Z4YLL5_MOUSE Loading...

SKI/DACH domain containing 1

AlphaFold DB , UniProt , Accession Z4YLL5, Species MOUSE (Mus musculus, Mouse), Gene Skida1, Length 65 aa.

						>Z4YLL5_MOUSE|Z4YLL5|Skida1
MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCDLEELR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.1	Very low	76.8	Confident	242 Å²	242	106.7 Å²	106.7	100%	1.192	58%	0.576	S	S	*	*				0	77.8	0	-86.1	171.7	159.8	0	0	107.6
2	G	50.3	Low	77.5	Confident	63 Å²	63	110.5 Å²	110.5	65%	0.649	60%	0.595	S	S	*	*			trans	-99.8	126.7	179.7	0	0	0	0	0	108.7	L4	G2-L4 PolarHBondContact O-N 3.09Å
3	D	61.9	Low	78.2	Confident	144 Å²	144	106.9 Å²	106.9	77%	0.77	60%	0.6	S	S	*	*			trans	-44.7	89.1	-176	-59.1	-108.8	0	0	0	114.2	K5	D3-K5 VanDerWaalsContact C-N 3.34Å; D3-K5 PolarHBondContact O-N 2.96Å
4	L	68.5	Low	78.9	Confident	67 Å²	67	101.4 Å²	101.4	35%	0.351	57%	0.57	S	S	.	*			trans	-68.6	96.8	162.9	-76	162.8	0	0	0	107.1	G2 S6 L19 I21 E63	G2-L4 PolarHBondContact O-N 3.09Å; L4-S6 PolarHBondContact O-N 3.36Å; L4-L19 HydrophobicContact CB-CD1 4.13Å; L4-L19 HydrophobicContact CD2-CD2 3.83Å; L4-L19 HydrophobicContact CD2-CG 4.14Å; L4-I21 HydrophobicContact CD2-CG1 4.03Å; L4-E63 HydrophobicContact CD1-CG 4.05Å; L4-E63 HydrophobicContact CD2-CG 4.11Å
5	K	80.1	Confident	79.7	Confident	138 Å²	138	105.7 Å²	105.7	60%	0.6	57%	0.574	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-76.3	110.8	176.9	-71.1	-175.5	177.5	-178.5	0	108.9	D3 I20	D3-K5 VanDerWaalsContact C-N 3.34Å; D3-K5 PolarHBondContact O-N 2.96Å; K5-I20 HydrophobicContact CB-CB 4.2Å; K5-I20 HydrophobicContact CB-CD1 4.05Å; K5-I20 HydrophobicContact CB-CG1 4.28Å; K5-I20 PolarHBondContact O-N 3.21Å
6	S	86	Confident	80.4	Confident	94 Å²	94	99.3 Å²	99.3	66%	0.657	54%	0.539	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.6	156.1	172.2	56.7	0	0	0	0	111.1	L4 Y18	L4-S6 PolarHBondContact O-N 3.36Å; S6-Y18 VanDerWaalsContact CA-O 3.27Å; S6-Y18 WeakPolarHBondContact CA-O 3.37Å
7	G	89.4	Confident	80.9	Confident	17 Å²	17	94.4 Å²	94.4	18%	0.175	52%	0.517	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-168.7	-171.4	177.3	0	0	0	0	0	111.8	G17 Y18	G7-G17 WeakPolarHBondContact O-CA 3.31Å; G7-Y18 VanDerWaalsContact C-CE1 3.43Å; G7-Y18 PolarHBondContact N-O 3.19Å; G7-Y18 PolarHBondContact O-N 2.97Å
8	F	90.6	Very high	81.4	Confident	131 Å²	131	92.3 Å²	92.3	58%	0.575	50%	0.501	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.7	138.3	174.4	-63.7	-88.4	0	0	0	109.5	R15 L16	F8-R15 HydrophobicContact CB-CG 3.91Å; F8-R15 HydrophobicContact CD1-CG 4.17Å; F8-R15 HydrophobicContact CG-CG 4.36Å; F8-L16 CarbonylContact C-O 3.53Å; F8-L16 VanDerWaalsContact CA-O 3.3Å; F8-L16 WeakPolarHBondContact CA-O 3.38Å
