Z4YKI7_MOUSE Loading...

Hydroxypyruvate isomerase (putative)

AlphaFold DB , UniProt , Accession Z4YKI7, Species MOUSE (Mus musculus, Mouse), Gene Hyi, Length 69 aa.

						>Z4YKI7_MOUSE|Z4YKI7|Hyi
MAPLRFSANVSWLFPELPGLPERLHAAGRAGFEAAEVAWPYTESPQALASAAQTAGLRLVLINTPRGST
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	75.7	Confident	93.1	Very high	234 Å²	234	90.5 Å²	90.5	100%	1.153	48%	0.482	S	S	*	.				0	140	0	-88.4	168.7	64.7	0	0	108.5
2	A	81.4	Confident	93.5	Very high	86 Å²	86	99.7 Å²	99.7	71%	0.711	51%	0.506	S	S	*	.	P	Polyproline II helix	trans	-68.9	146.9	168.4	0	0	0	0	0	109.7
3	P	90.1	Very high	93.9	Very high	119 Å²	119	97.8 Å²	97.8	77%	0.773	50%	0.497	S	S	*	.	P	Polyproline II helix	trans	-64.1	145.5	177.2	26.2	-33	0	0	0	111.1
4	L	94.3	Very high	94.2	Very high	136 Å²	136	93.7 Å²	93.7	71%	0.712	47%	0.474	S	S	*	.	P	Polyproline II helix	trans	-65.6	145.2	172.7	-65.4	176.7	0	0	0	110.1	F6	L4-F6 HydrophobicContact CB-CE2 3.79Å; L4-F6 HydrophobicContact CB-CZ 3.84Å; L4-F6 HydrophobicContact CD1-CZ 3.83Å
5	R	94.4	Very high	94.4	Very high	174 Å²	174	93.3 Å²	93.3	66%	0.657	48%	0.481	S	S	*	.			trans	-118.6	120.9	176.3	-66.6	175	62.8	-163.9	-9	108.3	R58	R5-R58 VanDerWaalsContact NH2-NH1 3.12Å
6	F	97.6	Very high	94.7	Very high	140 Å²	140	96.4 Å²	96.4	61%	0.614	49%	0.493	S	S	*	.			trans	-102.3	144.6	-177	-62.3	-80.6	0	0	0	111.1	L4 F32	L4-F6 HydrophobicContact CB-CE2 3.79Å; L4-F6 HydrophobicContact CB-CZ 3.84Å; L4-F6 HydrophobicContact CD1-CZ 3.83Å; F6-F32 HydrophobicContact CB-CD1 4.2Å; F6-F32 HydrophobicContact CB-CE1 3.95Å
7	S	98.6	Very high	94.9	Very high	40 Å²	40	93.5 Å²	93.5	28%	0.28	48%	0.478	S	S	.	.			trans	-113.7	131.6	172.9	179.5	0	0	0	0	108.9	N9 A34 E36 V60	S7-N9 PolarHBondContact O-N 3.46Å; S7-A34 WeakPolarHBondContact CA-O 3.45Å; S7-E36 PolarHBondContact OG-N 3.33Å; S7-E36 PolarHBondContact OG-OE2 3.48Å; S7-V60 WeakPolarHBondContact OG-CG2 3.35Å
8	A	98.7	Very high	94.9	Very high	0 Å²	0	93.1 Å²	93.1	0%	0	48%	0.483	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.8	113.9	171.2	0	0	0	0	0	109.9	V10 L13 A27 F32 A34 A35 E36	A8-V10 HydrophobicContact CB-CG1 4.24Å; A8-V10 PolarHBondContact O-N 3.39Å; A8-V10 VanDerWaalsContact O-N 3.13Å; A8-L13 HydrophobicContact CB-CD1 4.25Å; A8-A27 HydrophobicContact CB-CB 3.68Å; A8-F32 HydrophobicContact CB-CB 4.21Å; A8-F32 HydrophobicContact CB-CD1 3.81Å; A8-F32 HydrophobicContact CB-CD2 3.85Å; A8-F32 HydrophobicContact CB-CE1 4.06Å; A8-F32 HydrophobicContact CB-CE2 4.1Å; A8-F32 HydrophobicContact CB-CG 3.69Å; A8-F32 HydrophobicContact CB-CZ 4.2Å; A8-A34 PolarHBondContact N-O 3.39Å; A8-A35 HydrophobicContact CB-CB 4.48Å; A8-A35 CarbonylContact O-C 3.57Å; A8-A35 VanDerWaalsContact O-CA 3.23Å; A8-A35 WeakPolarHBondContact O-CA 3.23Å; A8-A35 WeakPolarHBondContact O-CB 3.46Å; A8-E36 PolarHBondContact O-N 2.98Å
9	N	98.6	Very high	94.9	Very high	32 Å²	32	89.8 Å²	89.8	17%	0.171	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.4	94	168.6	-170.2	-46.1	0	0	0	109.9	S7 S11 W12 L13 E36	S7-N9 PolarHBondContact O-N 3.46Å; N9-S11 PolarHBondContact O-N 2.93Å; N9-S11 VanDerWaalsContact OD1-CB 3.32Å; N9-S11 WeakPolarHBondContact OD1-CB 3.24Å; N9-S11 PolarHBondContact OD1-N 3.13Å; N9-S11 VanDerWaalsContact OD1-N 3.13Å; N9-W12 PolarHBondContact O-N 3.44Å; N9-W12 VanDerWaalsContact O-N 3.08Å; N9-W12 PolarHBondContact OD1-N 2.72Å; N9-L13 WeakPolarHBondContact O-CB 3.32Å; N9-L13 PolarHBondContact O-N 2.86Å; N9-E36 HydrophobicContact CB-CG 3.61Å; N9-E36 WeakPolarHBondContact CB-OE1 3.12Å; N9-E36 PolarHBondContact ND2-OE1 3.48Å
10	V	98.3	Very high	95	Very high	0 Å²	0	86.2 Å²	86.2	0%	0	46%	0.455	C	S	.	.	T	Hydrogen-bonded Turn	trans	-77.9	-1.9	-175.1	-60.8	0	0	0	0	113.4	A8 W12 F14 L20 R23 L24 A27 A35 E36 V37	A8-V10 HydrophobicContact CB-CG1 4.24Å; A8-V10 PolarHBondContact O-N 3.39Å; A8-V10 VanDerWaalsContact O-N 3.13Å; V10-W12 VanDerWaalsContact C-N 3.28Å; V10-F14 HydrophobicContact CG1-CD2 4.34Å; V10-L20 HydrophobicContact CG2-CD2 4.16Å; V10-R23 HydrophobicContact CB-CB 3.92Å; V10-R23 HydrophobicContact CG1-CB 4.29Å; V10-R23 VanDerWaalsContact O-CD 3.28Å; V10-R23 WeakPolarHBondContact O-CD 3.48Å; V10-R23 PolarHBondContact O-NH1 2.88Å; V10-L24 HydrophobicContact CG1-CD2 4.28Å; V10-L24 HydrophobicContact CG2-CD2 4.06Å; V10-L24 HydrophobicContact CG2-CG 4.48Å; V10-A27 HydrophobicContact CG1-CB 4.03Å; V10-A35 HydrophobicContact CG1-CB 4.43Å; V10-E36 WeakPolarHBondContact CG2-O 3.28Å; V10-E36 PolarHBondContact N-O 3.06Å; V10-E36 VanDerWaalsContact N-O 3.1Å; V10-V37 HydrophobicContact CG2-CG2 3.51Å
