177.4	-78.4	-65.4	154.2	0	0	112.2	F97 L98 M99 R104 Q105	F97-E101 WeakPolarHBondContact O-CB 3.25Å; F97-E101 WeakPolarHBondContact O-CG 3.24Å; F97-E101 PolarHBondContact O-N 3.47Å; L98-E101 PolarHBondContact O-N 3.49Å; M99-E101 PolarHBondContact O-N 3.33Å; E101-R104 WeakPolarHBondContact O-CB 3.22Å; E101-R104 PolarHBondContact O-N 3.26Å; E101-R104 IonicContact OE1-CZ 3.06Å; E101-R104 IonicContact OE1-NE 3.67Å; E101-R104 IonicContact OE1-NH2 3.26Å; E101-R104 PolarHBondContact OE1-NH2 2.88Å; E101-R104 IonicContact OE2-CZ 3.91Å; E101-R104 VanDerWaalsContact OE2-CZ 3.26Å; E101-R104 IonicContact OE2-NE 3.11Å; E101-R104 PolarHBondContact OE2-NE 3.32Å; E101-R104 VanDerWaalsContact OE2-NE 3.11Å; E101-R104 IonicContact OE2-NH2 3.89Å; E101-R104 PolarHBondContact OE2-NH2 3.31Å; E101-Q105 WeakPolarHBondContact O-CB 3.48Å; E101-Q105 WeakPolarHBondContact O-CG 3.37Å; E101-Q105 PolarHBondContact O-N 2.91Å
102	V	88.9	Confident	82	Confident	83 Å²	83	111.1 Å²	111.1	50%	0.503	57%	0.569	S	S	.	*	H	α-helix	trans	-62.2	-46.9	175.2	167.7	0	0	0	0	110.6	L98 M99 R104 Q105 D106	L98-V102 WeakPolarHBondContact O-CB 3.39Å; L98-V102 VanDerWaalsContact O-CG2 3.24Å; L98-V102 WeakPolarHBondContact O-CG2 3.37Å; L98-V102 PolarHBondContact O-N 2.84Å; M99-V102 PolarHBondContact O-N 3.39Å; V102-R104 VanDerWaalsContact C-N 3.3Å; V102-R104 PolarHBondContact O-N 2.81Å; V102-Q105 PolarHBondContact O-N 3.28Å; V102-D106 WeakPolarHBondContact O-CB 3.32Å; V102-D106 PolarHBondContact O-N 2.88Å
103	W	88.3	Confident	80	Confident	172 Å²	172	113.4 Å²	113.4	65%	0.652	59%	0.589	S	S	*	*	H	α-helix	trans	-63.2	-38	176.3	-81.4	60.1	0	0	0	111.6	M99 I100 H107	M99-W103 WeakPolarHBondContact O-CB 3.3Å; M99-W103 PolarHBondContact O-N 2.87Å; I100-W103 PolarHBondContact O-N 2.94Å; W103-H107 WeakPolarHBondContact O-CB 3.36Å; W103-H107 PolarHBondContact O-N 3.03Å
104	R	82.2	Confident	77.6	Confident	123 Å²	123	122.5 Å²	122.5	46%	0.464	62%	0.624	S	S	.	*	H	α-helix	trans	-65	-41.6	176.1	-175.8	-179	74.7	129.5	0.9	111.6	I100 E101 V102 Q108	I100-R104 VanDerWaalsContact O-CB 3.22Å; I100-R104 WeakPolarHBondContact O-CB 3.5Å; I100-R104 PolarHBondContact O-N 3.43Å; E101-R104 WeakPolarHBondContact O-CB 3.22Å; E101-R104 PolarHBondContact O-N 3.26Å; E101-R104 IonicContact OE1-CZ 3.06Å; E101-R104 IonicContact OE1-NE 3.67Å; E101-R104 IonicContact OE1-NH2 3.26Å; E101-R104 PolarHBondContact OE1-NH2 2.88Å; E101-R104 IonicContact OE2-CZ 3.91Å; E101-R104 VanDerWaalsContact OE2-CZ 3.26Å; E101-R104 IonicContact OE2-NE 3.11Å; E101-R104 PolarHBondContact OE2-NE 3.32Å; E101-R104 VanDerWaalsContact OE2-NE 3.11Å; E101-R104 IonicContact OE2-NH2 3.89Å; E101-R104 PolarHBondContact OE2-NH2 3.31Å; V102-R104 VanDerWaalsContact C-N 3.3Å; V102-R104 PolarHBondContact O-N 2.81Å; R104-Q108 WeakPolarHBondContact O-CB 3.32Å; R104-Q108 VanDerWaalsContact O-CG 3.3Å; R104-Q108 WeakPolarHBondContact O-CG 3.34Å; R104-Q108 PolarHBondContact O-N 3.45Å