9	E	91.2	Very high	81.8	Confident	82 Å²	82	88.9 Å²	88.9	38%	0.383	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.4	142.7	174.7	-172.8	171.8	86	0	0	109.4	V11 L16 Y18 Q25 F27	E9-V11 HydrophobicContact CG-CG2 4.4Å; E9-L16 PolarHBondContact N-O 2.91Å; E9-L16 PolarHBondContact O-N 2.93Å; E9-Y18 HydrophobicContact CB-CD1 3.92Å; E9-Y18 HydrophobicContact CB-CE1 4.14Å; E9-Q25 PolarHBondContact OE1-NE2 3.01Å; E9-Q25 PolarHBondContact OE2-NE2 2.82Å; E9-Q25 VanDerWaalsContact OE2-NE2 3.09Å; E9-F27 HydrophobicContact CB-CE1 4.18Å; E9-F27 WeakPolarHBondContact OE1-CZ 3.34Å
10	E	91.6	Very high	82	Confident	151 Å²	151	87 Å²	87	71%	0.706	47%	0.471	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.8	119.1	176.3	-166.4	175.2	103.7	0	0	109.8	V14	E10-V14 CarbonylContact C-O 3.48Å; E10-V14 WeakPolarHBondContact CA-O 3.42Å
11	V	87.4	Confident	82	Confident	45 Å²	45	83.3 Å²	83.3	27%	0.273	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.7	122	179.6	-177.2	0	0	0	0	107.6	E9 G13 V14 L16 F27 L36	E9-V11 HydrophobicContact CG-CG2 4.4Å; V11-G13 PolarHBondContact O-N 3.43Å; V11-V14 PolarHBondContact N-O 3.28Å; V11-V14 WeakPolarHBondContact O-CB 3.27Å; V11-V14 PolarHBondContact O-N 2.82Å; V11-L16 HydrophobicContact CB-CD1 3.85Å; V11-L16 HydrophobicContact CG1-CD1 4.5Å; V11-L16 HydrophobicContact CG2-CD1 3.99Å; V11-F27 HydrophobicContact CG2-CE1 4.21Å; V11-F27 HydrophobicContact CG2-CZ 4.12Å; V11-L36 HydrophobicContact CG1-CD1 4.21Å
12	D	85	Confident	83.5	Confident	152 Å²	152	81.3 Å²	81.3	81%	0.813	44%	0.435	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.1	34.5	-179.7	-143.2	-115.8	0	0	0	113.4	V14 L36	D12-V14 VanDerWaalsContact C-N 3.27Å; D12-V14 PolarHBondContact O-N 2.98Å; D12-L36 HydrophobicContact CB-CD2 3.38Å
13	G	86.7	Confident	85	Confident	64 Å²	64	81.6 Å²	81.6	66%	0.66	44%	0.439	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.9	9.5	-176.4	0	0	0	0	0	114.8	V11	V11-G13 PolarHBondContact O-N 3.43Å
14	V	88.3	Confident	86.1	Confident	29 Å²	29	82 Å²	82	18%	0.176	43%	0.433	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	129.2	175.3	176.3	0	0	0	0	110.1	E10 V11 D12 L16 D35 L36	E10-V14 CarbonylContact C-O 3.48Å; E10-V14 WeakPolarHBondContact CA-O 3.42Å; V11-V14 PolarHBondContact N-O 3.28Å; V11-V14 WeakPolarHBondContact O-CB 3.27Å; V11-V14 PolarHBondContact O-N 2.82Å; D12-V14 VanDerWaalsContact C-N 3.27Å; D12-V14 PolarHBondContact O-N 2.98Å; V14-L16 HydrophobicContact CG1-CD2 3.72Å; V14-L16 HydrophobicContact CG1-CG 4.02Å; V14-L16 PolarHBondContact O-N 3.49Å; V14-D35 HydrophobicContact CB-CB 4.25Å; V14-D35 HydrophobicContact CG1-CB 3.28Å; V14-D35 HydrophobicContact CG2-CB 3.98Å; V14-L36 HydrophobicContact CB-CD2 4.35Å; V14-L36 HydrophobicContact CG2-CD2 4.14Å; V14-L36 HydrophobicContact CG2-CG 4.46Å