11	S	96.9	Very high	95.2	Very high	34 Å²	34	82.9 Å²	82.9	24%	0.238	44%	0.438	C	S	.	.	T	Hydrogen-bonded Turn	trans	-74.5	-21.4	164.5	-58.9	0	0	0	0	112.4	N9 A38	N9-S11 PolarHBondContact O-N 2.93Å; N9-S11 VanDerWaalsContact OD1-CB 3.32Å; N9-S11 WeakPolarHBondContact OD1-CB 3.24Å; N9-S11 PolarHBondContact OD1-N 3.13Å; N9-S11 VanDerWaalsContact OD1-N 3.13Å; S11-A38 WeakPolarHBondContact OG-CB 3.43Å; S11-A38 PolarHBondContact OG-N 3.01Å
12	W	97.6	Very high	96.2	Very high	201 Å²	201	75.8 Å²	75.8	76%	0.761	40%	0.402	S	S	*	.	T	Hydrogen-bonded Turn	trans	-116	-33.5	179	-56.3	114.7	0	0	0	113.6	N9 V10	N9-W12 PolarHBondContact O-N 3.44Å; N9-W12 VanDerWaalsContact O-N 3.08Å; N9-W12 PolarHBondContact OD1-N 2.72Å; V10-W12 VanDerWaalsContact C-N 3.28Å
13	L	98.4	Very high	97	Very high	76 Å²	76	73.9 Å²	73.9	40%	0.398	38%	0.377	S	S	.	.	S	Bend	trans	-86.9	154.7	177.6	-62.2	178.4	0	0	0	111.6	A8 N9 P15	A8-L13 HydrophobicContact CB-CD1 4.25Å; N9-L13 WeakPolarHBondContact O-CB 3.32Å; N9-L13 PolarHBondContact O-N 2.86Å; L13-P15 VanDerWaalsContact C-CD 3.44Å
14	F	98.4	Very high	97.5	Very high	40 Å²	40	68.2 Å²	68.2	18%	0.175	34%	0.34	C	S	.	.			trans	55.5	42	-178.3	-43.7	-73.4	0	0	0	114.3	V10 E16 L17 R23 A26 A27 A30	V10-F14 HydrophobicContact CG1-CD2 4.34Å; F14-E16 WeakPolarHBondContact CA-OE2 3.43Å; F14-E16 PolarHBondContact O-N 3.08Å; F14-E16 VanDerWaalsContact O-N 3.14Å; F14-L17 HydrophobicContact CB-CD1 4.18Å; F14-L17 PolarHBondContact O-N 3.28Å; F14-L17 VanDerWaalsContact O-N 3.11Å; F14-R23 HydrophobicContact CB-CB 4.19Å; F14-R23 HydrophobicContact CB-CG 4Å; F14-R23 WeakPolarHBondContact O-CG 3.48Å; F14-R23 PolarHBondContact O-NE 2.95Å; F14-A26 HydrophobicContact CB-CB 4.26Å; F14-A26 HydrophobicContact CD1-CB 3.62Å; F14-A26 HydrophobicContact CD2-CB 4.14Å; F14-A26 HydrophobicContact CE1-CB 3.94Å; F14-A26 HydrophobicContact CE2-CB 4.44Å; F14-A26 HydrophobicContact CG-CB 3.72Å; F14-A26 HydrophobicContact CZ-CB 4.34Å; F14-A27 HydrophobicContact CE2-CB 3.78Å; F14-A27 HydrophobicContact CZ-CB 4.42Å; F14-A30 HydrophobicContact CE1-CB 4.49Å; F14-A30 HydrophobicContact CZ-CB 4.07Å
15	P	97.7	Very high	97.7	Very high	88 Å²	88	64.5 Å²	64.5	57%	0.571	32%	0.319	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.5	-20.7	-176.9	29.6	-38.1	0	0	0	113.7	L13 L17 R23	L13-P15 VanDerWaalsContact C-CD 3.44Å; P15-L17 PolarHBondContact O-N 3.13Å; P15-R23 PolarHBondContact O-NH2 2.86Å
16	E	98.2	Very high	97.9	Very high	143 Å²	143	56.6 Å²	56.6	67%	0.668	29%	0.29	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69	-15.8	176.5	68.9	-80.1	-173.4	0	0	113.9	F14	F14-E16 WeakPolarHBondContact CA-OE2 3.43Å; F14-E16 PolarHBondContact O-N 3.08Å; F14-E16 VanDerWaalsContact O-N 3.14Å
17	L	98.1	Very high	97.9	Very high	46 Å²	46	49.9 Å²	49.9	24%	0.241	26%	0.261	C	S	.	.	S	Bend	trans	-96.3	142	178.6	-59.4	177.5	0	0	0	111.6	F14 P15 E22 R23 A26	F14-L17 HydrophobicContact CB-CD1 4.18Å; F14-L17 PolarHBondContact O-N 3.28Å; F14-L17 VanDerWaalsContact O-N 3.11Å; P15-L17 PolarHBondContact O-N 3.13Å; L17-E22 HydrophobicContact CB-CB 4.19Å; L17-R23 HydrophobicContact CB-CG 3.95Å; L17-R23 PolarHBondContact O-NE 3.04Å; L17-R23 PolarHBondContact O-NH2 3.1Å; L17-R23 VanDerWaalsContact O-NH2 3.14Å; L17-A26 HydrophobicContact CD1-CB 3.42Å; L17-A26 VanDerWaalsContact CD1-CB 3.42Å
18	P	95.1	Very high	97.9	Very high	87 Å²	87	49 Å²	49	57%	0.565	26%	0.258	S	S	*	.	S	Bend	trans	-69.9	148.7	177.2	31.3	-35	0	0	0	110.5	E22	P18-E22 HydrophobicContact CG-CG 4.17Å; P18-E22 WeakPolarHBondContact O-CB 3.45Å
19	G	95.3	Very high	97.9	Very high	31 Å²	31	57.5 Å²	57.5	32%	0.32	29%	0.29	S	S	.	.	T	Hydrogen-bonded Turn	trans	61.3	178.8	172.2	0	0	0	0	0	114.9	R23 E43	G19-R23 WeakPolarHBondContact O-CD 3.39Å; G19-R23 WeakPolarHBondContact O-CG 3.1Å; G19-R23 PolarHBondContact O-NE 3.23Å; G19-R23 VanDerWaalsContact O-NE 3.13Å; G19-E43 WeakPolarHBondContact CA-OE1 3.4Å
