Z4YJL9_MOUSE Loading...

Intraflagellar transport 20

AlphaFold DB , UniProt , Accession Z4YJL9, Species MOUSE (Mus musculus, Mouse), Gene Ift20, Length 111 aa.

						>Z4YJL9_MOUSE|Z4YJL9|Ift20
MAKDILGEAGLHFDELNKLRVLDPEVTQQTVELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKTQLERYRVEY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.5	Low	67.6	Low	191 Å²	191	95.8 Å²	95.8	94%	0.941	55%	0.546	S	S	*	.				0	-78	0	-62.3	-158.4	-153.6	0	0	111.9	D4 I5	M1-D4 PolarHBondContact N-OD2 3.3Å; M1-D4 PolarHBondContact O-N 3.29Å; M1-I5 WeakPolarHBondContact O-CD1 3.47Å; M1-I5 VanDerWaalsContact O-CG1 3.31Å; M1-I5 WeakPolarHBondContact O-CG1 3.48Å; M1-I5 PolarHBondContact O-N 3.11Å
2	A	59.3	Low	68.8	Low	73 Å²	73	92.7 Å²	92.7	60%	0.603	52%	0.523	S	S	*	.	H	α-helix	trans	-68.9	-37.1	-178.6	0	0	0	0	0	114.4	D4 L6	A2-D4 VanDerWaalsContact C-N 3.35Å; A2-L6 WeakPolarHBondContact O-CD1 3.47Å; A2-L6 WeakPolarHBondContact O-CG 3.49Å; A2-L6 PolarHBondContact O-N 3.06Å
3	K	57.7	Low	69.7	Low	169 Å²	169	92.4 Å²	92.4	74%	0.735	51%	0.513	S	S	*	.	H	α-helix	trans	-64.9	-34.9	174.4	-94	-173.5	171	-174.1	0	113.1	G7	K3-G7 PolarHBondContact O-N 3.4Å
4	D	62.6	Low	70.4	Confident	104 Å²	104	87.1 Å²	87.1	56%	0.556	48%	0.483	S	S	*	.	H	α-helix	trans	-71.9	-42.2	-179.8	-57.2	-55.4	0	0	0	111.8	M1 A2 L6 G7 E8	M1-D4 PolarHBondContact N-OD2 3.3Å; M1-D4 PolarHBondContact O-N 3.29Å; A2-D4 VanDerWaalsContact C-N 3.35Å; D4-L6 VanDerWaalsContact C-N 3.32Å; D4-L6 PolarHBondContact O-N 3.26Å; D4-G7 PolarHBondContact O-N 2.85Å; D4-E8 WeakPolarHBondContact O-CG 3.5Å; D4-E8 PolarHBondContact O-N 3.02Å
5	I	68.5	Low	71	Confident	111 Å²	111	93.9 Å²	93.9	57%	0.569	51%	0.51	S	S	*	.	H	α-helix	trans	-65.2	-37.1	178.1	-60.5	162.9	0	0	0	111.2	M1 A9	M1-I5 WeakPolarHBondContact O-CD1 3.47Å; M1-I5 VanDerWaalsContact O-CG1 3.31Å; M1-I5 WeakPolarHBondContact O-CG1 3.48Å; M1-I5 PolarHBondContact O-N 3.11Å; I5-A9 PolarHBondContact O-N 3.18Å
6	L	67	Low	71.8	Confident	47 Å²	47	95.9 Å²	95.9	25%	0.246	52%	0.519	C	S	.	.	H	α-helix	trans	-71.5	-39.1	176.5	-70.5	167.7	0	0	0	111.5	A2 D4 A9 G10 L11 F13 L19	A2-L6 WeakPolarHBondContact O-CD1 3.47Å; A2-L6 WeakPolarHBondContact O-CG 3.49Å; A2-L6 PolarHBondContact O-N 3.06Å; D4-L6 VanDerWaalsContact C-N 3.32Å; D4-L6 PolarHBondContact O-N 3.26Å; L6-A9 CarbonylContact O-C 3.55Å; L6-A9 PolarHBondContact O-N 3.44Å; L6-G10 PolarHBondContact O-N 3.32Å; L6-L11 CarbonylContact C-O 3.58Å; L6-L11 HydrophobicContact CB-CB 4.35Å; L6-L11 HydrophobicContact CD2-CB 4.28Å; L6-L11 HydrophobicContact CD2-CD1 3.91Å; L6-L11 WeakPolarHBondContact O-CA 3.45Å; L6-L11 WeakPolarHBondContact O-CB 3.22Å; L6-L11 PolarHBondContact O-N 3.05Å; L6-L11 VanDerWaalsContact O-O 3.13Å; L6-F13 HydrophobicContact CD1-CE2 3.43Å; L6-F13 VanDerWaalsContact CD1-CE2 3.43Å; L6-F13 HydrophobicContact CD1-CZ 3.78Å; L6-L19 HydrophobicContact CD2-CD1 4.42Å
7	G	68.1	Low	72.3	Confident	42 Å²	42	98.2 Å²	98.2	43%	0.433	53%	0.531	S	S	.	.	H	α-helix	trans	-61.9	-41.7	172.1	0	0	0	0	0	113	K3 D4 A9 G10	K3-G7 PolarHBondContact O-N 3.4Å; D4-G7 PolarHBondContact O-N 2.85Å; G7-A9 PolarHBondContact O-N 3.1Å; G7-G10 PolarHBondContact O-N 2.83Å; G7-G10 VanDerWaalsContact O-N 3.09Å
8	E	71.5	Confident	72.8	Confident	170 Å²	170	99.4 Å²	99.4	79%	0.794	53%	0.531	S	S	*	.	H	α-helix	trans	-64.4	-27	174.3	-75.5	177.4	178.2	0	0	113.1	D4 G10	D4-E8 WeakPolarHBondContact O-CG 3.5Å; D4-E8 PolarHBondContact O-N 3.02Å; E8-G10 VanDerWaalsContact C-N 3.33Å
9	A	77.1	Confident	73.5	Confident	67 Å²	67	99.1 Å²	99.1	55%	0.554	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.5	2	174.6	0	0	0	0	0	113.9	I5 L6 G7 L11	I5-A9 PolarHBondContact O-N 3.18Å; L6-A9 CarbonylContact O-C 3.55Å; L6-A9 PolarHBondContact O-N 3.44Å; G7-A9 PolarHBondContact O-N 3.1Å; A9-L11 VanDerWaalsContact C-N 3.33Å; A9-L11 HydrophobicContact CB-CD1 4.24Å; A9-L11 HydrophobicContact CB-CG 4.44Å
10	G	76.1	Confident	73.8	Confident	31 Å²	31	100.4 Å²	100.4	32%	0.32	53%	0.526	S	S	.	.	T	Hydrogen-bonded Turn	trans	72.6	23.2	-177.2	0	0	0	0	0	114.1	L6 G7 E8 H12	L6-G10 PolarHBondContact O-N 3.32Å; G7-G10 PolarHBondContact O-N 2.83Å; G7-G10 VanDerWaalsContact O-N 3.09Å; E8-G10 VanDerWaalsContact C-N 3.33Å; G10-H12 PolarHBondContact O-CD2 3.08Å
11	L	81.8	Confident	74.3	Confident	49 Å²	49	101.5 Å²	101.5	26%	0.257	54%	0.536	S	S	.	.			trans	-106.6	123.4	-179.9	-64.2	168.7	0	0	0	110.3	L6 A9 L19 R20 V21	L6-L11 CarbonylContact C-O 3.58Å; L6-L11 HydrophobicContact CB-CB 4.35Å; L6-L11 HydrophobicContact CD2-CB 4.28Å; L6-L11 HydrophobicContact CD2-CD1 3.91Å; L6-L11 WeakPolarHBondContact O-CA 3.45Å; L6-L11 WeakPolarHBondContact O-CB 3.22Å; L6-L11 PolarHBondContact O-N 3.05Å; L6-L11 VanDerWaalsContact O-O 3.13Å; A9-L11 VanDerWaalsContact C-N 3.33Å; A9-L11 HydrophobicContact CB-CD1 4.24Å; A9-L11 HydrophobicContact CB-CG 4.44Å; L11-L19 HydrophobicContact CB-CD1 4.22Å; L11-L19 HydrophobicContact CB-CG 4.38Å; L11-L19 HydrophobicContact CD1-CD2 4.16Å; L11-L19 HydrophobicContact CD2-CD2 4.03Å; L11-L19 HydrophobicContact CD2-CG 4.29Å; L11-R20 CarbonylContact C-O 3.56Å; L11-R20 WeakPolarHBondContact CA-O 3.45Å; L11-V21 HydrophobicContact CD2-CG1 4.08Å
12	H	81.3	Confident	75.5	Confident	58 Å²	58	97.1 Å²	97.1	27%	0.269	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	151.7	-177	-57.4	-100.3	0	0	0	110	G10 L19 R20 D23	G10-H12 PolarHBondContact O-CD2 3.08Å; H12-L19 CarbonylContact O-C 3.35Å; H12-R20 HydrophobicContact CB-CB 4.43Å; H12-R20 PolarHBondContact N-O 2.96Å; H12-R20 PolarHBondContact O-N 3.24Å; H12-D23 IonicContact CE1-OD2 2.85Å; H12-D23 IonicContact ND1-OD2 3.76Å
13	F	80.7	Confident	76.6	Confident	89 Å²	89	96.3 Å²	96.3	39%	0.39	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102	134.8	168.5	-74	-77.5	0	0	0	109.5	L6 K18 L19	L6-F13 HydrophobicContact CD1-CE2 3.43Å; L6-F13 VanDerWaalsContact CD1-CE2 3.43Å; L6-F13 HydrophobicContact CD1-CZ 3.78Å; F13-K18 WeakPolarHBondContact CA-O 3.42Å; F13-L19 HydrophobicContact CD1-CD1 4.25Å; F13-L19 HydrophobicContact CE1-CD1 3.67Å; F13-L19 HydrophobicContact CE2-CD1 4.25Å; F13-L19 HydrophobicContact CZ-CD1 3.67Å
14	D	79.8	Confident	77.9	Confident	18 Å²	18	90.1 Å²	90.1	10%	0.096	48%	0.479	C	S	.	.			trans	-82.1	175.3	169.3	69.8	16.1	0	0	0	112.5	L16 N17 K18 R20 P24	D14-L16 PolarHBondContact O-N 2.94Å; D14-L16 WeakPolarHBondContact OD1-CA 3.44Å; D14-L16 WeakPolarHBondContact OD1-CB 3.44Å; D14-L16 PolarHBondContact OD1-N 3.45Å; D14-N17 PolarHBondContact O-N 3.38Å; D14-N17 PolarHBondContact OD1-N 3.34Å; D14-K18 PolarHBondContact N-O 3.35Å; D14-K18 WeakPolarHBondContact OD1-CB 3.29Å; D14-K18 PolarHBondContact OD1-N 2.91Å; D14-R20 HydrophobicContact CB-CG 4.05Å; D14-R20 IonicContact OD2-CZ 3.26Å; D14-R20 VanDerWaalsContact OD2-CZ 3.26Å; D14-R20 IonicContact OD2-NE 2.84Å; D14-R20 PolarHBondContact OD2-NE 2.97Å; D14-R20 IonicContact OD2-NH2 2.79Å; D14-R20 PolarHBondContact OD2-NH2 2.94Å; D14-P24 HydrophobicContact CB-CB 4.36Å; D14-P24 HydrophobicContact CB-CG 3.87Å