15	R	90.1	Very high	86.9	Confident	167 Å²	167	82.4 Å²	82.4	63%	0.63	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81	100.5	174.2	-173.1	176.9	178.7	-177.1	0.1	111.4	F8 Q31	F8-R15 HydrophobicContact CB-CG 3.91Å; F8-R15 HydrophobicContact CD1-CG 4.17Å; F8-R15 HydrophobicContact CG-CG 4.36Å; R15-Q31 PolarHBondContact O-NE2 3.39Å
16	L	90.6	Very high	87.3	Confident	2 Å²	2	78.3 Å²	78.3	1%	0.01	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.1	134.2	-179	-63.8	173.8	0	0	0	112.1	F8 E9 V11 V14 F27 Q31 V32 L36	F8-L16 CarbonylContact C-O 3.53Å; F8-L16 VanDerWaalsContact CA-O 3.3Å; F8-L16 WeakPolarHBondContact CA-O 3.38Å; E9-L16 PolarHBondContact N-O 2.91Å; E9-L16 PolarHBondContact O-N 2.93Å; V11-L16 HydrophobicContact CB-CD1 3.85Å; V11-L16 HydrophobicContact CG1-CD1 4.5Å; V11-L16 HydrophobicContact CG2-CD1 3.99Å; V14-L16 HydrophobicContact CG1-CD2 3.72Å; V14-L16 HydrophobicContact CG1-CG 4.02Å; V14-L16 PolarHBondContact O-N 3.49Å; L16-F27 HydrophobicContact CB-CD1 3.77Å; L16-F27 HydrophobicContact CB-CE1 4.2Å; L16-F27 HydrophobicContact CD1-CD1 4.13Å; L16-F27 HydrophobicContact CD1-CG 4.49Å; L16-Q31 HydrophobicContact CD2-CB 4.08Å; L16-Q31 HydrophobicContact CD2-CG 3.69Å; L16-V32 HydrophobicContact CD1-CG2 3.99Å; L16-V32 HydrophobicContact CD2-CG2 4.3Å; L16-L36 HydrophobicContact CD1-CD1 3.6Å; L16-L36 HydrophobicContact CD1-CG 4.38Å
17	G	89.6	Confident	87.4	Confident	16 Å²	16	77.2 Å²	77.2	17%	0.165	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.4	135.4	166.7	0	0	0	0	0	110.9	G7 A28	G7-G17 WeakPolarHBondContact O-CA 3.31Å; G17-A28 PolarHBondContact O-N 3.31Å
18	Y	89.9	Confident	87.2	Confident	58 Å²	58	78.4 Å²	78.4	23%	0.227	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	155.8	173	73.5	-99	0	0	0	112	S6 G7 E9 I20 Q25 M26	S6-Y18 VanDerWaalsContact CA-O 3.27Å; S6-Y18 WeakPolarHBondContact CA-O 3.37Å; G7-Y18 VanDerWaalsContact C-CE1 3.43Å; G7-Y18 PolarHBondContact N-O 3.19Å; G7-Y18 PolarHBondContact O-N 2.97Å; E9-Y18 HydrophobicContact CB-CD1 3.92Å; E9-Y18 HydrophobicContact CB-CE1 4.14Å; Y18-I20 HydrophobicContact CD2-CG1 4.13Å; Y18-I20 HydrophobicContact CE2-CD1 4.19Å; Y18-I20 HydrophobicContact CE2-CG1 3.93Å; Y18-Q25 HydrophobicContact CD2-CG 3.65Å; Y18-Q25 HydrophobicContact CE2-CG 4.4Å; Y18-Q25 HydrophobicContact CG-CG 3.72Å; Y18-M26 CarbonylContact C-O 3.58Å; Y18-M26 WeakPolarHBondContact CA-O 3.17Å; Y18-M26 WeakPolarHBondContact CB-O 3.36Å