105	Q	78	Confident	76.7	Confident	110 Å²	110	122 Å²	122	51%	0.514	62%	0.623	S	S	.	*	H	α-helix	trans	-66.3	-48.1	177	-75.4	178.5	-30.1	0	0	111.3	E101 V102 H107 Q108 E109	E101-Q105 WeakPolarHBondContact O-CB 3.48Å; E101-Q105 WeakPolarHBondContact O-CG 3.37Å; E101-Q105 PolarHBondContact O-N 2.91Å; V102-Q105 PolarHBondContact O-N 3.28Å; Q105-H107 VanDerWaalsContact C-N 3.26Å; Q105-H107 PolarHBondContact O-N 2.87Å; Q105-Q108 CarbonylContact O-C 3.57Å; Q105-Q108 PolarHBondContact O-N 3.02Å; Q105-E109 PolarHBondContact O-N 3Å
106	D	76.6	Confident	75.6	Confident	119 Å²	119	123.6 Å²	123.6	64%	0.636	63%	0.631	S	S	*	*	H	α-helix	trans	-57.6	-39.8	176.8	-172.6	69.2	0	0	0	111.7	V102	V102-D106 WeakPolarHBondContact O-CB 3.32Å; V102-D106 PolarHBondContact O-N 2.88Å
107	H	71.1	Confident	74.5	Confident	158 Å²	158	125.1 Å²	125.1	73%	0.731	64%	0.638	S	S	*	*	H	α-helix	trans	-76.9	-20.8	177.1	-134.9	-64.4	0	0	0	114.1	W103 Q105	W103-H107 WeakPolarHBondContact O-CB 3.36Å; W103-H107 PolarHBondContact O-N 3.03Å; Q105-H107 VanDerWaalsContact C-N 3.26Å; Q105-H107 PolarHBondContact O-N 2.87Å
108	Q	63.5	Low	73.3	Confident	140 Å²	140	124.5 Å²	124.5	65%	0.654	64%	0.641	S	S	*	*	H	α-helix	trans	-86.9	-24.9	174.4	-79.2	-176.9	4.5	0	0	112.6	R104 Q105 G110	R104-Q108 WeakPolarHBondContact O-CB 3.32Å; R104-Q108 VanDerWaalsContact O-CG 3.3Å; R104-Q108 WeakPolarHBondContact O-CG 3.34Å; R104-Q108 PolarHBondContact O-N 3.45Å; Q105-Q108 CarbonylContact O-C 3.57Å; Q105-Q108 PolarHBondContact O-N 3.02Å; Q108-G110 PolarHBondContact O-N 3.27Å
109	E	60	Low	72	Confident	164 Å²	164	125 Å²	125	77%	0.766	64%	0.643	S	S	*	*	S	Bend	trans	-75.7	33.3	167.1	-70.5	-175.6	170.3	0	0	112.5	Q105	Q105-E109 PolarHBondContact O-N 3Å
110	G	57.7	Low	70.6	Confident	44 Å²	44	126.7 Å²	126.7	45%	0.454	65%	0.653	S	S	.	*	P	Polyproline II helix	trans	-58	152	169.4	0	0	0	0	0	111.6	Q108 S112	Q108-G110 PolarHBondContact O-N 3.27Å; G110-S112 PolarHBondContact O-N 3.02Å
111	P	56.9	Low	69.1	Low	125 Å²	125	128.1 Å²	128.1	81%	0.812	66%	0.66	S	S	*	*	P	Polyproline II helix	trans	-53.8	124.9	-157.8	22.6	-33.9	0	0	0	111.8
112	S	55	Low	67.6	Low	97 Å²	97	132.4 Å²	132.4	68%	0.678	69%	0.685	S	S	*	*	P	Polyproline II helix	trans	-49.2	126.4	164.5	-177.8	0	0	0	0	108.1	G110 E114	G110-S112 PolarHBondContact O-N 3.02Å; S112-E114 PolarHBondContact O-N 2.98Å
113	P	55.1	Low	65.8	Low	130 Å²	130	136.5 Å²	136.5	84%	0.844	70%	0.7	S	S	*	*			trans	-73.3	97.1	176.9	30.1	-30.7	0	0	0	107.9
114	E	45	Very low	63.7	Low	256 Å²	256	133.3 Å²	133.3	100%	1.196	71%	0.705	S	S	*	*			trans	-109.6	0	159.2	-67	-157.9	128.9	0	0	110.3	S112	S112-E114 PolarHBondContact O-N 2.98Å

Retrieved 114 of 114 residues in 35.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).