15	E	79.5	Confident	78.9	Confident	190 Å²	190	91 Å²	91	89%	0.888	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.5	-14.8	179.9	-59.7	-175.4	161.2	0	0	113.8
16	L	83.2	Confident	79.8	Confident	125 Å²	125	88.9 Å²	88.9	65%	0.654	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.4	14.6	177	-59.4	176.6	0	0	0	112.5	D14 K18	D14-L16 PolarHBondContact O-N 2.94Å; D14-L16 WeakPolarHBondContact OD1-CA 3.44Å; D14-L16 WeakPolarHBondContact OD1-CB 3.44Å; D14-L16 PolarHBondContact OD1-N 3.45Å; L16-K18 HydrophobicContact CB-CG 4.3Å; L16-K18 PolarHBondContact O-N 2.98Å
17	N	79.9	Confident	80.7	Confident	136 Å²	136	89.3 Å²	89.3	73%	0.727	48%	0.476	S	S	*	.	S	Bend	trans	57.7	25.9	-175.6	-60.1	-57.9	0	0	0	114.2	D14	D14-N17 PolarHBondContact O-N 3.38Å; D14-N17 PolarHBondContact OD1-N 3.34Å
18	K	82.6	Confident	81.8	Confident	119 Å²	119	92.6 Å²	92.6	52%	0.517	48%	0.48	S	S	.	.			trans	-87.3	139.8	173.2	-56.6	179.1	179.7	178.1	0	109.7	F13 D14 L16	F13-K18 WeakPolarHBondContact CA-O 3.42Å; D14-K18 PolarHBondContact N-O 3.35Å; D14-K18 WeakPolarHBondContact OD1-CB 3.29Å; D14-K18 PolarHBondContact OD1-N 2.91Å; L16-K18 HydrophobicContact CB-CG 4.3Å; L16-K18 PolarHBondContact O-N 2.98Å
19	L	84.8	Confident	82.7	Confident	94 Å²	94	89.5 Å²	89.5	49%	0.492	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.4	129.7	175.4	-156.5	81.9	0	0	0	109.8	L6 L11 H12 F13	L6-L19 HydrophobicContact CD2-CD1 4.42Å; L11-L19 HydrophobicContact CB-CD1 4.22Å; L11-L19 HydrophobicContact CB-CG 4.38Å; L11-L19 HydrophobicContact CD1-CD2 4.16Å; L11-L19 HydrophobicContact CD2-CD2 4.03Å; L11-L19 HydrophobicContact CD2-CG 4.29Å; H12-L19 CarbonylContact O-C 3.35Å; F13-L19 HydrophobicContact CD1-CD1 4.25Å; F13-L19 HydrophobicContact CE1-CD1 3.67Å; F13-L19 HydrophobicContact CE2-CD1 4.25Å; F13-L19 HydrophobicContact CZ-CD1 3.67Å
20	R	79.4	Confident	83.5	Confident	125 Å²	125	90.3 Å²	90.3	47%	0.472	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	148.6	-178.7	-63.3	-74.7	-178	164.3	3.3	109.2	L11 H12 D14 L22 P24	L11-R20 CarbonylContact C-O 3.56Å; L11-R20 WeakPolarHBondContact CA-O 3.45Å; H12-R20 HydrophobicContact CB-CB 4.43Å; H12-R20 PolarHBondContact N-O 2.96Å; H12-R20 PolarHBondContact O-N 3.24Å; D14-R20 HydrophobicContact CB-CG 4.05Å; D14-R20 IonicContact OD2-CZ 3.26Å; D14-R20 VanDerWaalsContact OD2-CZ 3.26Å; D14-R20 IonicContact OD2-NE 2.84Å; D14-R20 PolarHBondContact OD2-NE 2.97Å; D14-R20 IonicContact OD2-NH2 2.79Å; D14-R20 PolarHBondContact OD2-NH2 2.94Å; R20-L22 WeakPolarHBondContact CB-O 3.5Å; R20-P24 HydrophobicContact CG-CG 4.45Å
21	V	84.9	Confident	84.3	Confident	124 Å²	124	92.8 Å²	92.8	75%	0.752	47%	0.473	S	S	*	.	S	Bend	trans	-95.9	-6.3	177.9	-127.3	0	0	0	0	112.5	L11	L11-V21 HydrophobicContact CD2-CG1 4.08Å
22	L	79.3	Confident	85	Confident	99 Å²	99	95 Å²	95	52%	0.518	48%	0.482	S	S	.	.	S	Bend	trans	-130.2	142.5	176.6	-168.5	68.7	0	0	0	107.4	R20 P24 T27	R20-L22 WeakPolarHBondContact CB-O 3.5Å; L22-P24 WeakPolarHBondContact O-CD 3.26Å; L22-T27 WeakPolarHBondContact CD2-OG1 3.49Å
23	D	83.6	Confident	85.7	Confident	55 Å²	55	97.2 Å²	97.2	29%	0.294	50%	0.495	S	S	.	.			trans	-56.4	123.6	176.2	-164.2	-43	0	0	0	109.8	H12 E25 V26 T27	H12-D23 IonicContact CE1-OD2 2.85Å; H12-D23 IonicContact ND1-OD2 3.76Å; D23-E25 PolarHBondContact O-N 3.5Å; D23-E25 PolarHBondContact OD1-N 3.33Å; D23-V26 HydrophobicContact CB-CB 4.04Å; D23-V26 HydrophobicContact CB-CG2 3.8Å; D23-V26 PolarHBondContact O-N 3.49Å; D23-T27 PolarHBondContact O-N 2.97Å; D23-T27 PolarHBondContact O-OG1 3.33Å
24	P	83.6	Confident	86.4	Confident	39 Å²	39	99.7 Å²	99.7	25%	0.253	51%	0.506	S	S	.	.	H	α-helix	trans	-54	-36.5	177.7	-26	33.6	0	0	0	113.4	D14 R20 L22 T27 Q28	D14-P24 HydrophobicContact CB-CB 4.36Å; D14-P24 HydrophobicContact CB-CG 3.87Å; R20-P24 HydrophobicContact CG-CG 4.45Å; L22-P24 WeakPolarHBondContact O-CD 3.26Å; P24-T27 WeakPolarHBondContact O-CB 3.4Å; P24-T27 PolarHBondContact O-N 2.96Å; P24-Q28 WeakPolarHBondContact O-CB 3.37Å; P24-Q28 PolarHBondContact O-N 3.01Å
25	E	84.9	Confident	87.3	Confident	124 Å²	124	102.9 Å²	102.9	58%	0.579	52%	0.52	S	S	*	.	H	α-helix	trans	-68.8	-45.3	-180	-170.7	175.1	176.1	0	0	110.9	D23 T27 Q28 Q29	D23-E25 PolarHBondContact O-N 3.5Å; D23-E25 PolarHBondContact OD1-N 3.33Å; E25-T27 VanDerWaalsContact C-N 3.29Å; E25-T27 PolarHBondContact O-N 3.39Å; E25-Q28 PolarHBondContact O-N 3.48Å; E25-Q29 WeakPolarHBondContact O-CB 3.35Å; E25-Q29 WeakPolarHBondContact O-CG 3.5Å; E25-Q29 PolarHBondContact O-N 2.93Å
26	V	86.1	Confident	88.1	Confident	65 Å²	65	100.2 Å²	100.2	39%	0.394	51%	0.507	S	S	.	.	H	α-helix	trans	-62.9	-38.4	175.1	177.8	0	0	0	0	110.9	D23 T30	D23-V26 HydrophobicContact CB-CB 4.04Å; D23-V26 HydrophobicContact CB-CG2 3.8Å; D23-V26 PolarHBondContact O-N 3.49Å; V26-T30 VanDerWaalsContact O-CB 3.3Å; V26-T30 WeakPolarHBondContact O-CB 3.5Å; V26-T30 PolarHBondContact O-N 3.23Å; V26-T30 PolarHBondContact O-OG1 3.36Å
27	T	87.8	Confident	88.8	Confident	57 Å²	57	97.4 Å²	97.4	35%	0.35	50%	0.497	S	S	.	.	H	α-helix	trans	-61.8	-47.9	176.1	-53.9	0	0	0	0	110.7	L22 D23 P24 E25 T30 V31	L22-T27 WeakPolarHBondContact CD2-OG1 3.49Å; D23-T27 PolarHBondContact O-N 2.97Å; D23-T27 PolarHBondContact O-OG1 3.33Å; P24-T27 WeakPolarHBondContact O-CB 3.4Å; P24-T27 PolarHBondContact O-N 2.96Å; E25-T27 VanDerWaalsContact C-N 3.29Å; E25-T27 PolarHBondContact O-N 3.39Å; T27-T30 PolarHBondContact O-N 2.95Å; T27-V31 WeakPolarHBondContact O-CG2 3.47Å; T27-V31 PolarHBondContact O-N 3.48Å
28	Q	89.3	Confident	89.6	Confident	111 Å²	111	96.5 Å²	96.5	52%	0.519	49%	0.487	S	S	.	.	H	α-helix	trans	-63.4	-50.3	179.9	179	166.3	-1.2	0	0	111.7	P24 E25 T30 V31 E32	P24-Q28 WeakPolarHBondContact O-CB 3.37Å; P24-Q28 PolarHBondContact O-N 3.01Å; E25-Q28 PolarHBondContact O-N 3.48Å; Q28-T30 VanDerWaalsContact C-N 3.26Å; Q28-T30 PolarHBondContact O-N 2.92Å; Q28-V31 PolarHBondContact O-N 2.98Å; Q28-V31 VanDerWaalsContact O-N 3.08Å; Q28-E32 HydrophobicContact CG-CG 4.44Å; Q28-E32 VanDerWaalsContact CG-OE1 3.3Å; Q28-E32 WeakPolarHBondContact CG-OE1 3.41Å; Q28-E32 PolarHBondContact NE2-OE1 3.46Å; Q28-E32 WeakPolarHBondContact O-CG 3.43Å; Q28-E32 PolarHBondContact O-N 3.35Å
29	Q	92.3	Very high	90.3	Very high	104 Å²	104	94.7 Å²	94.7	49%	0.486	48%	0.483	S	S	.	.	H	α-helix	trans	-58.2	-38.5	177.4	-71.4	175.5	-4.1	0	0	112	E25 E32 L33	E25-Q29 WeakPolarHBondContact O-CB 3.35Å; E25-Q29 WeakPolarHBondContact O-CG 3.5Å; E25-Q29 PolarHBondContact O-N 2.93Å; Q29-E32 PolarHBondContact O-N 3.39Å; Q29-L33 VanDerWaalsContact O-CB 3.28Å; Q29-L33 WeakPolarHBondContact O-CB 3.33Å; Q29-L33 PolarHBondContact O-N 3.47Å