19	L	88.4	Confident	87	Confident	27 Å²	27	75.4 Å²	75.4	14%	0.141	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	135	172.1	-158.6	69.5	0	0	0	109.2	L4 I21 M26 E63	L4-L19 HydrophobicContact CB-CD1 4.13Å; L4-L19 HydrophobicContact CD2-CD2 3.83Å; L4-L19 HydrophobicContact CD2-CG 4.14Å; L19-I21 HydrophobicContact CB-CG1 4.45Å; L19-I21 HydrophobicContact CD2-CD1 3.85Å; L19-I21 HydrophobicContact CD2-CG1 3.85Å; L19-I21 HydrophobicContact CG-CD1 4.47Å; L19-I21 HydrophobicContact CG-CG1 4.14Å; L19-I21 PolarHBondContact O-N 2.86Å; L19-M26 PolarHBondContact N-O 2.8Å; L19-M26 PolarHBondContact O-N 2.83Å; L19-E63 HydrophobicContact CD2-CB 3.87Å; L19-E63 HydrophobicContact CD2-CG 4.29Å
20	I	85.8	Confident	86.6	Confident	51 Å²	51	75.5 Å²	75.5	26%	0.262	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.9	107.6	173	-57.3	-178.7	0	0	0	108.4	K5 Y18 K24	K5-I20 HydrophobicContact CB-CB 4.2Å; K5-I20 HydrophobicContact CB-CD1 4.05Å; K5-I20 HydrophobicContact CB-CG1 4.28Å; K5-I20 PolarHBondContact O-N 3.21Å; Y18-I20 HydrophobicContact CD2-CG1 4.13Å; Y18-I20 HydrophobicContact CE2-CD1 4.19Å; Y18-I20 HydrophobicContact CE2-CG1 3.93Å; I20-K24 WeakPolarHBondContact CA-O 3.47Å
21	I	81.6	Confident	86.3	Confident	9 Å²	9	70.9 Å²	70.9	5%	0.046	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	121.9	176.6	-62.8	163.2	0	0	0	107.4	L4 L19 G23 K24 M26 E63	L4-I21 HydrophobicContact CD2-CG1 4.03Å; L19-I21 HydrophobicContact CB-CG1 4.45Å; L19-I21 HydrophobicContact CD2-CD1 3.85Å; L19-I21 HydrophobicContact CD2-CG1 3.85Å; L19-I21 HydrophobicContact CG-CD1 4.47Å; L19-I21 HydrophobicContact CG-CG1 4.14Å; L19-I21 PolarHBondContact O-N 2.86Å; I21-G23 PolarHBondContact O-N 3.17Å; I21-K24 PolarHBondContact N-O 3.18Å; I21-K24 PolarHBondContact O-N 3.4Å; I21-M26 HydrophobicContact CB-CE 3.5Å; I21-M26 VanDerWaalsContact CB-CE 3.5Å; I21-M26 HydrophobicContact CD1-CE 3.59Å; I21-M26 HydrophobicContact CG1-CE 4.12Å; I21-M26 HydrophobicContact CG2-CE 3.72Å; I21-E63 HydrophobicContact CD1-CG 4.42Å; I21-E63 WeakPolarHBondContact CD1-OE1 3.3Å; I21-E63 VanDerWaalsContact CG1-OE1 3.31Å; I21-E63 WeakPolarHBondContact CG1-OE1 3.39Å; I21-E63 WeakPolarHBondContact CG2-OE1 3.42Å
22	K	79.9	Confident	86.3	Confident	200 Å²	200	70 Å²	70	87%	0.87	38%	0.381	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.8	37.4	-179	-61.2	176.6	177.8	174.5	0	113.4	K24	K22-K24 PolarHBondContact O-N 2.89Å
23	G	81.6	Confident	86.4	Confident	70 Å²	70	63.8 Å²	63.8	72%	0.722	35%	0.347	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.3	7.9	-178.9	0	0	0	0	0	114.9	I21	I21-G23 PolarHBondContact O-N 3.17Å
24	K	84.9	Confident	86.3	Confident	152 Å²	152	64.6 Å²	64.6	66%	0.661	34%	0.339	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.8	128.9	173.3	-66.7	-174.8	179.5	-177.2	0	110.2	I20 I21 K22 M26	I20-K24 WeakPolarHBondContact CA-O 3.47Å; I21-K24 PolarHBondContact N-O 3.18Å; I21-K24 PolarHBondContact O-N 3.4Å; K22-K24 PolarHBondContact O-N 2.89Å; K24-M26 PolarHBondContact O-N 3.27Å