20	L	97.6	Very high	97.9	Very high	17 Å²	17	58.9 Å²	58.9	9%	0.089	31%	0.306	C	S	.	.	T	Hydrogen-bonded Turn	trans	-86.5	-35.9	171.8	-64.2	165.7	0	0	0	114	V10 E22 R23 L24 V37 P40 E43 L48	V10-L20 HydrophobicContact CG2-CD2 4.16Å; L20-E22 PolarHBondContact O-N 2.94Å; L20-R23 PolarHBondContact O-N 3.22Å; L20-L24 WeakPolarHBondContact O-CG 3.47Å; L20-L24 PolarHBondContact O-N 2.92Å; L20-V37 HydrophobicContact CD1-CG1 3.42Å; L20-V37 VanDerWaalsContact CD1-CG1 3.42Å; L20-V37 HydrophobicContact CD2-CG1 3.86Å; L20-V37 HydrophobicContact CG-CG1 4.24Å; L20-P40 HydrophobicContact CD1-CB 4.19Å; L20-E43 HydrophobicContact CB-CG 4.07Å; L20-E43 HydrophobicContact CD1-CG 3.74Å; L20-E43 HydrophobicContact CG-CG 4.22Å; L20-E43 PolarHBondContact N-OE1 3.41Å; L20-L48 HydrophobicContact CB-CD2 3.79Å; L20-L48 HydrophobicContact CD1-CD2 4.47Å
21	P	97.5	Very high	97.9	Very high	16 Å²	16	61.8 Å²	61.8	10%	0.104	34%	0.336	C	S	.	.	H	α-helix	trans	-55.4	-47.2	179	-29.9	38.4	0	0	0	114.1	R23 L24 H25 A47 A51	P21-R23 VanDerWaalsContact C-N 3.3Å; P21-R23 PolarHBondContact O-N 3.47Å; P21-L24 WeakPolarHBondContact O-CB 3.41Å; P21-L24 PolarHBondContact O-N 2.87Å; P21-H25 PolarHBondContact O-CD2 3.15Å; P21-H25 PolarHBondContact O-N 3.3Å; P21-A47 HydrophobicContact CG-CB 4.49Å; P21-A51 HydrophobicContact CB-CB 3.79Å
22	E	98.2	Very high	98	Very high	86 Å²	86	63 Å²	63	40%	0.402	34%	0.337	S	S	.	.	H	α-helix	trans	-66.8	-34.8	-178.7	-67.3	74.2	-177.5	0	0	111.5	L17 P18 L20 H25 A26	L17-E22 HydrophobicContact CB-CB 4.19Å; P18-E22 HydrophobicContact CG-CG 4.17Å; P18-E22 WeakPolarHBondContact O-CB 3.45Å; L20-E22 PolarHBondContact O-N 2.94Å; E22-H25 PolarHBondContact O-N 3.35Å; E22-A26 PolarHBondContact O-N 3.26Å
23	R	98.6	Very high	98	Very high	46 Å²	46	59.3 Å²	59.3	17%	0.174	33%	0.328	C	S	.	.	H	α-helix	trans	-69.4	-36	175	-61.5	179.9	-171.9	-167	-0.8	112.2	V10 F14 P15 L17 G19 L20 P21 A26 A27	V10-R23 HydrophobicContact CB-CB 3.92Å; V10-R23 HydrophobicContact CG1-CB 4.29Å; V10-R23 VanDerWaalsContact O-CD 3.28Å; V10-R23 WeakPolarHBondContact O-CD 3.48Å; V10-R23 PolarHBondContact O-NH1 2.88Å; F14-R23 HydrophobicContact CB-CB 4.19Å; F14-R23 HydrophobicContact CB-CG 4Å; F14-R23 WeakPolarHBondContact O-CG 3.48Å; F14-R23 PolarHBondContact O-NE 2.95Å; P15-R23 PolarHBondContact O-NH2 2.86Å; L17-R23 HydrophobicContact CB-CG 3.95Å; L17-R23 PolarHBondContact O-NE 3.04Å; L17-R23 PolarHBondContact O-NH2 3.1Å; L17-R23 VanDerWaalsContact O-NH2 3.14Å; G19-R23 WeakPolarHBondContact O-CD 3.39Å; G19-R23 WeakPolarHBondContact O-CG 3.1Å; G19-R23 PolarHBondContact O-NE 3.23Å; G19-R23 VanDerWaalsContact O-NE 3.13Å; L20-R23 PolarHBondContact O-N 3.22Å; P21-R23 VanDerWaalsContact C-N 3.3Å; P21-R23 PolarHBondContact O-N 3.47Å; R23-A26 PolarHBondContact O-N 3.01Å; R23-A27 PolarHBondContact O-N 3.43Å
24	L	98.6	Very high	98	Very high	0 Å²	0	56.1 Å²	56.1	0%	0	31%	0.313	C	S	.	.	H	α-helix	trans	-63	-43.6	170.6	-70.9	172.8	0	0	0	111	V10 L20 P21 A26 A27 G28 A35 L48 A51 A52 A55 L57 L59	V10-L24 HydrophobicContact CG1-CD2 4.28Å; V10-L24 HydrophobicContact CG2-CD2 4.06Å; V10-L24 HydrophobicContact CG2-CG 4.48Å; L20-L24 WeakPolarHBondContact O-CG 3.47Å; L20-L24 PolarHBondContact O-N 2.92Å; P21-L24 WeakPolarHBondContact O-CB 3.41Å; P21-L24 PolarHBondContact O-N 2.87Å; L24-A26 VanDerWaalsContact C-N 3.28Å; L24-A26 PolarHBondContact O-N 3.36Å; L24-A27 PolarHBondContact O-N 3.36Å; L24-G28 PolarHBondContact O-N 2.98Å; L24-A35 HydrophobicContact CD2-CB 3.56Å; L24-L48 HydrophobicContact CD1-CD2 3.65Å; L24-A51 HydrophobicContact CB-CB 4.33Å; L24-A51 HydrophobicContact CD1-CB 4.12Å; L24-A52 HydrophobicContact CD1-CB 4.27Å; L24-A55 WeakPolarHBondContact O-CB 3.14Å; L24-L57 HydrophobicContact CB-CD1 4.11Å; L24-L57 HydrophobicContact CD2-CD1 3.92Å; L24-L57 WeakPolarHBondContact O-CD1 3.16Å; L24-L59 HydrophobicContact CD2-CD2 4.35Å
25	H	98.6	Very high	98	Very high	58 Å²	58	54.2 Å²	54.2	27%	0.269	31%	0.305	S	S	.	.	H	α-helix	trans	-60.5	-38.1	173.9	-68.2	-62.7	0	0	0	112.4	P21 E22 G28 R29	P21-H25 PolarHBondContact O-CD2 3.15Å; P21-H25 PolarHBondContact O-N 3.3Å; E22-H25 PolarHBondContact O-N 3.35Å; H25-G28 PolarHBondContact O-N 3.28Å; H25-R29 WeakPolarHBondContact O-CG 3.25Å; H25-R29 PolarHBondContact O-N 3.13Å; H25-R29 PolarHBondContact O-NH1 3.03Å