30	T	92.8	Very high	91	Very high	84 Å²	84	96.5 Å²	96.5	52%	0.515	49%	0.487	S	S	.	.	H	α-helix	trans	-67.2	-37.7	177.5	-57.7	0	0	0	0	112	V26 T27 Q28 K34	V26-T30 VanDerWaalsContact O-CB 3.3Å; V26-T30 WeakPolarHBondContact O-CB 3.5Å; V26-T30 PolarHBondContact O-N 3.23Å; V26-T30 PolarHBondContact O-OG1 3.36Å; T27-T30 PolarHBondContact O-N 2.95Å; Q28-T30 VanDerWaalsContact C-N 3.26Å; Q28-T30 PolarHBondContact O-N 2.92Å; T30-K34 WeakPolarHBondContact O-CB 3.47Å; T30-K34 PolarHBondContact O-N 3.35Å; T30-K34 VanDerWaalsContact O-N 3.08Å
31	V	93.7	Very high	91.8	Very high	83 Å²	83	95.1 Å²	95.1	50%	0.503	49%	0.492	S	S	.	.	H	α-helix	trans	-69.2	-45.2	176.2	171	0	0	0	0	110.8	T27 Q28 K34 E35	T27-V31 WeakPolarHBondContact O-CG2 3.47Å; T27-V31 PolarHBondContact O-N 3.48Å; Q28-V31 PolarHBondContact O-N 2.98Å; Q28-V31 VanDerWaalsContact O-N 3.08Å; V31-K34 WeakPolarHBondContact O-CB 3.42Å; V31-K34 PolarHBondContact O-N 3Å; V31-E35 PolarHBondContact O-N 3.35Å
32	E	95.7	Very high	92.5	Very high	97 Å²	97	93.2 Å²	93.2	45%	0.453	48%	0.478	S	S	.	.	H	α-helix	trans	-58.5	-49.5	176.3	-72.5	173	-173.3	0	0	110.9	Q28 Q29 K34 E35 E36	Q28-E32 HydrophobicContact CG-CG 4.44Å; Q28-E32 VanDerWaalsContact CG-OE1 3.3Å; Q28-E32 WeakPolarHBondContact CG-OE1 3.41Å; Q28-E32 PolarHBondContact NE2-OE1 3.46Å; Q28-E32 WeakPolarHBondContact O-CG 3.43Å; Q28-E32 PolarHBondContact O-N 3.35Å; Q29-E32 PolarHBondContact O-N 3.39Å; E32-K34 VanDerWaalsContact C-N 3.28Å; E32-K34 PolarHBondContact O-N 2.89Å; E32-E35 PolarHBondContact O-N 3.39Å; E32-E36 WeakPolarHBondContact O-CG 3.36Å; E32-E36 PolarHBondContact O-N 3.02Å
33	L	95.8	Very high	93.4	Very high	103 Å²	103	95 Å²	95	54%	0.539	48%	0.482	S	S	.	.	H	α-helix	trans	-57.8	-40.3	176.7	179.6	62.6	0	0	0	112.4	Q29 C37	Q29-L33 VanDerWaalsContact O-CB 3.28Å; Q29-L33 WeakPolarHBondContact O-CB 3.33Å; Q29-L33 PolarHBondContact O-N 3.47Å; L33-C37 VanDerWaalsContact O-CB 3.27Å; L33-C37 WeakPolarHBondContact O-CB 3.46Å; L33-C37 PolarHBondContact O-N 3Å; L33-C37 PolarHBondContact O-SG 3.25Å
34	K	96.4	Very high	94.1	Very high	142 Å²	142	95.5 Å²	95.5	62%	0.617	48%	0.483	S	S	*	.	H	α-helix	trans	-63.6	-45.2	178.2	-180	-169.3	171.5	-164.2	0	111.6	T30 V31 E32 C37 K38	T30-K34 WeakPolarHBondContact O-CB 3.47Å; T30-K34 PolarHBondContact O-N 3.35Å; T30-K34 VanDerWaalsContact O-N 3.08Å; V31-K34 WeakPolarHBondContact O-CB 3.42Å; V31-K34 PolarHBondContact O-N 3Å; E32-K34 VanDerWaalsContact C-N 3.28Å; E32-K34 PolarHBondContact O-N 2.89Å; K34-C37 PolarHBondContact O-N 3.48Å; K34-K38 PolarHBondContact O-N 3.32Å
35	E	97.3	Very high	94.7	Very high	85 Å²	85	94.8 Å²	94.8	40%	0.397	48%	0.483	S	S	.	.	H	α-helix	trans	-68.1	-42	178.7	-65.7	-55.1	136	0	0	111.2	V31 E32 C37 K38 D39	V31-E35 PolarHBondContact O-N 3.35Å; E32-E35 PolarHBondContact O-N 3.39Å; E35-C37 VanDerWaalsContact C-N 3.33Å; E35-C37 PolarHBondContact O-N 3.28Å; E35-K38 WeakPolarHBondContact O-CB 3.37Å; E35-K38 PolarHBondContact O-N 3.49Å; E35-K38 VanDerWaalsContact O-N 3.15Å; E35-D39 PolarHBondContact O-N 3.47Å
36	E	96.9	Very high	95.4	Very high	133 Å²	133	94.8 Å²	94.8	62%	0.621	48%	0.483	S	S	*	.	H	α-helix	trans	-60.6	-41.9	175	-74	-172.3	171.7	0	0	112.4	E32 K38 D39 F40	E32-E36 WeakPolarHBondContact O-CG 3.36Å; E32-E36 PolarHBondContact O-N 3.02Å; E36-K38 VanDerWaalsContact C-N 3.32Å; E36-K38 PolarHBondContact O-N 2.96Å; E36-D39 PolarHBondContact O-N 2.94Å; E36-F40 WeakPolarHBondContact O-CB 2.9Å; E36-F40 PolarHBondContact O-N 2.89Å
37	C	97.3	Very high	95.9	Very high	66 Å²	66	97.8 Å²	97.8	45%	0.446	49%	0.491	S	S	.	.	H	α-helix	trans	-63.1	-39.6	176.3	-77	0	0	0	0	111.6	L33 K34 E35 F40 V41	L33-C37 VanDerWaalsContact O-CB 3.27Å; L33-C37 WeakPolarHBondContact O-CB 3.46Å; L33-C37 PolarHBondContact O-N 3Å; L33-C37 PolarHBondContact O-SG 3.25Å; K34-C37 PolarHBondContact O-N 3.48Å; E35-C37 VanDerWaalsContact C-N 3.33Å; E35-C37 PolarHBondContact O-N 3.28Å; C37-F40 PolarHBondContact O-N 3.43Å; C37-V41 WeakPolarHBondContact O-CG2 3.48Å; C37-V41 PolarHBondContact O-N 2.93Å
38	K	97.4	Very high	96.4	Very high	117 Å²	117	101.2 Å²	101.2	51%	0.509	50%	0.503	S	S	.	.	H	α-helix	trans	-64.6	-48.4	175.7	-176.7	-174.5	171	-163.4	0	111.1	K34 E35 E36 F40 V41 D42	K34-K38 PolarHBondContact O-N 3.32Å; E35-K38 WeakPolarHBondContact O-CB 3.37Å; E35-K38 PolarHBondContact O-N 3.49Å; E35-K38 VanDerWaalsContact O-N 3.15Å; E36-K38 VanDerWaalsContact C-N 3.32Å; E36-K38 PolarHBondContact O-N 2.96Å; K38-F40 VanDerWaalsContact C-N 3.26Å; K38-F40 PolarHBondContact O-N 3.31Å; K38-V41 PolarHBondContact O-N 3.31Å; K38-D42 PolarHBondContact O-N 2.89Å
39	D	97.8	Very high	96.9	Very high	81 Å²	81	103.8 Å²	103.8	43%	0.433	51%	0.513	S	S	.	.	H	α-helix	trans	-59.1	-39.1	176.4	-83.5	2.1	0	0	0	112	E35 E36 D42 K43	E35-D39 PolarHBondContact O-N 3.47Å; E36-D39 PolarHBondContact O-N 2.94Å; D39-D42 PolarHBondContact O-N 3.46Å; D39-K43 WeakPolarHBondContact O-CB 3.29Å; D39-K43 VanDerWaalsContact O-CG 3.23Å; D39-K43 WeakPolarHBondContact O-CG 3.35Å; D39-K43 PolarHBondContact O-N 3.13Å
40	F	98.1	Very high	97.1	Very high	133 Å²	133	104.6 Å²	104.6	58%	0.583	52%	0.519	S	S	*	.	H	α-helix	trans	-63.1	-48.5	176	179.6	-96.1	0	0	0	111.5	E36 C37 K38 D42 K43 I44	E36-F40 WeakPolarHBondContact O-CB 2.9Å; E36-F40 PolarHBondContact O-N 2.89Å; C37-F40 PolarHBondContact O-N 3.43Å; K38-F40 VanDerWaalsContact C-N 3.26Å; K38-F40 PolarHBondContact O-N 3.31Å; F40-D42 VanDerWaalsContact C-N 3.31Å; F40-D42 PolarHBondContact O-N 3.29Å; F40-K43 PolarHBondContact O-N 3.45Å; F40-I44 HydrophobicContact CD1-CG1 4.17Å; F40-I44 HydrophobicContact CE1-CD1 4.48Å; F40-I44 HydrophobicContact CE1-CG1 3.74Å; F40-I44 HydrophobicContact CE2-CD1 4.31Å; F40-I44 HydrophobicContact CE2-CG1 4.12Å; F40-I44 HydrophobicContact CZ-CD1 3.99Å; F40-I44 HydrophobicContact CZ-CG1 3.71Å; F40-I44 WeakPolarHBondContact O-CG1 3.46Å; F40-I44 PolarHBondContact O-N 3.46Å
41	V	97.9	Very high	97.4	Very high	95 Å²	95	103.1 Å²	103.1	58%	0.576	51%	0.51	S	S	*	.	H	α-helix	trans	-60.4	-43.1	177.6	170.8	0	0	0	0	110.9	C37 K38 I44 G45	C37-V41 WeakPolarHBondContact O-CG2 3.48Å; C37-V41 PolarHBondContact O-N 2.93Å; K38-V41 PolarHBondContact O-N 3.31Å; V41-I44 PolarHBondContact O-N 3.24Å; V41-G45 PolarHBondContact O-N 3.43Å
42	D	98.3	Very high	97.6	Very high	84 Å²	84	100.6 Å²	100.6	45%	0.449	50%	0.5	S	S	.	.	H	α-helix	trans	-63.7	-44.3	178.5	-75.5	-17.4	0	0	0	111.7	K38 D39 F40 G45 Q46	K38-D42 PolarHBondContact O-N 2.89Å; D39-D42 PolarHBondContact O-N 3.46Å; F40-D42 VanDerWaalsContact C-N 3.31Å; F40-D42 PolarHBondContact O-N 3.29Å; D42-G45 PolarHBondContact O-N 3.33Å; D42-Q46 WeakPolarHBondContact O-CG 3.33Å; D42-Q46 PolarHBondContact O-N 2.95Å