25	Q	85.9	Confident	86.3	Confident	75 Å²	75	66.4 Å²	66.4	35%	0.35	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.5	123.2	170.5	-174.1	164.3	-46.2	0	0	109.2	E9 Y18 F27	E9-Q25 PolarHBondContact OE1-NE2 3.01Å; E9-Q25 PolarHBondContact OE2-NE2 2.82Å; E9-Q25 VanDerWaalsContact OE2-NE2 3.09Å; Y18-Q25 HydrophobicContact CD2-CG 3.65Å; Y18-Q25 HydrophobicContact CE2-CG 4.4Å; Y18-Q25 HydrophobicContact CG-CG 3.72Å; Q25-F27 HydrophobicContact CG-CZ 4.32Å; Q25-F27 VanDerWaalsContact NE2-CZ 3.28Å
26	M	87.8	Confident	86.1	Confident	53 Å²	53	60.9 Å²	60.9	26%	0.261	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	135	177.2	-63.8	-144.8	-108.8	0	0	109.4	Y18 L19 I21 K24 H57	Y18-M26 CarbonylContact C-O 3.58Å; Y18-M26 WeakPolarHBondContact CA-O 3.17Å; Y18-M26 WeakPolarHBondContact CB-O 3.36Å; L19-M26 PolarHBondContact N-O 2.8Å; L19-M26 PolarHBondContact O-N 2.83Å; I21-M26 HydrophobicContact CB-CE 3.5Å; I21-M26 VanDerWaalsContact CB-CE 3.5Å; I21-M26 HydrophobicContact CD1-CE 3.59Å; I21-M26 HydrophobicContact CG1-CE 4.12Å; I21-M26 HydrophobicContact CG2-CE 3.72Å; K24-M26 PolarHBondContact O-N 3.27Å; M26-H57 HydrophobicContact CE-CB 3.35Å; M26-H57 HydrophobicContact SD-CB 3.5Å; M26-H57 VanDerWaalsContact SD-CB 3.5Å
27	F	89.5	Confident	85.8	Confident	71 Å²	71	63.2 Å²	63.2	31%	0.311	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.1	150.2	177.9	-62.5	-79.5	0	0	0	111	E9 V11 L16 Q25 L29 V32	E9-F27 HydrophobicContact CB-CE1 4.18Å; E9-F27 WeakPolarHBondContact OE1-CZ 3.34Å; V11-F27 HydrophobicContact CG2-CE1 4.21Å; V11-F27 HydrophobicContact CG2-CZ 4.12Å; L16-F27 HydrophobicContact CB-CD1 3.77Å; L16-F27 HydrophobicContact CB-CE1 4.2Å; L16-F27 HydrophobicContact CD1-CD1 4.13Å; L16-F27 HydrophobicContact CD1-CG 4.49Å; Q25-F27 HydrophobicContact CG-CZ 4.32Å; Q25-F27 VanDerWaalsContact NE2-CZ 3.28Å; F27-L29 PolarHBondContact O-N 2.9Å; F27-V32 HydrophobicContact CB-CG2 3.9Å
28	A	85.8	Confident	85.7	Confident	41 Å²	41	69.5 Å²	69.5	34%	0.339	37%	0.366	S	S	.	.			trans	-63	109.1	171.4	0	0	0	0	0	110.1	G17 S30 Q31 V32	G17-A28 PolarHBondContact O-N 3.31Å; A28-S30 PolarHBondContact O-N 2.81Å; A28-Q31 HydrophobicContact CB-CB 4.03Å; A28-Q31 WeakPolarHBondContact O-CB 3.23Å; A28-Q31 PolarHBondContact O-N 3.03Å; A28-V32 WeakPolarHBondContact O-CG2 3.28Å; A28-V32 PolarHBondContact O-N 2.88Å