26	A	98.8	Very high	98.1	Very high	7 Å²	7	52.4 Å²	52.4	6%	0.058	29%	0.288	C	S	.	.	H	α-helix	trans	-66.3	-41.2	175.1	0	0	0	0	0	113	F14 L17 E22 R23 L24 G28 R29 A30	F14-A26 HydrophobicContact CB-CB 4.26Å; F14-A26 HydrophobicContact CD1-CB 3.62Å; F14-A26 HydrophobicContact CD2-CB 4.14Å; F14-A26 HydrophobicContact CE1-CB 3.94Å; F14-A26 HydrophobicContact CE2-CB 4.44Å; F14-A26 HydrophobicContact CG-CB 3.72Å; F14-A26 HydrophobicContact CZ-CB 4.34Å; L17-A26 HydrophobicContact CD1-CB 3.42Å; L17-A26 VanDerWaalsContact CD1-CB 3.42Å; E22-A26 PolarHBondContact O-N 3.26Å; R23-A26 PolarHBondContact O-N 3.01Å; L24-A26 VanDerWaalsContact C-N 3.28Å; L24-A26 PolarHBondContact O-N 3.36Å; A26-G28 VanDerWaalsContact C-N 3.35Å; A26-G28 PolarHBondContact O-N 2.86Å; A26-R29 PolarHBondContact O-N 3.42Å; A26-A30 WeakPolarHBondContact O-CB 3.44Å; A26-A30 PolarHBondContact O-N 3.11Å
27	A	98.8	Very high	98	Very high	0 Å²	0	45.6 Å²	45.6	0%	0	26%	0.257	C	S	.	.	H	α-helix	trans	-60	-43.6	174.5	0	0	0	0	0	112	A8 V10 F14 R23 L24 A30 G31 F32 L57	A8-A27 HydrophobicContact CB-CB 3.68Å; V10-A27 HydrophobicContact CG1-CB 4.03Å; F14-A27 HydrophobicContact CE2-CB 3.78Å; F14-A27 HydrophobicContact CZ-CB 4.42Å; R23-A27 PolarHBondContact O-N 3.43Å; L24-A27 PolarHBondContact O-N 3.36Å; A27-A30 PolarHBondContact O-N 3.14Å; A27-G31 PolarHBondContact O-N 3.14Å; A27-F32 HydrophobicContact CB-CD2 4.48Å; A27-F32 PolarHBondContact O-N 3.37Å; A27-F32 VanDerWaalsContact O-N 3.15Å; A27-L57 HydrophobicContact CB-CD1 3.84Å
28	G	98.6	Very high	97.9	Very high	20 Å²	20	43.9 Å²	43.9	21%	0.206	25%	0.249	C	C	.	.	H	α-helix	trans	-61.6	-45.2	174.4	0	0	0	0	0	112.5	L24 H25 A26 A30 G31 A55	L24-G28 PolarHBondContact O-N 2.98Å; H25-G28 PolarHBondContact O-N 3.28Å; A26-G28 VanDerWaalsContact C-N 3.35Å; A26-G28 PolarHBondContact O-N 2.86Å; G28-A30 PolarHBondContact O-N 3.21Å; G28-G31 PolarHBondContact O-N 2.91Å; G28-A55 WeakPolarHBondContact CA-O 3.43Å
29	R	98.6	Very high	98	Very high	179 Å²	179	44.3 Å²	44.3	68%	0.675	24%	0.24	S	C	*	.	H	α-helix	trans	-62.6	-29.6	175.3	-71.5	-171.1	-57.3	-89.1	1.9	113.4	H25 A26 G31	H25-R29 WeakPolarHBondContact O-CG 3.25Å; H25-R29 PolarHBondContact O-N 3.13Å; H25-R29 PolarHBondContact O-NH1 3.03Å; A26-R29 PolarHBondContact O-N 3.42Å; R29-G31 PolarHBondContact O-N 3.26Å
30	A	98.4	Very high	98	Very high	61 Å²	61	43.4 Å²	43.4	50%	0.504	23%	0.228	S	C	.	.	T	Hydrogen-bonded Turn	trans	-78.8	-1.7	175.6	0	0	0	0	0	113.4	F14 A26 A27 G28 F32	F14-A30 HydrophobicContact CE1-CB 4.49Å; F14-A30 HydrophobicContact CZ-CB 4.07Å; A26-A30 WeakPolarHBondContact O-CB 3.44Å; A26-A30 PolarHBondContact O-N 3.11Å; A27-A30 PolarHBondContact O-N 3.14Å; G28-A30 PolarHBondContact O-N 3.21Å; A30-F32 HydrophobicContact CB-CD2 4.02Å; A30-F32 HydrophobicContact CB-CE2 4.17Å
31	G	98.1	Very high	97.8	Very high	62 Å²	62	48.2 Å²	48.2	64%	0.639	25%	0.246	S	C	*	.	T	Hydrogen-bonded Turn	trans	88.4	13.1	175.2	0	0	0	0	0	114.8	A27 G28 R29	A27-G31 PolarHBondContact O-N 3.14Å; G28-G31 PolarHBondContact O-N 2.91Å; R29-G31 PolarHBondContact O-N 3.26Å
32	F	98.4	Very high	97.6	Very high	58 Å²	58	53.8 Å²	53.8	25%	0.254	28%	0.28	S	S	.	.			trans	-72.3	147.6	170	-70.2	-90.6	0	0	0	110.7	F6 A8 A27 A30 L57	F6-F32 HydrophobicContact CB-CD1 4.2Å; F6-F32 HydrophobicContact CB-CE1 3.95Å; A8-F32 HydrophobicContact CB-CB 4.21Å; A8-F32 HydrophobicContact CB-CD1 3.81Å; A8-F32 HydrophobicContact CB-CD2 3.85Å; A8-F32 HydrophobicContact CB-CE1 4.06Å; A8-F32 HydrophobicContact CB-CE2 4.1Å; A8-F32 HydrophobicContact CB-CG 3.69Å; A8-F32 HydrophobicContact CB-CZ 4.2Å; A27-F32 HydrophobicContact CB-CD2 4.48Å; A27-F32 PolarHBondContact O-N 3.37Å; A27-F32 VanDerWaalsContact O-N 3.15Å; A30-F32 HydrophobicContact CB-CD2 4.02Å; A30-F32 HydrophobicContact CB-CE2 4.17Å; F32-L57 HydrophobicContact CB-CD2 3.98Å; F32-L57 WeakPolarHBondContact O-CD2 3.46Å
33	E	98.3	Very high	97.4	Very high	125 Å²	125	52 Å²	52	58%	0.584	27%	0.272	S	S	*	.	S	Bend	trans	-107.8	-6.4	173.2	-61.3	178.4	-170.2	0	0	112.6	R58	E33-R58 PolarHBondContact O-N 3.05Å; E33-R58 IonicContact OE2-NH2 3.71Å