43	K	98.1	Very high	97.7	Very high	137 Å²	137	97.3 Å²	97.3	60%	0.596	49%	0.493	S	S	*	.	H	α-helix	trans	-62.5	-43.3	175.9	-75.6	169.1	-175.7	165.7	0	112	D39 F40 G45 Q46 F47	D39-K43 WeakPolarHBondContact O-CB 3.29Å; D39-K43 VanDerWaalsContact O-CG 3.23Å; D39-K43 WeakPolarHBondContact O-CG 3.35Å; D39-K43 PolarHBondContact O-N 3.13Å; F40-K43 PolarHBondContact O-N 3.45Å; K43-G45 VanDerWaalsContact C-N 3.34Å; K43-Q46 PolarHBondContact O-N 3.31Å; K43-F47 WeakPolarHBondContact O-CB 3.45Å; K43-F47 PolarHBondContact O-N 2.98Å
44	I	97.9	Very high	97.8	Very high	65 Å²	65	97.4 Å²	97.4	33%	0.333	49%	0.493	S	S	.	.	H	α-helix	trans	-64.3	-40.7	176	-69.3	-65.8	0	0	0	110.8	F40 V41 Q46 F47 Q48	F40-I44 HydrophobicContact CD1-CG1 4.17Å; F40-I44 HydrophobicContact CE1-CD1 4.48Å; F40-I44 HydrophobicContact CE1-CG1 3.74Å; F40-I44 HydrophobicContact CE2-CD1 4.31Å; F40-I44 HydrophobicContact CE2-CG1 4.12Å; F40-I44 HydrophobicContact CZ-CD1 3.99Å; F40-I44 HydrophobicContact CZ-CG1 3.71Å; F40-I44 WeakPolarHBondContact O-CG1 3.46Å; F40-I44 PolarHBondContact O-N 3.46Å; V41-I44 PolarHBondContact O-N 3.24Å; I44-Q46 VanDerWaalsContact C-N 3.34Å; I44-Q46 PolarHBondContact O-N 2.93Å; I44-F47 PolarHBondContact O-N 3.04Å; I44-Q48 HydrophobicContact CG2-CG 4.41Å; I44-Q48 WeakPolarHBondContact O-CG 3.49Å; I44-Q48 PolarHBondContact O-N 3.44Å
45	G	98.1	Very high	97.9	Very high	24 Å²	24	95.3 Å²	95.3	25%	0.247	49%	0.488	C	S	.	.	H	α-helix	trans	-61.4	-40.7	175.2	0	0	0	0	0	112.7	V41 D42 K43 K49	V41-G45 PolarHBondContact O-N 3.43Å; D42-G45 PolarHBondContact O-N 3.33Å; K43-G45 VanDerWaalsContact C-N 3.34Å; G45-K49 WeakPolarHBondContact O-CG 3.43Å; G45-K49 PolarHBondContact O-N 3.12Å
46	Q	98.1	Very high	98	Very high	124 Å²	124	97.2 Å²	97.2	58%	0.579	50%	0.497	S	S	*	.	H	α-helix	trans	-65.7	-44.2	173.6	-69.5	176	17.5	0	0	111.9	D42 K43 I44 Q48 K49 I50	D42-Q46 WeakPolarHBondContact O-CG 3.33Å; D42-Q46 PolarHBondContact O-N 2.95Å; K43-Q46 PolarHBondContact O-N 3.31Å; I44-Q46 VanDerWaalsContact C-N 3.34Å; I44-Q46 PolarHBondContact O-N 2.93Å; Q46-Q48 PolarHBondContact O-N 3.01Å; Q46-K49 WeakPolarHBondContact O-CB 3.34Å; Q46-K49 PolarHBondContact O-N 2.94Å; Q46-I50 WeakPolarHBondContact O-CG1 3.37Å; Q46-I50 PolarHBondContact O-N 3.34Å
47	F	98.1	Very high	98	Very high	128 Å²	128	96.2 Å²	96.2	56%	0.561	50%	0.495	S	S	*	.	H	α-helix	trans	-58.6	-46.3	177.1	177.6	-100.2	0	0	0	111.8	K43 I44 K49 I50 V51	K43-F47 WeakPolarHBondContact O-CB 3.45Å; K43-F47 PolarHBondContact O-N 2.98Å; I44-F47 PolarHBondContact O-N 3.04Å; F47-K49 VanDerWaalsContact C-N 3.31Å; F47-K49 PolarHBondContact O-N 3.38Å; F47-I50 PolarHBondContact O-N 2.98Å; F47-V51 HydrophobicContact CD1-CG2 4.19Å; F47-V51 HydrophobicContact CD2-CG2 4.32Å; F47-V51 HydrophobicContact CE1-CG2 3.73Å; F47-V51 HydrophobicContact CE2-CG2 3.88Å; F47-V51 HydrophobicContact CG-CG2 4.47Å; F47-V51 HydrophobicContact CZ-CG2 3.56Å; F47-V51 WeakPolarHBondContact O-CG2 3.47Å; F47-V51 PolarHBondContact O-N 2.94Å
48	Q	98	Very high	98.1	Very high	129 Å²	129	96.9 Å²	96.9	60%	0.603	50%	0.497	S	S	*	.	H	α-helix	trans	-59.2	-40.6	176.7	-74.8	176.5	-21.4	0	0	112.3	I44 Q46 G52	I44-Q48 HydrophobicContact CG2-CG 4.41Å; I44-Q48 WeakPolarHBondContact O-CG 3.49Å; I44-Q48 PolarHBondContact O-N 3.44Å; Q46-Q48 PolarHBondContact O-N 3.01Å; Q48-G52 PolarHBondContact O-N 2.9Å
49	K	98.1	Very high	98.1	Very high	166 Å²	166	95.6 Å²	95.6	72%	0.722	50%	0.496	S	S	*	.	H	α-helix	trans	-63.1	-43.6	175.4	-72.2	173.4	-177.1	178.6	0	112.1	G45 Q46 F47 G52 G53	G45-K49 WeakPolarHBondContact O-CG 3.43Å; G45-K49 PolarHBondContact O-N 3.12Å; Q46-K49 WeakPolarHBondContact O-CB 3.34Å; Q46-K49 PolarHBondContact O-N 2.94Å; F47-K49 VanDerWaalsContact C-N 3.31Å; F47-K49 PolarHBondContact O-N 3.38Å; K49-G52 PolarHBondContact O-N 2.93Å; K49-G53 PolarHBondContact O-N 3.48Å
50	I	98	Very high	98.1	Very high	121 Å²	121	96.9 Å²	96.9	62%	0.621	50%	0.499	S	S	*	.	H	α-helix	trans	-63.8	-47.8	178.9	-67	165.7	0	0	0	110.4	Q46 F47 G52 G53 L54	Q46-I50 WeakPolarHBondContact O-CG1 3.37Å; Q46-I50 PolarHBondContact O-N 3.34Å; F47-I50 PolarHBondContact O-N 2.98Å; I50-G52 VanDerWaalsContact C-N 3.33Å; I50-G52 PolarHBondContact O-N 2.77Å; I50-G53 PolarHBondContact O-N 3.31Å; I50-L54 PolarHBondContact O-N 3.37Å
51	V	98.2	Very high	98.1	Very high	53 Å²	53	95.9 Å²	95.9	32%	0.321	50%	0.499	S	S	.	.	H	α-helix	trans	-63.5	-41.1	178.6	173.5	0	0	0	0	111	F47 L54 I55	F47-V51 HydrophobicContact CD1-CG2 4.19Å; F47-V51 HydrophobicContact CD2-CG2 4.32Å; F47-V51 HydrophobicContact CE1-CG2 3.73Å; F47-V51 HydrophobicContact CE2-CG2 3.88Å; F47-V51 HydrophobicContact CG-CG2 4.47Å; F47-V51 HydrophobicContact CZ-CG2 3.56Å; F47-V51 WeakPolarHBondContact O-CG2 3.47Å; F47-V51 PolarHBondContact O-N 2.94Å; V51-L54 PolarHBondContact O-N 3.46Å; V51-I55 HydrophobicContact CG1-CD1 3.95Å; V51-I55 HydrophobicContact CG1-CG1 4.45Å; V51-I55 WeakPolarHBondContact O-CG1 3.31Å; V51-I55 PolarHBondContact O-N 3.19Å
52	G	98.3	Very high	98.2	Very high	29 Å²	29	93.9 Å²	93.9	30%	0.299	49%	0.492	S	S	.	.	H	α-helix	trans	-57.2	-49.4	173.9	0	0	0	0	0	112.2	Q48 K49 I50 L54 I55 E56	Q48-G52 PolarHBondContact O-N 2.9Å; K49-G52 PolarHBondContact O-N 2.93Å; I50-G52 VanDerWaalsContact C-N 3.33Å; I50-G52 PolarHBondContact O-N 2.77Å; G52-L54 VanDerWaalsContact C-N 3.32Å; G52-L54 PolarHBondContact O-N 2.89Å; G52-I55 PolarHBondContact O-N 2.9Å; G52-E56 WeakPolarHBondContact O-CG 3.49Å; G52-E56 PolarHBondContact O-N 3.43Å; G52-E56 VanDerWaalsContact O-N 3.1Å
53	G	98.2	Very high	98.2	Very high	29 Å²	29	97.1 Å²	97.1	30%	0.299	50%	0.503	S	S	.	.	H	α-helix	trans	-62.9	-35.8	176.2	0	0	0	0	0	113.5	K49 I50 E56 L57	K49-G53 PolarHBondContact O-N 3.48Å; I50-G53 PolarHBondContact O-N 3.31Å; G53-E56 PolarHBondContact O-N 3.45Å; G53-L57 WeakPolarHBondContact O-CG 3.45Å; G53-L57 PolarHBondContact O-N 3.48Å
54	L	98.1	Very high	98.2	Very high	105 Å²	105	96.5 Å²	96.5	55%	0.55	50%	0.502	S	S	.	.	H	α-helix	trans	-65.5	-43.1	175.1	179.2	62	0	0	0	111.9	I50 V51 G52 E56 L57 V58	I50-L54 PolarHBondContact O-N 3.37Å; V51-L54 PolarHBondContact O-N 3.46Å; G52-L54 VanDerWaalsContact C-N 3.32Å; G52-L54 PolarHBondContact O-N 2.89Å; L54-E56 VanDerWaalsContact C-N 3.32Å; L54-E56 PolarHBondContact O-N 2.94Å; L54-L57 PolarHBondContact O-N 3.23Å; L54-V58 HydrophobicContact CD1-CG2 4.24Å; L54-V58 HydrophobicContact CG-CG2 4.5Å; L54-V58 VanDerWaalsContact O-CG2 3.31Å; L54-V58 WeakPolarHBondContact O-CG2 3.45Å; L54-V58 PolarHBondContact O-N 3.42Å
55	I	98.1	Very high	98.2	Very high	97 Å²	97	96.1 Å²	96.1	50%	0.497	51%	0.508	S	S	.	.	H	α-helix	trans	-59.5	-46.3	176.7	-69.4	165.9	0	0	0	109.9	V51 G52 L57 V58 D59	V51-I55 HydrophobicContact CG1-CD1 3.95Å; V51-I55 HydrophobicContact CG1-CG1 4.45Å; V51-I55 WeakPolarHBondContact O-CG1 3.31Å; V51-I55 PolarHBondContact O-N 3.19Å; G52-I55 PolarHBondContact O-N 2.9Å; I55-L57 PolarHBondContact O-N 3.06Å; I55-V58 PolarHBondContact O-N 3.46Å; I55-D59 PolarHBondContact O-N 3.49Å