29	L	84.9	Confident	85.6	Confident	69 Å²	69	73.6 Å²	73.6	36%	0.361	39%	0.391	S	S	.	.	H	α-helix	trans	-60	-34.3	-176.8	-170.9	66.5	0	0	0	112.2	F27 Q31 V32 F33 M49	F27-L29 PolarHBondContact O-N 2.9Å; L29-Q31 VanDerWaalsContact C-N 3.33Å; L29-Q31 PolarHBondContact O-N 2.89Å; L29-V32 PolarHBondContact O-N 3.48Å; L29-F33 HydrophobicContact CD1-CD1 4.41Å; L29-F33 HydrophobicContact CD1-CE1 3.64Å; L29-F33 HydrophobicContact CD1-CE2 4.08Å; L29-F33 HydrophobicContact CD1-CZ 3.49Å; L29-F33 VanDerWaalsContact CD1-CZ 3.49Å; L29-F33 HydrophobicContact CD2-CE2 3.73Å; L29-F33 HydrophobicContact CD2-CZ 3.67Å; L29-F33 HydrophobicContact CG-CD2 4.11Å; L29-F33 HydrophobicContact CG-CE1 3.99Å; L29-F33 HydrophobicContact CG-CE2 3.48Å; L29-F33 VanDerWaalsContact CG-CE2 3.48Å; L29-F33 HydrophobicContact CG-CZ 3.42Å; L29-F33 VanDerWaalsContact CG-CZ 3.42Å; L29-F33 WeakPolarHBondContact O-CD2 3.19Å; L29-F33 WeakPolarHBondContact O-CG 3.49Å; L29-F33 PolarHBondContact O-N 2.85Å; L29-M49 HydrophobicContact CD1-CE 3.95Å; L29-M49 HydrophobicContact CD1-SD 4.19Å; L29-M49 HydrophobicContact CD2-CE 4.36Å
30	S	83.6	Confident	85.4	Confident	84 Å²	84	75.5 Å²	75.5	59%	0.587	40%	0.401	S	S	*	.	H	α-helix	trans	-59.6	-42.1	173.9	48.1	0	0	0	0	112.6	A28 F33 T34	A28-S30 PolarHBondContact O-N 2.81Å; S30-F33 PolarHBondContact O-N 3.33Å; S30-T34 WeakPolarHBondContact O-CB 3.26Å; S30-T34 PolarHBondContact O-N 3.49Å; S30-T34 VanDerWaalsContact O-N 3.14Å; S30-T34 PolarHBondContact O-OG1 2.85Å
31	Q	85.6	Confident	85.6	Confident	53 Å²	53	76.8 Å²	76.8	25%	0.248	41%	0.413	C	S	.	.	H	α-helix	trans	-72.6	-44.6	179.3	-161.8	-178.6	-6.5	0	0	110.8	R15 L16 A28 L29 F33 T34 D35	R15-Q31 PolarHBondContact O-NE2 3.39Å; L16-Q31 HydrophobicContact CD2-CB 4.08Å; L16-Q31 HydrophobicContact CD2-CG 3.69Å; A28-Q31 HydrophobicContact CB-CB 4.03Å; A28-Q31 WeakPolarHBondContact O-CB 3.23Å; A28-Q31 PolarHBondContact O-N 3.03Å; L29-Q31 VanDerWaalsContact C-N 3.33Å; L29-Q31 PolarHBondContact O-N 2.89Å; Q31-F33 PolarHBondContact O-N 3.23Å; Q31-T34 PolarHBondContact O-N 3.04Å; Q31-D35 WeakPolarHBondContact CG-OD2 3.38Å; Q31-D35 PolarHBondContact O-N 2.89Å
32	V	87.6	Confident	85.7	Confident	26 Å²	26	84.2 Å²	84.2	16%	0.158	44%	0.44	C	S	.	.	I	π-helix	trans	-54.3	-41.7	172.8	173.3	0	0	0	0	111.3	L16 F27 A28 L29 L36 L37	L16-V32 HydrophobicContact CD1-CG2 3.99Å; L16-V32 HydrophobicContact CD2-CG2 4.3Å; F27-V32 HydrophobicContact CB-CG2 3.9Å; A28-V32 WeakPolarHBondContact O-CG2 3.28Å; A28-V32 PolarHBondContact O-N 2.88Å; L29-V32 PolarHBondContact O-N 3.48Å; V32-L36 HydrophobicContact CG1-CB 4.44Å; V32-L36 HydrophobicContact CG1-CD1 4.06Å; V32-L36 HydrophobicContact CG2-CD1 4.44Å; V32-L36 WeakPolarHBondContact O-CB 3.47Å; V32-L36 PolarHBondContact O-N 3.17Å; V32-L36 VanDerWaalsContact O-N 3.17Å; V32-L37 HydrophobicContact CG1-CD1 4.18Å; V32-L37 HydrophobicContact CG1-CG 4.39Å; V32-L37 PolarHBondContact O-N 3.41Å