34	A	98.6	Very high	97.3	Very high	9 Å²	9	52.4 Å²	52.4	7%	0.074	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.4	148.5	-179.2	0	0	0	0	0	110.2	S7 A8 R58 V60	S7-A34 WeakPolarHBondContact CA-O 3.45Å; A8-A34 PolarHBondContact N-O 3.39Å; A34-R58 CarbonylContact C-O 3.55Å; A34-R58 VanDerWaalsContact CA-O 3.24Å; A34-R58 WeakPolarHBondContact CA-O 3.34Å; A34-V60 HydrophobicContact CB-CG1 3.85Å; A34-V60 HydrophobicContact CB-CG2 4.2Å
35	A	98.7	Very high	97.1	Very high	0 Å²	0	56.9 Å²	56.9	0%	0	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140	157.5	174.3	0	0	0	0	0	110.8	A8 V10 L24 L57 R58 L59 V60	A8-A35 HydrophobicContact CB-CB 4.48Å; A8-A35 CarbonylContact O-C 3.57Å; A8-A35 VanDerWaalsContact O-CA 3.23Å; A8-A35 WeakPolarHBondContact O-CA 3.23Å; A8-A35 WeakPolarHBondContact O-CB 3.46Å; V10-A35 HydrophobicContact CG1-CB 4.43Å; L24-A35 HydrophobicContact CD2-CB 3.56Å; A35-L57 HydrophobicContact CB-CD1 4.05Å; A35-R58 PolarHBondContact N-O 3.45Å; A35-L59 CarbonylContact O-C 3.57Å; A35-L59 WeakPolarHBondContact O-CA 3.34Å; A35-V60 WeakPolarHBondContact O-CG2 3.47Å; A35-V60 PolarHBondContact O-N 2.91Å
36	E	98.7	Very high	97.1	Very high	49 Å²	49	60.7 Å²	60.7	23%	0.229	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	147.6	173	61.1	-172.6	-132.6	0	0	110.5	S7 A8 N9 V10 L61	S7-E36 PolarHBondContact OG-N 3.33Å; S7-E36 PolarHBondContact OG-OE2 3.48Å; A8-E36 PolarHBondContact O-N 2.98Å; N9-E36 HydrophobicContact CB-CG 3.61Å; N9-E36 WeakPolarHBondContact CB-OE1 3.12Å; N9-E36 PolarHBondContact ND2-OE1 3.48Å; V10-E36 WeakPolarHBondContact CG2-O 3.28Å; V10-E36 PolarHBondContact N-O 3.06Å; V10-E36 VanDerWaalsContact N-O 3.1Å; E36-L61 WeakPolarHBondContact CA-O 3.37Å; E36-L61 HydrophobicContact CB-CB 3.76Å; E36-L61 HydrophobicContact CB-CD2 4.12Å
37	V	97.7	Very high	97	Very high	1 Å²	1	62.2 Å²	62.2	1%	0.006	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.5	123.2	-176.5	178.1	0	0	0	0	108.3	V10 L20 P40 L59 L61 I62	V10-V37 HydrophobicContact CG2-CG2 3.51Å; L20-V37 HydrophobicContact CD1-CG1 3.42Å; L20-V37 VanDerWaalsContact CD1-CG1 3.42Å; L20-V37 HydrophobicContact CD2-CG1 3.86Å; L20-V37 HydrophobicContact CG-CG1 4.24Å; V37-P40 HydrophobicContact CG1-CB 3.85Å; V37-P40 HydrophobicContact CG1-CG 4.32Å; V37-L59 HydrophobicContact CB-CD2 4.4Å; V37-L59 HydrophobicContact CG2-CD2 3.59Å; V37-L61 PolarHBondContact N-O 2.78Å; V37-I62 HydrophobicContact CB-CG2 4.45Å; V37-I62 VanDerWaalsContact O-CA 3.25Å; V37-I62 WeakPolarHBondContact O-CA 3.17Å
38	A	95.9	Very high	96.9	Very high	10 Å²	10	62.8 Å²	62.8	8%	0.083	34%	0.344	C	S	.	.	S	Bend	trans	-61.1	-62.9	-178.9	0	0	0	0	0	112.2	S11 N63	S11-A38 WeakPolarHBondContact OG-CB 3.43Å; S11-A38 PolarHBondContact OG-N 3.01Å; A38-N63 WeakPolarHBondContact O-CA 3.28Å; A38-N63 WeakPolarHBondContact O-CB 3.28Å; A38-N63 PolarHBondContact O-N 2.91Å
39	W	95.2	Very high	96.8	Very high	96 Å²	96	64 Å²	64	36%	0.364	35%	0.352	S	S	.	.			trans	-136	90.6	-176.6	-59.8	-69	0	0	0	111.2	Y41 T64 R66	W39-Y41 HydrophobicContact CB-CD2 4.16Å; W39-Y41 HydrophobicContact CB-CE2 4.47Å; W39-Y41 PolarHBondContact O-N 3.23Å; W39-T64 PolarHBondContact NE1-O 2.95Å; W39-R66 HydrophobicContact CD2-CG 3.85Å; W39-R66 VanDerWaalsContact CE2-NE 3.33Å; W39-R66 HydrophobicContact CG-CG 3.89Å; W39-R66 VanDerWaalsContact CH2-CZ 3.46Å; W39-R66 HydrophobicContact CZ2-CG 4.18Å; W39-R66 VanDerWaalsContact CZ2-NE 3.32Å; W39-R66 VanDerWaalsContact NE1-CG 3.33Å
40	P	95.8	Very high	96.8	Very high	12 Å²	12	58.6 Å²	58.6	8%	0.078	34%	0.341	C	S	.	.			trans	-77.6	2	-175.9	28	-32.4	0	0	0	115.1	L20 V37 T42 E43 L48 I62	L20-P40 HydrophobicContact CD1-CB 4.19Å; V37-P40 HydrophobicContact CG1-CB 3.85Å; V37-P40 HydrophobicContact CG1-CG 4.32Å; P40-T42 PolarHBondContact O-N 3.42Å; P40-E43 WeakPolarHBondContact O-CB 3.21Å; P40-E43 PolarHBondContact O-N 3.29Å; P40-L48 HydrophobicContact CB-CD1 3.33Å; P40-I62 HydrophobicContact CG-CB 4.38Å; P40-I62 HydrophobicContact CG-CG2 4.09Å