56	E	98.3	Very high	98.2	Very high	125 Å²	125	99.6 Å²	99.6	58%	0.584	52%	0.518	S	S	*	.	H	α-helix	trans	-60.5	-43.1	177.9	-70.9	177.4	-177.7	0	0	112.6	G52 G53 L54 D59 Q60	G52-E56 WeakPolarHBondContact O-CG 3.49Å; G52-E56 PolarHBondContact O-N 3.43Å; G52-E56 VanDerWaalsContact O-N 3.1Å; G53-E56 PolarHBondContact O-N 3.45Å; L54-E56 VanDerWaalsContact C-N 3.32Å; L54-E56 PolarHBondContact O-N 2.94Å; E56-D59 PolarHBondContact O-N 3.44Å; E56-Q60 WeakPolarHBondContact O-CG 3.42Å; E56-Q60 PolarHBondContact O-N 3.2Å
57	L	98.3	Very high	98.2	Very high	112 Å²	112	97.8 Å²	97.8	59%	0.586	51%	0.513	S	S	*	.	H	α-helix	trans	-63.2	-42.8	176.4	-81.5	166.9	0	0	0	112.1	G53 L54 I55 D59 Q60 L61	G53-L57 WeakPolarHBondContact O-CG 3.45Å; G53-L57 PolarHBondContact O-N 3.48Å; L54-L57 PolarHBondContact O-N 3.23Å; I55-L57 PolarHBondContact O-N 3.06Å; L57-D59 VanDerWaalsContact C-N 3.34Å; L57-Q60 PolarHBondContact O-N 2.95Å; L57-L61 WeakPolarHBondContact O-CB 3.48Å; L57-L61 PolarHBondContact O-N 3.01Å
58	V	98.3	Very high	98.2	Very high	81 Å²	81	96.7 Å²	96.7	49%	0.491	51%	0.509	S	S	.	.	H	α-helix	trans	-64.1	-41.2	177.6	170.8	0	0	0	0	110.9	L54 I55 L61 A62	L54-V58 HydrophobicContact CD1-CG2 4.24Å; L54-V58 HydrophobicContact CG-CG2 4.5Å; L54-V58 VanDerWaalsContact O-CG2 3.31Å; L54-V58 WeakPolarHBondContact O-CG2 3.45Å; L54-V58 PolarHBondContact O-N 3.42Å; I55-V58 PolarHBondContact O-N 3.46Å; V58-L61 PolarHBondContact O-N 3.26Å; V58-A62 WeakPolarHBondContact O-CB 3.5Å; V58-A62 PolarHBondContact O-N 2.91Å
59	D	98.4	Very high	98.2	Very high	90 Å²	90	95.7 Å²	95.7	48%	0.481	50%	0.503	S	S	.	.	H	α-helix	trans	-64.2	-39.6	176.4	-84	-8.4	0	0	0	112.5	I55 E56 L57 K63	I55-D59 PolarHBondContact O-N 3.49Å; E56-D59 PolarHBondContact O-N 3.44Å; L57-D59 VanDerWaalsContact C-N 3.34Å; D59-K63 WeakPolarHBondContact O-CG 3.32Å; D59-K63 PolarHBondContact O-N 3Å; D59-K63 VanDerWaalsContact O-N 3.16Å
60	Q	98.4	Very high	98.2	Very high	107 Å²	107	93.5 Å²	93.5	50%	0.5	50%	0.497	S	S	.	.	H	α-helix	trans	-64.1	-47.5	174.6	-73.2	175.3	12	0	0	111.1	E56 L57 A62 K63 E64	E56-Q60 WeakPolarHBondContact O-CG 3.42Å; E56-Q60 PolarHBondContact O-N 3.2Å; L57-Q60 PolarHBondContact O-N 2.95Å; Q60-A62 VanDerWaalsContact C-N 3.31Å; Q60-A62 PolarHBondContact O-N 2.69Å; Q60-K63 WeakPolarHBondContact O-CB 3.34Å; Q60-K63 PolarHBondContact O-N 3.16Å; Q60-K63 VanDerWaalsContact O-N 3.16Å; Q60-E64 PolarHBondContact O-N 2.94Å
61	L	98.3	Very high	98.2	Very high	113 Å²	113	93 Å²	93	59%	0.592	49%	0.49	S	S	*	.	H	α-helix	trans	-60.2	-40.9	178.2	-178.1	61.9	0	0	0	111.9	L57 V58 K63 E64 A65	L57-L61 WeakPolarHBondContact O-CB 3.48Å; L57-L61 PolarHBondContact O-N 3.01Å; V58-L61 PolarHBondContact O-N 3.26Å; L61-K63 VanDerWaalsContact C-N 3.35Å; L61-K63 PolarHBondContact O-N 3.38Å; L61-E64 PolarHBondContact O-N 3.47Å; L61-A65 WeakPolarHBondContact O-CB 3.33Å; L61-A65 PolarHBondContact O-N 3.16Å
62	A	98.3	Very high	98.2	Very high	52 Å²	52	93.5 Å²	93.5	43%	0.43	50%	0.499	S	S	.	.	H	α-helix	trans	-61.6	-42.1	176.5	0	0	0	0	0	112.1	V58 Q60 A65 E66	V58-A62 WeakPolarHBondContact O-CB 3.5Å; V58-A62 PolarHBondContact O-N 2.91Å; Q60-A62 VanDerWaalsContact C-N 3.31Å; Q60-A62 PolarHBondContact O-N 2.69Å; A62-A65 PolarHBondContact O-N 2.96Å; A62-E66 PolarHBondContact O-N 3.37Å
63	K	98.3	Very high	98.2	Very high	153 Å²	153	95.1 Å²	95.1	67%	0.665	50%	0.5	S	S	*	.	H	α-helix	trans	-64.5	-43.3	176.3	-72.9	170	-176.8	169.4	0	112	D59 Q60 L61 E66 N67	D59-K63 WeakPolarHBondContact O-CG 3.32Å; D59-K63 PolarHBondContact O-N 3Å; D59-K63 VanDerWaalsContact O-N 3.16Å; Q60-K63 WeakPolarHBondContact O-CB 3.34Å; Q60-K63 PolarHBondContact O-N 3.16Å; Q60-K63 VanDerWaalsContact O-N 3.16Å; L61-K63 VanDerWaalsContact C-N 3.35Å; L61-K63 PolarHBondContact O-N 3.38Å; K63-E66 PolarHBondContact O-N 3.35Å; K63-N67 WeakPolarHBondContact O-CB 3.34Å; K63-N67 PolarHBondContact O-N 3.35Å
64	E	98.3	Very high	98.2	Very high	123 Å²	123	95.6 Å²	95.6	58%	0.575	51%	0.505	S	S	*	.	H	α-helix	trans	-64.2	-44.3	177.3	-72	-177	-178.4	0	0	111.7	Q60 L61 E66 N67 E68	Q60-E64 PolarHBondContact O-N 2.94Å; L61-E64 PolarHBondContact O-N 3.47Å; E64-E66 VanDerWaalsContact C-N 3.35Å; E64-E66 PolarHBondContact O-N 2.95Å; E64-N67 WeakPolarHBondContact O-CB 3.49Å; E64-N67 PolarHBondContact O-N 3.36Å; E64-E68 PolarHBondContact O-N 3.43Å
65	A	98.3	Very high	98.2	Very high	57 Å²	57	93.1 Å²	93.1	47%	0.471	50%	0.5	S	S	.	.	H	α-helix	trans	-59.8	-43.7	177.2	0	0	0	0	0	112	L61 A62 E68 K69	L61-A65 WeakPolarHBondContact O-CB 3.33Å; L61-A65 PolarHBondContact O-N 3.16Å; A62-A65 PolarHBondContact O-N 2.96Å; A65-E68 PolarHBondContact O-N 2.95Å; A65-K69 WeakPolarHBondContact O-CB 3.39Å; A65-K69 PolarHBondContact O-N 2.92Å
66	E	98.1	Very high	98.2	Very high	97 Å²	97	96.8 Å²	96.8	45%	0.453	51%	0.508	S	S	.	.	H	α-helix	trans	-68.6	-35.5	176.6	-78.9	-58.5	165.8	0	0	112.9	A62 K63 E64 K69 M70	A62-E66 PolarHBondContact O-N 3.37Å; K63-E66 PolarHBondContact O-N 3.35Å; E64-E66 VanDerWaalsContact C-N 3.35Å; E64-E66 PolarHBondContact O-N 2.95Å; E66-K69 VanDerWaalsContact CD-NZ 3.31Å; E66-K69 PolarHBondContact O-N 2.91Å; E66-K69 IonicContact OE1-NZ 3.84Å; E66-K69 PolarHBondContact OE1-NZ 3.3Å; E66-K69 WeakPolarHBondContact OE2-CD 3.28Å; E66-K69 IonicContact OE2-NZ 3.98Å; E66-K69 PolarHBondContact OE2-NZ 3.48Å; E66-M70 WeakPolarHBondContact O-CB 3.46Å; E66-M70 WeakPolarHBondContact O-CG 3.34Å; E66-M70 PolarHBondContact O-N 3.31Å
67	N	98.3	Very high	98.2	Very high	87 Å²	87	94.9 Å²	94.9	47%	0.465	50%	0.502	S	S	.	.	H	α-helix	trans	-61	-48.5	173.2	-173.4	24.5	0	0	0	111.6	K63 E64 K69 M70 K71	K63-N67 WeakPolarHBondContact O-CB 3.34Å; K63-N67 PolarHBondContact O-N 3.35Å; E64-N67 WeakPolarHBondContact O-CB 3.49Å; E64-N67 PolarHBondContact O-N 3.36Å; N67-K69 PolarHBondContact O-N 3.4Å; N67-M70 PolarHBondContact O-N 3.04Å; N67-K71 WeakPolarHBondContact O-CG 3.23Å; N67-K71 PolarHBondContact O-N 2.99Å
68	E	98.3	Very high	98.1	Very high	104 Å²	104	94.7 Å²	94.7	49%	0.486	50%	0.501	S	S	.	.	H	α-helix	trans	-65.4	-38.9	178.3	-71.6	-53.6	135	0	0	112.4	E64 A65 M70 K71 A72	E64-E68 PolarHBondContact O-N 3.43Å; A65-E68 PolarHBondContact O-N 2.95Å; E68-M70 VanDerWaalsContact C-N 3.32Å; E68-M70 PolarHBondContact O-N 3.47Å; E68-K71 PolarHBondContact O-N 3.46Å; E68-K71 IonicContact OE1-NZ 3.62Å; E68-K71 PolarHBondContact OE1-NZ 3.23Å; E68-A72 WeakPolarHBondContact O-CB 3.37Å; E68-A72 PolarHBondContact O-N 3.26Å