33	F	86.4	Confident	86	Confident	22 Å²	22	79.7 Å²	79.7	10%	0.096	43%	0.43	C	S	.	.	I	π-helix	trans	-69.4	-34.1	177.2	-67.1	-23.6	0	0	0	114	L29 S30 Q31 L37 K38 V45 H46 M49	L29-F33 HydrophobicContact CD1-CD1 4.41Å; L29-F33 HydrophobicContact CD1-CE1 3.64Å; L29-F33 HydrophobicContact CD1-CE2 4.08Å; L29-F33 HydrophobicContact CD1-CZ 3.49Å; L29-F33 VanDerWaalsContact CD1-CZ 3.49Å; L29-F33 HydrophobicContact CD2-CE2 3.73Å; L29-F33 HydrophobicContact CD2-CZ 3.67Å; L29-F33 HydrophobicContact CG-CD2 4.11Å; L29-F33 HydrophobicContact CG-CE1 3.99Å; L29-F33 HydrophobicContact CG-CE2 3.48Å; L29-F33 VanDerWaalsContact CG-CE2 3.48Å; L29-F33 HydrophobicContact CG-CZ 3.42Å; L29-F33 VanDerWaalsContact CG-CZ 3.42Å; L29-F33 WeakPolarHBondContact O-CD2 3.19Å; L29-F33 WeakPolarHBondContact O-CG 3.49Å; L29-F33 PolarHBondContact O-N 2.85Å; S30-F33 PolarHBondContact O-N 3.33Å; Q31-F33 PolarHBondContact O-N 3.23Å; F33-L37 HydrophobicContact CD1-CD1 4.1Å; F33-L37 HydrophobicContact CE1-CD1 4.37Å; F33-L37 CarbonylContact O-C 3.32Å; F33-L37 VanDerWaalsContact O-C 3.32Å; F33-K38 PolarHBondContact O-N 3.37Å; F33-V45 HydrophobicContact CD1-CG1 4.04Å; F33-V45 HydrophobicContact CE1-CB 4.13Å; F33-V45 HydrophobicContact CE1-CG1 3.35Å; F33-V45 HydrophobicContact CZ-CG1 4.13Å; F33-H46 AromaticContact CE2-NE2 3.55Å; F33-H46 AromaticContact CZ-CD2 3.76Å; F33-H46 AromaticContact CZ-NE2 3.67Å; F33-M49 HydrophobicContact CE1-SD 4.23Å; F33-M49 HydrophobicContact CZ-SD 4.05Å
34	T	85.4	Confident	86.4	Confident	81 Å²	81	79 Å²	79	50%	0.497	41%	0.411	S	S	.	.	I	π-helix	trans	-84.9	-34.6	-173.6	-53.2	0	0	0	0	112	S30 Q31 K38	S30-T34 WeakPolarHBondContact O-CB 3.26Å; S30-T34 PolarHBondContact O-N 3.49Å; S30-T34 VanDerWaalsContact O-N 3.14Å; S30-T34 PolarHBondContact O-OG1 2.85Å; Q31-T34 PolarHBondContact O-N 3.04Å; T34-K38 WeakPolarHBondContact O-CB 3.1Å
35	D	87.4	Confident	86.5	Confident	68 Å²	68	72.3 Å²	72.3	36%	0.364	38%	0.383	S	S	.	.	I	π-helix	trans	-100.4	-56.8	-175.6	-67.5	-66.4	0	0	0	112.1	V14 Q31	V14-D35 HydrophobicContact CB-CB 4.25Å; V14-D35 HydrophobicContact CG1-CB 3.28Å; V14-D35 HydrophobicContact CG2-CB 3.98Å; Q31-D35 WeakPolarHBondContact CG-OD2 3.38Å; Q31-D35 PolarHBondContact O-N 2.89Å
36	L	85.3	Confident	86.4	Confident	51 Å²	51	73.6 Å²	73.6	27%	0.267	39%	0.389	S	S	.	.	I	π-helix	trans	-75.3	-47.8	-177.2	-74.4	171.5	0	0	0	112.4	V11 D12 V14 L16 V32	V11-L36 HydrophobicContact CG1-CD1 4.21Å; D12-L36 HydrophobicContact CB-CD2 3.38Å; V14-L36 HydrophobicContact CB-CD2 4.35Å; V14-L36 HydrophobicContact CG2-CD2 4.14Å; V14-L36 HydrophobicContact CG2-CG 4.46Å; L16-L36 HydrophobicContact CD1-CD1 3.6Å; L16-L36 HydrophobicContact CD1-CG 4.38Å; V32-L36 HydrophobicContact CG1-CB 4.44Å; V32-L36 HydrophobicContact CG1-CD1 4.06Å; V32-L36 HydrophobicContact CG2-CD1 4.44Å; V32-L36 WeakPolarHBondContact O-CB 3.47Å; V32-L36 PolarHBondContact O-N 3.17Å; V32-L36 VanDerWaalsContact O-N 3.17Å