41	Y	94.1	Very high	96.8	Very high	117 Å²	117	55.8 Å²	55.8	46%	0.459	32%	0.318	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.1	-9.5	-159.9	-56.5	-62.8	0	0	0	116.2	W39 N63 T64 P65	W39-Y41 HydrophobicContact CB-CD2 4.16Å; W39-Y41 HydrophobicContact CB-CE2 4.47Å; W39-Y41 PolarHBondContact O-N 3.23Å; Y41-N63 WeakPolarHBondContact CE2-O 3.26Å; Y41-N63 PolarHBondContact OH-O 3.35Å; Y41-T64 VanDerWaalsContact OH-C 3.29Å; Y41-T64 VanDerWaalsContact OH-CA 3.29Å; Y41-T64 WeakPolarHBondContact OH-CA 3.28Å; Y41-P65 HydrophobicContact CE1-CG 4.27Å; Y41-P65 VanDerWaalsContact CE2-CA 3.47Å; Y41-P65 HydrophobicContact CE2-CB 4.2Å; Y41-P65 HydrophobicContact CE2-CG 3.99Å; Y41-P65 VanDerWaalsContact OH-CD 3.25Å; Y41-P65 WeakPolarHBondContact OH-CD 3.43Å
42	T	92.2	Very high	96.8	Very high	134 Å²	134	53.1 Å²	53.1	82%	0.822	29%	0.291	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85	-15.6	171.2	53.1	0	0	0	0	112.9	P40	P40-T42 PolarHBondContact O-N 3.42Å
43	E	94.6	Very high	96.8	Very high	49 Å²	49	57.6 Å²	57.6	23%	0.229	31%	0.312	C	S	.	.	S	Bend	trans	-91.9	153.1	179.5	-59.1	-70.3	-179	0	0	110.9	G19 L20 P40 P45 L48	G19-E43 WeakPolarHBondContact CA-OE1 3.4Å; L20-E43 HydrophobicContact CB-CG 4.07Å; L20-E43 HydrophobicContact CD1-CG 3.74Å; L20-E43 HydrophobicContact CG-CG 4.22Å; L20-E43 PolarHBondContact N-OE1 3.41Å; P40-E43 WeakPolarHBondContact O-CB 3.21Å; P40-E43 PolarHBondContact O-N 3.29Å; E43-P45 WeakPolarHBondContact O-CD 3.49Å; E43-L48 HydrophobicContact CB-CD1 3.51Å; E43-L48 HydrophobicContact CB-CG 3.85Å; E43-L48 HydrophobicContact CG-CD1 4.08Å; E43-L48 HydrophobicContact CG-CG 4.28Å
44	S	95.9	Very high	96.8	Very high	53 Å²	53	56.5 Å²	56.5	37%	0.371	31%	0.314	S	S	.	.			trans	-63.6	129.9	166.2	162.7	0	0	0	0	109.7	Q46 A47 L48	S44-Q46 PolarHBondContact O-N 3.41Å; S44-Q46 PolarHBondContact OG-N 2.96Å; S44-Q46 PolarHBondContact OG-OE1 3.25Å; S44-A47 PolarHBondContact O-N 2.67Å; S44-A47 VanDerWaalsContact O-N 3.14Å; S44-A47 PolarHBondContact OG-N 2.93Å; S44-L48 PolarHBondContact O-N 3.26Å
45	P	95.9	Very high	96.8	Very high	94 Å²	94	57 Å²	57	61%	0.61	32%	0.318	S	S	*	.	H	α-helix	trans	-56	-35.6	172.8	-26.5	35	0	0	0	112.8	E43 A49	E43-P45 WeakPolarHBondContact O-CD 3.49Å; P45-A49 VanDerWaalsContact O-CB 3.28Å; P45-A49 WeakPolarHBondContact O-CB 3.39Å; P45-A49 PolarHBondContact O-N 3.42Å
46	Q	97.6	Very high	96.8	Very high	138 Å²	138	59.8 Å²	59.8	65%	0.645	35%	0.347	S	S	*	.	H	α-helix	trans	-68.9	-41.8	178.2	-64.7	74.7	19.2	0	0	111.5	S44 A49 S50	S44-Q46 PolarHBondContact O-N 3.41Å; S44-Q46 PolarHBondContact OG-N 2.96Å; S44-Q46 PolarHBondContact OG-OE1 3.25Å; Q46-A49 PolarHBondContact O-N 3.42Å; Q46-S50 VanDerWaalsContact O-CB 3.28Å; Q46-S50 WeakPolarHBondContact O-CB 3.29Å; Q46-S50 PolarHBondContact O-N 3.4Å
47	A	96.3	Very high	96.8	Very high	40 Å²	40	58 Å²	58	33%	0.331	34%	0.339	S	S	.	.	H	α-helix	trans	-63.3	-46.5	177	0	0	0	0	0	111.4	P21 S44 S50 A51	P21-A47 HydrophobicContact CG-CB 4.49Å; S44-A47 PolarHBondContact O-N 2.67Å; S44-A47 VanDerWaalsContact O-N 3.14Å; S44-A47 PolarHBondContact OG-N 2.93Å; A47-S50 PolarHBondContact O-N 2.94Å; A47-A51 WeakPolarHBondContact O-CB 3.43Å; A47-A51 PolarHBondContact O-N 3.45Å
48	L	96.6	Very high	96.8	Very high	12 Å²	12	63.9 Å²	63.9	6%	0.063	36%	0.361	C	S	.	.	H	α-helix	trans	-61	-45.8	175.5	-89.9	166.2	0	0	0	112.8	L20 L24 P40 E43 S44 A51 A52	L20-L48 HydrophobicContact CB-CD2 3.79Å; L20-L48 HydrophobicContact CD1-CD2 4.47Å; L24-L48 HydrophobicContact CD1-CD2 3.65Å; P40-L48 HydrophobicContact CB-CD1 3.33Å; E43-L48 HydrophobicContact CB-CD1 3.51Å; E43-L48 HydrophobicContact CB-CG 3.85Å; E43-L48 HydrophobicContact CG-CD1 4.08Å; E43-L48 HydrophobicContact CG-CG 4.28Å; S44-L48 PolarHBondContact O-N 3.26Å; L48-A51 PolarHBondContact O-N 2.88Å; L48-A52 WeakPolarHBondContact O-CB 3.45Å; L48-A52 PolarHBondContact O-N 2.88Å
49	A	97.2	Very high	96.9	Very high	44 Å²	44	66.6 Å²	66.6	36%	0.364	37%	0.374	S	S	.	.	H	α-helix	trans	-63	-43.8	178.6	0	0	0	0	0	111.6	P45 Q46 A52 Q53	P45-A49 VanDerWaalsContact O-CB 3.28Å; P45-A49 WeakPolarHBondContact O-CB 3.39Å; P45-A49 PolarHBondContact O-N 3.42Å; Q46-A49 PolarHBondContact O-N 3.42Å; A49-A52 PolarHBondContact O-N 3.41Å; A49-Q53 WeakPolarHBondContact O-CB 3.25Å; A49-Q53 VanDerWaalsContact O-CG 3.28Å; A49-Q53 WeakPolarHBondContact O-CG 3.43Å; A49-Q53 PolarHBondContact O-N 2.95Å