69	K	98.4	Very high	98	Very high	108 Å²	108	96.5 Å²	96.5	47%	0.47	51%	0.507	S	S	.	.	H	α-helix	trans	-59.1	-43.7	172.8	-175.5	-154.9	-171.2	177.1	0	111.5	A65 E66 N67 A72 I73	A65-K69 WeakPolarHBondContact O-CB 3.39Å; A65-K69 PolarHBondContact O-N 2.92Å; E66-K69 VanDerWaalsContact CD-NZ 3.31Å; E66-K69 PolarHBondContact O-N 2.91Å; E66-K69 IonicContact OE1-NZ 3.84Å; E66-K69 PolarHBondContact OE1-NZ 3.3Å; E66-K69 WeakPolarHBondContact OE2-CD 3.28Å; E66-K69 IonicContact OE2-NZ 3.98Å; E66-K69 PolarHBondContact OE2-NZ 3.48Å; N67-K69 PolarHBondContact O-N 3.4Å; K69-A72 PolarHBondContact O-N 2.94Å; K69-I73 HydrophobicContact CG-CD1 4.13Å; K69-I73 VanDerWaalsContact O-CG1 3.29Å; K69-I73 WeakPolarHBondContact O-CG1 3.27Å; K69-I73 PolarHBondContact O-N 2.93Å
70	M	98.1	Very high	98	Very high	120 Å²	120	100 Å²	100	59%	0.591	52%	0.518	S	S	*	.	H	α-helix	trans	-63.5	-42	176.8	-75	-59.7	-65.7	0	0	112.2	E66 N67 E68 I73 G74	E66-M70 WeakPolarHBondContact O-CB 3.46Å; E66-M70 WeakPolarHBondContact O-CG 3.34Å; E66-M70 PolarHBondContact O-N 3.31Å; N67-M70 PolarHBondContact O-N 3.04Å; E68-M70 VanDerWaalsContact C-N 3.32Å; E68-M70 PolarHBondContact O-N 3.47Å; M70-I73 PolarHBondContact O-N 2.99Å; M70-I73 HydrophobicContact SD-CD1 4.39Å; M70-G74 PolarHBondContact O-N 3.26Å
71	K	98.1	Very high	97.9	Very high	112 Å²	112	98.2 Å²	98.2	49%	0.487	52%	0.517	S	S	.	.	H	α-helix	trans	-60.4	-45.2	173.6	-69.2	175.4	-171	170	0	111.8	N67 E68 I73 G74 A75	N67-K71 WeakPolarHBondContact O-CG 3.23Å; N67-K71 PolarHBondContact O-N 2.99Å; E68-K71 PolarHBondContact O-N 3.46Å; E68-K71 IonicContact OE1-NZ 3.62Å; E68-K71 PolarHBondContact OE1-NZ 3.23Å; K71-I73 PolarHBondContact O-N 3.45Å; K71-G74 PolarHBondContact O-N 2.89Å; K71-A75 PolarHBondContact O-N 3.1Å
72	A	98.3	Very high	97.9	Very high	62 Å²	62	95.8 Å²	95.8	51%	0.512	51%	0.505	S	S	.	.	H	α-helix	trans	-62.3	-42.5	178.3	0	0	0	0	0	112.1	E68 K69 G74 A75 R76	E68-A72 WeakPolarHBondContact O-CB 3.37Å; E68-A72 PolarHBondContact O-N 3.26Å; K69-A72 PolarHBondContact O-N 2.94Å; A72-G74 VanDerWaalsContact C-N 3.35Å; A72-A75 PolarHBondContact O-N 3.25Å; A72-R76 WeakPolarHBondContact O-CB 3.37Å; A72-R76 PolarHBondContact O-N 2.91Å
73	I	97.9	Very high	97.8	Very high	63 Å²	63	96.1 Å²	96.1	32%	0.323	51%	0.507	S	S	.	.	H	α-helix	trans	-60.7	-45.6	173.5	-68.8	165.7	0	0	0	110.4	K69 M70 K71 R76 N77	K69-I73 HydrophobicContact CG-CD1 4.13Å; K69-I73 VanDerWaalsContact O-CG1 3.29Å; K69-I73 WeakPolarHBondContact O-CG1 3.27Å; K69-I73 PolarHBondContact O-N 2.93Å; M70-I73 PolarHBondContact O-N 2.99Å; M70-I73 HydrophobicContact SD-CD1 4.39Å; K71-I73 PolarHBondContact O-N 3.45Å; I73-R76 PolarHBondContact O-N 3.18Å; I73-N77 WeakPolarHBondContact O-CB 3.34Å; I73-N77 VanDerWaalsContact O-CG 3.25Å; I73-N77 PolarHBondContact O-N 3.21Å
74	G	98	Very high	97.7	Very high	39 Å²	39	96.3 Å²	96.3	40%	0.402	51%	0.508	S	S	.	.	H	α-helix	trans	-58.2	-50.1	177.2	0	0	0	0	0	112.6	M70 K71 A72 R76 N77 L78	M70-G74 PolarHBondContact O-N 3.26Å; K71-G74 PolarHBondContact O-N 2.89Å; A72-G74 VanDerWaalsContact C-N 3.35Å; G74-R76 VanDerWaalsContact C-N 3.34Å; G74-R76 PolarHBondContact O-N 3.03Å; G74-N77 PolarHBondContact O-N 2.88Å; G74-L78 PolarHBondContact O-N 2.98Å
75	A	97.7	Very high	97.6	Very high	54 Å²	54	95.7 Å²	95.7	45%	0.446	51%	0.505	S	S	.	.	H	α-helix	trans	-60.4	-42.9	177.1	0	0	0	0	0	112.1	K71 A72 N77 L78 L79	K71-A75 PolarHBondContact O-N 3.1Å; A72-A75 PolarHBondContact O-N 3.25Å; A75-N77 VanDerWaalsContact C-N 3.35Å; A75-N77 PolarHBondContact O-N 3.45Å; A75-L78 PolarHBondContact O-N 3.42Å; A75-L79 WeakPolarHBondContact O-CG 3.32Å; A75-L79 PolarHBondContact O-N 3.37Å
76	R	97.8	Very high	97.6	Very high	173 Å²	173	101.5 Å²	101.5	65%	0.653	52%	0.515	S	S	*	.	H	α-helix	trans	-61.7	-42.8	176.5	-168.9	-179.6	77.7	168.6	2.7	112	A72 I73 G74 L79 K80	A72-R76 WeakPolarHBondContact O-CB 3.37Å; A72-R76 PolarHBondContact O-N 2.91Å; I73-R76 PolarHBondContact O-N 3.18Å; G74-R76 VanDerWaalsContact C-N 3.34Å; G74-R76 PolarHBondContact O-N 3.03Å; R76-L79 PolarHBondContact O-N 3.37Å; R76-K80 PolarHBondContact O-N 3.2Å
77	N	97.8	Very high	97.5	Very high	85 Å²	85	102.3 Å²	102.3	46%	0.455	52%	0.518	S	S	.	.	H	α-helix	trans	-65.6	-40.5	178.4	-72.5	-12.6	0	0	0	111.5	I73 G74 A75 K80 S81	I73-N77 WeakPolarHBondContact O-CB 3.34Å; I73-N77 VanDerWaalsContact O-CG 3.25Å; I73-N77 PolarHBondContact O-N 3.21Å; G74-N77 PolarHBondContact O-N 2.88Å; A75-N77 VanDerWaalsContact C-N 3.35Å; A75-N77 PolarHBondContact O-N 3.45Å; N77-K80 PolarHBondContact O-N 3.15Å; N77-S81 PolarHBondContact O-N 3.03Å
78	L	97.3	Very high	97.5	Very high	109 Å²	109	100.3 Å²	100.3	57%	0.571	51%	0.514	S	S	*	.	H	α-helix	trans	-60.5	-48.6	175.3	-178.2	64.6	0	0	0	111.4	G74 A75 K80 S81 I82	G74-L78 PolarHBondContact O-N 2.98Å; A75-L78 PolarHBondContact O-N 3.42Å; L78-K80 VanDerWaalsContact C-N 3.31Å; L78-K80 PolarHBondContact O-N 2.93Å; L78-S81 WeakPolarHBondContact O-CB 3.39Å; L78-S81 PolarHBondContact O-N 3.39Å; L78-S81 VanDerWaalsContact O-N 3.12Å; L78-I82 HydrophobicContact CD1-CD1 4.29Å; L78-I82 HydrophobicContact CD1-CG1 4.5Å; L78-I82 HydrophobicContact CG-CD1 3.96Å; L78-I82 WeakPolarHBondContact O-CG1 3.47Å; L78-I82 PolarHBondContact O-N 3.49Å
79	L	97	Very high	97.4	Very high	119 Å²	119	99.9 Å²	99.9	62%	0.623	51%	0.512	S	S	*	.	H	α-helix	trans	-58.3	-43.6	177.1	-74.4	173.6	0	0	0	112.1	A75 R76 S81 I82 A83	A75-L79 WeakPolarHBondContact O-CG 3.32Å; A75-L79 PolarHBondContact O-N 3.37Å; R76-L79 PolarHBondContact O-N 3.37Å; L79-S81 VanDerWaalsContact C-N 3.32Å; L79-S81 PolarHBondContact O-N 3.31Å; L79-I82 PolarHBondContact O-N 2.91Å; L79-A83 PolarHBondContact O-N 3.43Å
80	K	97.3	Very high	97.4	Very high	162 Å²	162	100.3 Å²	100.3	70%	0.704	52%	0.516	S	S	*	.	H	α-helix	trans	-61.9	-40.5	176.2	-170.6	176.4	-178.8	179.4	0	111.8	R76 N77 L78 A83 K84	R76-K80 PolarHBondContact O-N 3.2Å; N77-K80 PolarHBondContact O-N 3.15Å; L78-K80 VanDerWaalsContact C-N 3.31Å; L78-K80 PolarHBondContact O-N 2.93Å; K80-A83 PolarHBondContact O-N 3.48Å; K80-K84 PolarHBondContact O-N 3.44Å; K80-K84 VanDerWaalsContact O-N 3.13Å
81	S	97	Very high	97.3	Very high	70 Å²	70	100.1 Å²	100.1	49%	0.49	51%	0.513	S	S	.	.	H	α-helix	trans	-64.4	-44.6	176.1	-171.5	0	0	0	0	111.8	N77 L78 L79 A83 K84 Q85	N77-S81 PolarHBondContact O-N 3.03Å; L78-S81 WeakPolarHBondContact O-CB 3.39Å; L78-S81 PolarHBondContact O-N 3.39Å; L78-S81 VanDerWaalsContact O-N 3.12Å; L79-S81 VanDerWaalsContact C-N 3.32Å; L79-S81 PolarHBondContact O-N 3.31Å; S81-A83 VanDerWaalsContact C-N 3.35Å; S81-A83 PolarHBondContact O-N 2.93Å; S81-K84 PolarHBondContact O-N 3.19Å; S81-Q85 WeakPolarHBondContact O-CB 3.45Å; S81-Q85 PolarHBondContact O-N 3.28Å
82	I	96.8	Very high	97.3	Very high	63 Å²	63	101.4 Å²	101.4	32%	0.323	52%	0.521	S	S	.	.	H	α-helix	trans	-61.7	-43.8	177.9	-68.5	167.7	0	0	0	110.7	L78 L79 K84 Q85 R86	L78-I82 HydrophobicContact CD1-CD1 4.29Å; L78-I82 HydrophobicContact CD1-CG1 4.5Å; L78-I82 HydrophobicContact CG-CD1 3.96Å; L78-I82 WeakPolarHBondContact O-CG1 3.47Å; L78-I82 PolarHBondContact O-N 3.49Å; L79-I82 PolarHBondContact O-N 2.91Å; I82-K84 VanDerWaalsContact C-N 3.35Å; I82-K84 PolarHBondContact O-N 3.31Å; I82-Q85 PolarHBondContact O-N 3.17Å; I82-R86 HydrophobicContact CG2-CG 4.46Å; I82-R86 WeakPolarHBondContact O-CB 3.5Å; I82-R86 WeakPolarHBondContact O-CG 3.3Å; I82-R86 PolarHBondContact O-N 2.87Å
83	A	96.1	Very high	97.3	Very high	58 Å²	58	103.7 Å²	103.7	48%	0.479	52%	0.524	S	S	.	.	H	α-helix	trans	-59.2	-46.1	177	0	0	0	0	0	111.6	L79 K80 S81 Q85 R86 E87	L79-A83 PolarHBondContact O-N 3.43Å; K80-A83 PolarHBondContact O-N 3.48Å; S81-A83 VanDerWaalsContact C-N 3.35Å; S81-A83 PolarHBondContact O-N 2.93Å; A83-Q85 PolarHBondContact O-N 2.91Å; A83-R86 PolarHBondContact O-N 3.38Å; A83-E87 PolarHBondContact O-N 3.34Å
84	K	96.9	Very high	97.3	Very high	158 Å²	158	106.2 Å²	106.2	69%	0.687	53%	0.534	S	S	*	.	H	α-helix	trans	-63.6	-40.6	176.8	-170.8	178.1	-179.3	-178.1	0	112.3	K80 S81 I82 E87 A88	K80-K84 PolarHBondContact O-N 3.44Å; K80-K84 VanDerWaalsContact O-N 3.13Å; S81-K84 PolarHBondContact O-N 3.19Å; I82-K84 VanDerWaalsContact C-N 3.35Å; I82-K84 PolarHBondContact O-N 3.31Å; K84-E87 PolarHBondContact O-N 2.87Å; K84-A88 WeakPolarHBondContact O-CB 3.38Å; K84-A88 PolarHBondContact O-N 2.7Å
85	Q	96.9	Very high	97.3	Very high	110 Å²	110	107.3 Å²	107.3	51%	0.514	54%	0.54	S	S	.	.	H	α-helix	trans	-64.3	-42.7	176.5	-174.5	179.1	7.3	0	0	111.5	S81 I82 A83 A88 Q89	S81-Q85 WeakPolarHBondContact O-CB 3.45Å; S81-Q85 PolarHBondContact O-N 3.28Å; I82-Q85 PolarHBondContact O-N 3.17Å; A83-Q85 PolarHBondContact O-N 2.91Å; Q85-A88 PolarHBondContact O-N 3.08Å; Q85-Q89 WeakPolarHBondContact O-CB 3.42Å; Q85-Q89 WeakPolarHBondContact O-CG 3.3Å; Q85-Q89 PolarHBondContact O-N 3.07Å
86	R	97.1	Very high	97.3	Very high	178 Å²	178	108.9 Å²	108.9	67%	0.672	54%	0.54	S	S	*	.	H	α-helix	trans	-60.9	-44.8	175.6	-77.7	-177.9	178	-169	-0.1	111.8	I82 A83 Q89 Q90	I82-R86 HydrophobicContact CG2-CG 4.46Å; I82-R86 WeakPolarHBondContact O-CB 3.5Å; I82-R86 WeakPolarHBondContact O-CG 3.3Å; I82-R86 PolarHBondContact O-N 2.87Å; A83-R86 PolarHBondContact O-N 3.38Å; R86-Q89 PolarHBondContact O-N 3.47Å; R86-Q90 WeakPolarHBondContact O-CB 3.41Å; R86-Q90 PolarHBondContact O-N 3.25Å
87	E	97.1	Very high	97.3	Very high	114 Å²	114	105.2 Å²	105.2	53%	0.533	53%	0.533	S	S	.	.	H	α-helix	trans	-60.9	-46.3	177.6	-171.8	-178.8	-179.9	0	0	111.5	A83 K84 Q89 Q90 Q91	A83-E87 PolarHBondContact O-N 3.34Å; K84-E87 PolarHBondContact O-N 2.87Å; E87-Q89 PolarHBondContact O-N 2.94Å; E87-Q90 PolarHBondContact O-N 2.91Å; E87-Q91 WeakPolarHBondContact O-CG 3.35Å; E87-Q91 PolarHBondContact O-N 2.95Å
88	A	97.1	Very high	97.3	Very high	45 Å²	45	103.7 Å²	103.7	37%	0.372	53%	0.532	S	S	.	.	H	α-helix	trans	-61.3	-43.5	176.3	0	0	0	0	0	112.3	K84 Q85 Q90 Q91 Q92	K84-A88 WeakPolarHBondContact O-CB 3.38Å; K84-A88 PolarHBondContact O-N 2.7Å; Q85-A88 PolarHBondContact O-N 3.08Å; A88-Q90 VanDerWaalsContact C-N 3.34Å; A88-Q90 PolarHBondContact O-N 3.21Å; A88-Q91 PolarHBondContact O-N 3.28Å; A88-Q92 WeakPolarHBondContact O-CG 3.46Å; A88-Q92 PolarHBondContact O-N 3.15Å
89	Q	97.2	Very high	97.3	Very high	95 Å²	95	103.2 Å²	103.2	44%	0.444	53%	0.527	S	S	.	.	H	α-helix	trans	-62.1	-41.4	175.8	-76.8	177.7	-20.1	0	0	111.9	Q85 R86 E87 Q92 L93	Q85-Q89 WeakPolarHBondContact O-CB 3.42Å; Q85-Q89 WeakPolarHBondContact O-CG 3.3Å; Q85-Q89 PolarHBondContact O-N 3.07Å; R86-Q89 PolarHBondContact O-N 3.47Å; E87-Q89 PolarHBondContact O-N 2.94Å; Q89-Q92 PolarHBondContact O-N 3.25Å; Q89-L93 WeakPolarHBondContact O-CG 3.41Å; Q89-L93 PolarHBondContact O-N 3.4Å
90	Q	97.5	Very high	97.3	Very high	118 Å²	118	103 Å²	103	55%	0.551	52%	0.521	S	S	*	.	H	α-helix	trans	-63	-44.2	177.5	-176.1	177.4	-9	0	0	111.6	R86 E87 A88 L93 Q94	R86-Q90 WeakPolarHBondContact O-CB 3.41Å; R86-Q90 PolarHBondContact O-N 3.25Å; E87-Q90 PolarHBondContact O-N 2.91Å; A88-Q90 VanDerWaalsContact C-N 3.34Å; A88-Q90 PolarHBondContact O-N 3.21Å; Q90-L93 PolarHBondContact O-N 2.93Å; Q90-Q94 WeakPolarHBondContact O-CG 3.45Å; Q90-Q94 PolarHBondContact O-N 3.27Å
91	Q	97.5	Very high	97.3	Very high	115 Å²	115	102 Å²	102	54%	0.537	52%	0.516	S	S	.	.	H	α-helix	trans	-62.2	-43.1	175.9	-71.2	176.8	2.8	0	0	111.7	E87 A88 L93 Q94 A95	E87-Q91 WeakPolarHBondContact O-CG 3.35Å; E87-Q91 PolarHBondContact O-N 2.95Å; A88-Q91 PolarHBondContact O-N 3.28Å; Q91-L93 PolarHBondContact O-N 2.94Å; Q91-Q94 PolarHBondContact O-N 2.98Å; Q91-A95 PolarHBondContact O-N 3.08Å
92	Q	97.5	Very high	97.2	Very high	140 Å²	140	102.8 Å²	102.8	65%	0.654	52%	0.518	S	S	*	.	H	α-helix	trans	-60.5	-45	175.4	-76.2	-179.6	-23.2	0	0	112.2	A88 Q89 A95 L96	A88-Q92 WeakPolarHBondContact O-CG 3.46Å; A88-Q92 PolarHBondContact O-N 3.15Å; Q89-Q92 PolarHBondContact O-N 3.25Å; Q92-A95 PolarHBondContact O-N 3.07Å; Q92-L96 PolarHBondContact O-N 3.39Å
93	L	97.8	Very high	97.2	Very high	110 Å²	110	102.7 Å²	102.7	58%	0.576	52%	0.517	S	S	*	.	H	α-helix	trans	-64	-40.6	177.4	-73.3	170.6	0	0	0	111.9	Q89 Q90 Q91 L96 I97	Q89-L93 WeakPolarHBondContact O-CG 3.41Å; Q89-L93 PolarHBondContact O-N 3.4Å; Q90-L93 PolarHBondContact O-N 2.93Å; Q91-L93 PolarHBondContact O-N 2.94Å; L93-L96 PolarHBondContact O-N 2.92Å; L93-I97 VanDerWaalsContact O-CG1 3.26Å; L93-I97 WeakPolarHBondContact O-CG1 3.36Å; L93-I97 PolarHBondContact O-N 2.9Å
94	Q	97.8	Very high	97.2	Very high	115 Å²	115	104.1 Å²	104.1	54%	0.537	52%	0.516	S	S	.	.	H	α-helix	trans	-63	-42.6	175.9	-76.3	178.9	-10.6	0	0	112.1	Q90 Q91 I97 A98	Q90-Q94 WeakPolarHBondContact O-CG 3.45Å; Q90-Q94 PolarHBondContact O-N 3.27Å; Q91-Q94 PolarHBondContact O-N 2.98Å; Q94-I97 PolarHBondContact O-N 2.98Å; Q94-A98 WeakPolarHBondContact O-CB 3.46Å; Q94-A98 PolarHBondContact O-N 3.04Å
95	A	97.6	Very high	97	Very high	63 Å²	63	101.3 Å²	101.3	52%	0.521	51%	0.505	S	S	.	.	H	α-helix	trans	-60.9	-44.7	175.1	0	0	0	0	0	111.5	Q91 Q92 I97 A98 E99	Q91-A95 PolarHBondContact O-N 3.08Å; Q92-A95 PolarHBondContact O-N 3.07Å; A95-I97 PolarHBondContact O-N 3.28Å; A95-A98 PolarHBondContact O-N 2.95Å; A95-E99 PolarHBondContact O-N 3.49Å
96	L	98.1	Very high	96.9	Very high	86 Å²	86	104.2 Å²	104.2	45%	0.45	51%	0.511	S	S	.	.	H	α-helix	trans	-63.1	-41.8	177.3	-174.1	67.2	0	0	0	112.1	Q92 L93 A98 E99 K100	Q92-L96 PolarHBondContact O-N 3.39Å; L93-L96 PolarHBondContact O-N 2.92Å; L96-A98 VanDerWaalsContact C-N 3.33Å; L96-A98 PolarHBondContact O-N 3.09Å; L96-E99 PolarHBondContact O-N 2.8Å; L96-K100 WeakPolarHBondContact O-CB 3.45Å; L96-K100 VanDerWaalsContact O-CG 3.29Å; L96-K100 WeakPolarHBondContact O-CG 3.47Å; L96-K100 PolarHBondContact O-N 3.49Å
97	I	97.8	Very high	96.8	Very high	97 Å²	97	102.7 Å²	102.7	50%	0.497	51%	0.506	S	S	.	.	H	α-helix	trans	-61.3	-43.7	175.3	-70.7	165.2	0	0	0	110.5	L93 Q94 A95 K100 K101	L93-I97 VanDerWaalsContact O-CG1 3.26Å; L93-I97 WeakPolarHBondContact O-CG1 3.36Å; L93-I97 PolarHBondContact O-N 2.9Å; Q94-I97 PolarHBondContact O-N 2.98Å; A95-I97 PolarHBondContact O-N 3.28Å; I97-K100 PolarHBondContact O-N 3.38Å; I97-K101 HydrophobicContact CG2-CD 4.34Å; I97-K101 WeakPolarHBondContact O-CG 3.49Å; I97-K101 PolarHBondContact O-N 2.91Å