50	S	98.2	Very high	97	Very high	66 Å²	66	65.9 Å²	65.9	46%	0.462	38%	0.38	S	S	.	.	H	α-helix	trans	-64.2	-42.3	177.2	-177.1	0	0	0	0	111.9	Q46 A47 Q53 T54	Q46-S50 VanDerWaalsContact O-CB 3.28Å; Q46-S50 WeakPolarHBondContact O-CB 3.29Å; Q46-S50 PolarHBondContact O-N 3.4Å; A47-S50 PolarHBondContact O-N 2.94Å; S50-Q53 PolarHBondContact O-N 3.34Å; S50-T54 VanDerWaalsContact O-CB 3.26Å; S50-T54 WeakPolarHBondContact O-CB 3.41Å; S50-T54 PolarHBondContact O-N 3.04Å; S50-T54 PolarHBondContact O-OG1 3.09Å
51	A	98.3	Very high	97.2	Very high	2 Å²	2	69 Å²	69	2%	0.017	40%	0.395	C	S	.	.	H	α-helix	trans	-63.2	-45.9	176.5	0	0	0	0	0	111.8	P21 L24 A47 L48 T54 A55	P21-A51 HydrophobicContact CB-CB 3.79Å; L24-A51 HydrophobicContact CB-CB 4.33Å; L24-A51 HydrophobicContact CD1-CB 4.12Å; A47-A51 WeakPolarHBondContact O-CB 3.43Å; A47-A51 PolarHBondContact O-N 3.45Å; L48-A51 PolarHBondContact O-N 2.88Å; A51-T54 PolarHBondContact O-N 3.11Å; A51-A55 WeakPolarHBondContact O-CB 3.46Å; A51-A55 PolarHBondContact O-N 3.45Å
52	A	98.4	Very high	97.3	Very high	7 Å²	7	67.9 Å²	67.9	6%	0.058	40%	0.396	C	S	.	.	H	α-helix	trans	-61.2	-46.2	176.3	0	0	0	0	0	111.9	L24 L48 A49 A55 G56 L57 L59	L24-A52 HydrophobicContact CD1-CB 4.27Å; L48-A52 WeakPolarHBondContact O-CB 3.45Å; L48-A52 PolarHBondContact O-N 2.88Å; A49-A52 PolarHBondContact O-N 3.41Å; A52-A55 PolarHBondContact O-N 3.43Å; A52-G56 PolarHBondContact O-N 3.05Å; A52-G56 VanDerWaalsContact O-N 3.11Å; A52-L57 PolarHBondContact O-N 3.23Å; A52-L59 HydrophobicContact CB-CD1 3.96Å; A52-L59 HydrophobicContact CB-CG 4.28Å
53	Q	98.5	Very high	97.5	Very high	152 Å²	152	64.4 Å²	64.4	71%	0.71	37%	0.373	S	S	*	.	H	α-helix	trans	-60.9	-47.9	177	-75.3	174.1	11.2	0	0	111.9	A49 S50 A55 G56	A49-Q53 WeakPolarHBondContact O-CB 3.25Å; A49-Q53 VanDerWaalsContact O-CG 3.28Å; A49-Q53 WeakPolarHBondContact O-CG 3.43Å; A49-Q53 PolarHBondContact O-N 2.95Å; S50-Q53 PolarHBondContact O-N 3.34Å; Q53-A55 VanDerWaalsContact C-N 3.29Å; Q53-A55 PolarHBondContact O-N 3.12Å; Q53-G56 PolarHBondContact O-N 2.92Å; Q53-G56 VanDerWaalsContact O-N 3.09Å
54	T	98.6	Very high	97.6	Very high	102 Å²	102	67.5 Å²	67.5	63%	0.626	40%	0.395	S	S	*	.	H	α-helix	trans	-64.7	-35.4	179.7	-58.3	0	0	0	0	111.7	S50 A51 G56	S50-T54 VanDerWaalsContact O-CB 3.26Å; S50-T54 WeakPolarHBondContact O-CB 3.41Å; S50-T54 PolarHBondContact O-N 3.04Å; S50-T54 PolarHBondContact O-OG1 3.09Å; A51-T54 PolarHBondContact O-N 3.11Å; T54-G56 VanDerWaalsContact C-N 3.25Å; T54-G56 PolarHBondContact O-N 2.97Å
55	A	98.6	Very high	97.5	Very high	18 Å²	18	69.2 Å²	69.2	15%	0.149	41%	0.405	C	S	.	.	T	Hydrogen-bonded Turn	trans	-78.4	-4.9	176.3	0	0	0	0	0	113.7	L24 G28 A51 A52 Q53 L57	L24-A55 WeakPolarHBondContact O-CB 3.14Å; G28-A55 WeakPolarHBondContact CA-O 3.43Å; A51-A55 WeakPolarHBondContact O-CB 3.46Å; A51-A55 PolarHBondContact O-N 3.45Å; A52-A55 PolarHBondContact O-N 3.43Å; Q53-A55 VanDerWaalsContact C-N 3.29Å; Q53-A55 PolarHBondContact O-N 3.12Å; A55-L57 VanDerWaalsContact C-N 3.25Å; A55-L57 HydrophobicContact CB-CB 4.48Å; A55-L57 HydrophobicContact CB-CD1 3.74Å; A55-L57 HydrophobicContact CB-CG 3.85Å; A55-L57 PolarHBondContact O-N 3.14Å
56	G	98.5	Very high	97.2	Very high	59 Å²	59	73.1 Å²	73.1	61%	0.608	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	69	22.3	-175.5	0	0	0	0	0	113.8	A52 Q53 T54	A52-G56 PolarHBondContact O-N 3.05Å; A52-G56 VanDerWaalsContact O-N 3.11Å; Q53-G56 PolarHBondContact O-N 2.92Å; Q53-G56 VanDerWaalsContact O-N 3.09Å; T54-G56 VanDerWaalsContact C-N 3.25Å; T54-G56 PolarHBondContact O-N 2.97Å
57	L	98.7	Very high	96.6	Very high	13 Å²	13	70 Å²	70	7%	0.068	41%	0.413	C	S	.	.			trans	-98.3	142.1	-174.1	-67	172.5	0	0	0	112.2	L24 A27 F32 A35 A52 A55	L24-L57 HydrophobicContact CB-CD1 4.11Å; L24-L57 HydrophobicContact CD2-CD1 3.92Å; L24-L57 WeakPolarHBondContact O-CD1 3.16Å; A27-L57 HydrophobicContact CB-CD1 3.84Å; F32-L57 HydrophobicContact CB-CD2 3.98Å; F32-L57 WeakPolarHBondContact O-CD2 3.46Å; A35-L57 HydrophobicContact CB-CD1 4.05Å; A52-L57 PolarHBondContact O-N 3.23Å; A55-L57 VanDerWaalsContact C-N 3.25Å; A55-L57 HydrophobicContact CB-CB 4.48Å; A55-L57 HydrophobicContact CB-CD1 3.74Å; A55-L57 HydrophobicContact CB-CG 3.85Å; A55-L57 PolarHBondContact O-N 3.14Å