98	A	97.6	Very high	96.6	Very high	52 Å²	52	104.8 Å²	104.8	43%	0.43	51%	0.509	S	S	.	.	H	α-helix	trans	-63.8	-42.8	178.6	0	0	0	0	0	111.9	Q94 A95 L96 K101 T102	Q94-A98 WeakPolarHBondContact O-CB 3.46Å; Q94-A98 PolarHBondContact O-N 3.04Å; A95-A98 PolarHBondContact O-N 2.95Å; L96-A98 VanDerWaalsContact C-N 3.33Å; L96-A98 PolarHBondContact O-N 3.09Å; A98-K101 PolarHBondContact O-N 3.35Å; A98-T102 PolarHBondContact O-N 3.18Å; A98-T102 PolarHBondContact O-OG1 3.28Å
99	E	97.4	Very high	96.3	Very high	100 Å²	100	108.6 Å²	108.6	47%	0.467	53%	0.528	S	S	.	.	H	α-helix	trans	-59.1	-49	174.6	-168.5	-163.4	149.3	0	0	111.2	A95 L96 K101 T102 Q103	A95-E99 PolarHBondContact O-N 3.49Å; L96-E99 PolarHBondContact O-N 2.8Å; E99-K101 PolarHBondContact O-N 3.4Å; E99-T102 WeakPolarHBondContact O-CB 3.48Å; E99-T102 PolarHBondContact O-N 3.2Å; E99-Q103 WeakPolarHBondContact O-CG 3.31Å; E99-Q103 PolarHBondContact O-N 3.02Å; E99-Q103 PolarHBondContact OE1-NE2 2.83Å
100	K	97.6	Very high	95.6	Very high	115 Å²	115	110.4 Å²	110.4	50%	0.5	54%	0.536	S	S	.	.	H	α-helix	trans	-64.5	-39.3	-179.8	-68.8	-70.7	163.8	-156.3	0	112.8	L96 I97 T102 Q103 L104	L96-K100 WeakPolarHBondContact O-CB 3.45Å; L96-K100 VanDerWaalsContact O-CG 3.29Å; L96-K100 WeakPolarHBondContact O-CG 3.47Å; L96-K100 PolarHBondContact O-N 3.49Å; I97-K100 PolarHBondContact O-N 3.38Å; K100-T102 VanDerWaalsContact C-N 3.33Å; K100-Q103 PolarHBondContact O-N 3.43Å; K100-L104 WeakPolarHBondContact O-CB 3.44Å; K100-L104 PolarHBondContact O-N 2.86Å
101	K	96.6	Very high	93.9	Very high	140 Å²	140	117 Å²	117	61%	0.609	56%	0.558	S	S	*	*	H	α-helix	trans	-61.1	-43.3	172.9	-78.2	-176.9	177.7	-176.2	0	111.5	I97 A98 E99 L104 E105	I97-K101 HydrophobicContact CG2-CD 4.34Å; I97-K101 WeakPolarHBondContact O-CG 3.49Å; I97-K101 PolarHBondContact O-N 2.91Å; A98-K101 PolarHBondContact O-N 3.35Å; E99-K101 PolarHBondContact O-N 3.4Å; K101-L104 PolarHBondContact O-N 3.28Å; K101-E105 WeakPolarHBondContact O-CG 3.38Å; K101-E105 PolarHBondContact O-N 3.28Å
102	T	96.4	Very high	93.7	Very high	86 Å²	86	117.1 Å²	117.1	53%	0.528	56%	0.559	S	S	.	*	H	α-helix	trans	-63.6	-42.3	178.1	-53.9	0	0	0	0	111.6	A98 E99 K100 L104 E105 R106	A98-T102 PolarHBondContact O-N 3.18Å; A98-T102 PolarHBondContact O-OG1 3.28Å; E99-T102 WeakPolarHBondContact O-CB 3.48Å; E99-T102 PolarHBondContact O-N 3.2Å; K100-T102 VanDerWaalsContact C-N 3.33Å; T102-L104 VanDerWaalsContact C-N 3.34Å; T102-E105 PolarHBondContact O-N 2.9Å; T102-R106 PolarHBondContact O-N 2.86Å
103	Q	95.3	Very high	93.5	Very high	62 Å²	62	115.8 Å²	115.8	29%	0.29	55%	0.554	S	S	.	*	H	α-helix	trans	-60.6	-42.8	173.8	-73.8	170.1	2.9	0	0	111.6	E99 K100 R106 Y107	E99-Q103 WeakPolarHBondContact O-CG 3.31Å; E99-Q103 PolarHBondContact O-N 3.02Å; E99-Q103 PolarHBondContact OE1-NE2 2.83Å; K100-Q103 PolarHBondContact O-N 3.43Å; Q103-R106 WeakPolarHBondContact O-CB 3.37Å; Q103-R106 PolarHBondContact O-N 3.26Å; Q103-Y107 VanDerWaalsContact O-CD2 3.22Å; Q103-Y107 WeakPolarHBondContact O-CD2 3.39Å; Q103-Y107 PolarHBondContact O-N 3.26Å; Q103-Y107 VanDerWaalsContact O-N 3.08Å
104	L	95.7	Very high	93.2	Very high	88 Å²	88	116.2 Å²	116.2	46%	0.461	55%	0.552	S	S	.	*	H	α-helix	trans	-65.4	-42	179.3	-173.6	138.5	0	0	0	112.5	K100 K101 T102 R106 Y107 R108	K100-L104 WeakPolarHBondContact O-CB 3.44Å; K100-L104 PolarHBondContact O-N 2.86Å; K101-L104 PolarHBondContact O-N 3.28Å; T102-L104 VanDerWaalsContact C-N 3.34Å; L104-R106 VanDerWaalsContact C-N 3.34Å; L104-Y107 PolarHBondContact O-N 2.84Å; L104-R108 WeakPolarHBondContact O-CG 3.5Å; L104-R108 PolarHBondContact O-N 3.33Å; L104-R108 VanDerWaalsContact O-N 3.1Å
105	E	94.6	Very high	93	Very high	98 Å²	98	116.2 Å²	116.2	46%	0.458	55%	0.553	S	S	.	*	H	α-helix	trans	-65.3	-36.8	175	-69.7	-55.9	141.1	0	0	112.1	K101 T102 R108 V109	K101-E105 WeakPolarHBondContact O-CG 3.38Å; K101-E105 PolarHBondContact O-N 3.28Å; T102-E105 PolarHBondContact O-N 2.9Å; E105-R108 PolarHBondContact O-N 2.71Å; E105-R108 IonicContact OE1-CZ 2.77Å; E105-R108 IonicContact OE1-NH1 2.69Å; E105-R108 PolarHBondContact OE1-NH1 3Å; E105-R108 IonicContact OE2-NH1 2.98Å; E105-V109 WeakPolarHBondContact O-CG2 3.33Å; E105-V109 PolarHBondContact O-N 2.78Å
106	R	94.3	Very high	92.7	Very high	171 Å²	171	119.6 Å²	119.6	65%	0.645	56%	0.555	S	S	*	*	H	α-helix	trans	-58.4	-50	171.6	-81	-178.2	154.4	-161.3	-6.8	112	T102 Q103 L104 R108 V109 E110	T102-R106 PolarHBondContact O-N 2.86Å; Q103-R106 WeakPolarHBondContact O-CB 3.37Å; Q103-R106 PolarHBondContact O-N 3.26Å; L104-R106 VanDerWaalsContact C-N 3.34Å; R106-R108 PolarHBondContact O-N 2.79Å; R106-V109 PolarHBondContact O-N 3.03Å; R106-E110 WeakPolarHBondContact O-CG 3.43Å; R106-E110 PolarHBondContact O-N 2.91Å; R106-E110 VanDerWaalsContact O-N 3.11Å
107	Y	94.1	Very high	92.3	Very high	146 Å²	146	121.8 Å²	121.8	57%	0.573	56%	0.562	S	S	*	*	H	α-helix	trans	-62.4	-29.7	179.3	-68.2	-45.3	0	0	0	113.4	Q103 L104 V109 Y111	Q103-Y107 VanDerWaalsContact O-CD2 3.22Å; Q103-Y107 WeakPolarHBondContact O-CD2 3.39Å; Q103-Y107 PolarHBondContact O-N 3.26Å; Q103-Y107 VanDerWaalsContact O-N 3.08Å; L104-Y107 PolarHBondContact O-N 2.84Å; Y107-V109 VanDerWaalsContact C-N 3.32Å; Y107-Y111 PolarHBondContact O-N 3.01Å
108	R	92.4	Very high	91.9	Very high	158 Å²	158	123.6 Å²	123.6	60%	0.596	57%	0.567	S	S	*	*	H	α-helix	trans	-71	-23.5	174.7	-77.8	177.7	169.3	177.7	-6.7	114.4	L104 E105 R106	L104-R108 WeakPolarHBondContact O-CG 3.5Å; L104-R108 PolarHBondContact O-N 3.33Å; L104-R108 VanDerWaalsContact O-N 3.1Å; E105-R108 PolarHBondContact O-N 2.71Å; E105-R108 IonicContact OE1-CZ 2.77Å; E105-R108 IonicContact OE1-NH1 2.69Å; E105-R108 PolarHBondContact OE1-NH1 3Å; E105-R108 IonicContact OE2-NH1 2.98Å; R106-R108 PolarHBondContact O-N 2.79Å
109	V	92	Very high	91.5	Very high	125 Å²	125	129.1 Å²	129.1	76%	0.758	58%	0.578	S	S	*	*	H	α-helix	trans	-89.7	-29.1	177.8	175.2	0	0	0	0	110.7	E105 R106 Y107	E105-V109 WeakPolarHBondContact O-CG2 3.33Å; E105-V109 PolarHBondContact O-N 2.78Å; R106-V109 PolarHBondContact O-N 3.03Å; Y107-V109 VanDerWaalsContact C-N 3.32Å
110	E	82.9	Confident	91	Very high	133 Å²	133	131.5 Å²	131.5	62%	0.621	59%	0.587	S	S	*	*	H	α-helix	trans	-80.6	-12.7	-179.6	-70.3	176.2	-179.4	0	0	114.2	R106	R106-E110 WeakPolarHBondContact O-CG 3.43Å; R106-E110 PolarHBondContact O-N 2.91Å; R106-E110 VanDerWaalsContact O-N 3.11Å
111	Y	60.4	Low	90.4	Very high	256 Å²	256	133 Å²	133	100%	1.004	60%	0.595	S	S	*	*			trans	-125.9	0	176.8	-80.2	-82.2	0	0	0	111.6	Y107	Y107-Y111 PolarHBondContact O-N 3.01Å

Retrieved 111 of 111 residues in 32.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).