58	R	98.3	Very high	95.7	Very high	123 Å²	123	73.8 Å²	73.8	46%	0.464	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	122.7	160	-69.8	176.1	-70.3	-166.2	-12.4	110	R5 E33 A34 A35 V60	R5-R58 VanDerWaalsContact NH2-NH1 3.12Å; E33-R58 PolarHBondContact O-N 3.05Å; E33-R58 IonicContact OE2-NH2 3.71Å; A34-R58 CarbonylContact C-O 3.55Å; A34-R58 VanDerWaalsContact CA-O 3.24Å; A34-R58 WeakPolarHBondContact CA-O 3.34Å; A35-R58 PolarHBondContact N-O 3.45Å; R58-V60 HydrophobicContact CB-CG1 4.07Å; R58-V60 PolarHBondContact O-N 3.4Å
59	L	97.6	Very high	94	Very high	68 Å²	68	83.4 Å²	83.4	36%	0.356	50%	0.496	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.2	106.3	165.7	-87.9	162.3	0	0	0	108.8	L24 A35 V37 A52	L24-L59 HydrophobicContact CD2-CD2 4.35Å; A35-L59 CarbonylContact O-C 3.57Å; A35-L59 WeakPolarHBondContact O-CA 3.34Å; V37-L59 HydrophobicContact CB-CD2 4.4Å; V37-L59 HydrophobicContact CG2-CD2 3.59Å; A52-L59 HydrophobicContact CB-CD1 3.96Å; A52-L59 HydrophobicContact CB-CG 4.28Å
60	V	98.2	Very high	93.8	Very high	80 Å²	80	85.4 Å²	85.4	49%	0.485	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	-16.2	-172.1	-65.9	0	0	0	0	113.8	S7 A34 A35 R58	S7-V60 WeakPolarHBondContact OG-CG2 3.35Å; A34-V60 HydrophobicContact CB-CG1 3.85Å; A34-V60 HydrophobicContact CB-CG2 4.2Å; A35-V60 WeakPolarHBondContact O-CG2 3.47Å; A35-V60 PolarHBondContact O-N 2.91Å; R58-V60 HydrophobicContact CB-CG1 4.07Å; R58-V60 PolarHBondContact O-N 3.4Å
61	L	98.3	Very high	93.6	Very high	77 Å²	77	86.4 Å²	86.4	40%	0.403	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.1	136.4	179.4	179.6	152.4	0	0	0	111.4	E36 V37	E36-L61 WeakPolarHBondContact CA-O 3.37Å; E36-L61 HydrophobicContact CB-CB 3.76Å; E36-L61 HydrophobicContact CB-CD2 4.12Å; V37-L61 PolarHBondContact N-O 2.78Å
62	I	97.4	Very high	93.3	Very high	95 Å²	95	91.1 Å²	91.1	49%	0.487	53%	0.532	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.2	150.1	162	65.7	174.2	0	0	0	109.6	V37 P40	V37-I62 HydrophobicContact CB-CG2 4.45Å; V37-I62 VanDerWaalsContact O-CA 3.25Å; V37-I62 WeakPolarHBondContact O-CA 3.17Å; P40-I62 HydrophobicContact CG-CB 4.38Å; P40-I62 HydrophobicContact CG-CG2 4.09Å
63	N	96.8	Very high	93	Very high	61 Å²	61	96.1 Å²	96.1	33%	0.326	56%	0.56	S	S	.	*	P	Polyproline II helix	trans	-89.1	153.1	170.5	-56	-29.4	0	0	0	109.9	A38 Y41	A38-N63 WeakPolarHBondContact O-CA 3.28Å; A38-N63 WeakPolarHBondContact O-CB 3.28Å; A38-N63 PolarHBondContact O-N 2.91Å; Y41-N63 WeakPolarHBondContact CE2-O 3.26Å; Y41-N63 PolarHBondContact OH-O 3.35Å
64	T	95.8	Very high	92.7	Very high	113 Å²	113	92.6 Å²	92.6	69%	0.693	55%	0.551	S	S	*	*	P	Polyproline II helix	trans	-59.6	162.9	169.1	49	0	0	0	0	112.1	W39 Y41 R66	W39-T64 PolarHBondContact NE1-O 2.95Å; Y41-T64 VanDerWaalsContact OH-C 3.29Å; Y41-T64 VanDerWaalsContact OH-CA 3.29Å; Y41-T64 WeakPolarHBondContact OH-CA 3.28Å; T64-R66 PolarHBondContact O-N 3.21Å
65	P	93.8	Very high	92.3	Very high	89 Å²	89	91.9 Å²	91.9	58%	0.578	55%	0.546	S	S	*	.	P	Polyproline II helix	trans	-53	139.2	176.4	-26.6	36.5	0	0	0	111.3	Y41 G67	Y41-P65 HydrophobicContact CE1-CG 4.27Å; Y41-P65 VanDerWaalsContact CE2-CA 3.47Å; Y41-P65 HydrophobicContact CE2-CB 4.2Å; Y41-P65 HydrophobicContact CE2-CG 3.99Å; Y41-P65 VanDerWaalsContact OH-CD 3.25Å; Y41-P65 WeakPolarHBondContact OH-CD 3.43Å; P65-G67 PolarHBondContact O-N 3.29Å
66	R	89.1	Confident	91.9	Very high	177 Å²	177	97.2 Å²	97.2	67%	0.668	57%	0.574	S	S	*	*	P	Polyproline II helix	trans	-63.9	126.2	172.6	-59.8	-179.6	122.9	178	-5.1	107.2	W39 T64	W39-R66 HydrophobicContact CD2-CG 3.85Å; W39-R66 VanDerWaalsContact CE2-NE 3.33Å; W39-R66 HydrophobicContact CG-CG 3.89Å; W39-R66 VanDerWaalsContact CH2-CZ 3.46Å; W39-R66 HydrophobicContact CZ2-CG 4.18Å; W39-R66 VanDerWaalsContact CZ2-NE 3.32Å; W39-R66 VanDerWaalsContact NE1-CG 3.33Å; T64-R66 PolarHBondContact O-N 3.21Å
67	G	86.6	Confident	91.4	Very high	73 Å²	73	100.2 Å²	100.2	75%	0.753	57%	0.571	S	S	*	*	P	Polyproline II helix	trans	-57.6	152.1	174.4	0	0	0	0	0	110.9	P65	P65-G67 PolarHBondContact O-N 3.29Å
68	S	76.9	Confident	90.7	Very high	119 Å²	119	107.4 Å²	107.4	83%	0.832	61%	0.613	S	S	*	*			trans	-79.5	113.5	166.6	50.9	0	0	0	0	108
69	T	60.3	Low	90.1	Very high	214 Å²	214	106 Å²	106	100%	1.313	63%	0.627	S	S	*	*			trans	-58.2	0	159.6	43.5	0	0	0	0	110.4

Retrieved 69 of 69 residues in 62 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).