37	L	85.7	Confident	86.5	Confident	51 Å²	51	78.9 Å²	78.9	27%	0.267	41%	0.41	S	S	.	.	S	Bend	trans	-103.7	23.4	-171.3	-53.3	179.9	0	0	0	112.9	V32 F33 N39 I40 V45	V32-L37 HydrophobicContact CG1-CD1 4.18Å; V32-L37 HydrophobicContact CG1-CG 4.39Å; V32-L37 PolarHBondContact O-N 3.41Å; F33-L37 HydrophobicContact CD1-CD1 4.1Å; F33-L37 HydrophobicContact CE1-CD1 4.37Å; F33-L37 CarbonylContact O-C 3.32Å; F33-L37 VanDerWaalsContact O-C 3.32Å; L37-N39 PolarHBondContact O-N 2.95Å; L37-I40 HydrophobicContact CD2-CD1 4.1Å; L37-I40 PolarHBondContact O-N 3.35Å; L37-V45 HydrophobicContact CB-CG2 4.33Å; L37-V45 HydrophobicContact CD1-CB 4.47Å; L37-V45 HydrophobicContact CD1-CG1 3.6Å; L37-V45 HydrophobicContact CD1-CG2 3.97Å
38	K	86.3	Confident	86.4	Confident	148 Å²	148	83.2 Å²	83.2	64%	0.643	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.2	-29.6	-175	77.2	-173.5	178.4	-173.3	0	114.7	F33 T34	F33-K38 PolarHBondContact O-N 3.37Å; T34-K38 WeakPolarHBondContact O-CB 3.1Å
39	N	87.6	Confident	86.4	Confident	144 Å²	144	82.9 Å²	82.9	77%	0.77	42%	0.417	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.3	-2.2	-178.4	-64.3	-36.6	0	0	0	113.5	L37	L37-N39 PolarHBondContact O-N 2.95Å
40	I	86	Confident	86.5	Confident	67 Å²	67	85.9 Å²	85.9	34%	0.344	43%	0.433	S	S	.	.	S	Bend	trans	-109.5	126.2	-178.9	-51.8	-174.5	0	0	0	109	L37 R42 T44 V45	L37-I40 HydrophobicContact CD2-CD1 4.1Å; L37-I40 PolarHBondContact O-N 3.35Å; I40-R42 PolarHBondContact O-N 2.94Å; I40-T44 HydrophobicContact CG2-CG2 4.1Å; I40-V45 HydrophobicContact CB-CG2 3.94Å; I40-V45 HydrophobicContact CG2-CG2 3.58Å
41	P	87.9	Confident	86.8	Confident	78 Å²	78	89.3 Å²	89.3	51%	0.506	44%	0.439	S	S	.	.			trans	-56.4	133.1	177.2	-23.5	31.7	0	0	0	111.7	T43 T44 V45	P41-T43 PolarHBondContact O-N 3.17Å; P41-T43 VanDerWaalsContact O-N 3.08Å; P41-T44 WeakPolarHBondContact O-CA 3.34Å; P41-T44 WeakPolarHBondContact O-CB 3.32Å; P41-T44 PolarHBondContact O-N 2.77Å; P41-V45 PolarHBondContact O-N 2.96Å; P41-V45 VanDerWaalsContact O-N 3.14Å
42	R	83.8	Confident	86.8	Confident	165 Å²	165	93 Å²	93	62%	0.623	46%	0.46	S	S	*	.	H	α-helix	trans	-51.7	-36.2	-179.4	-66.8	-175.8	178.5	107.4	0.8	113.2	I40 T44 V45 H46	I40-R42 PolarHBondContact O-N 2.94Å; R42-T44 VanDerWaalsContact C-N 3.33Å; R42-T44 PolarHBondContact O-N 3.5Å; R42-V45 PolarHBondContact O-N 3.23Å; R42-H46 WeakPolarHBondContact O-CB 3.5Å; R42-H46 PolarHBondContact O-CD2 2.95Å; R42-H46 VanDerWaalsContact O-CD2 3.3Å; R42-H46 PolarHBondContact O-N 3.01Å
43	T	87.9	Confident	86.5	Confident	105 Å²	105	100.4 Å²	100.4	64%	0.644	49%	0.49	S	S	*	.	H	α-helix	trans	-61.9	-38.9	176.3	53	0	0	0	0	112.7	P41 K47	P41-T43 PolarHBondContact O-N 3.17Å; P41-T43 VanDerWaalsContact O-N 3.08Å; T43-K47 PolarHBondContact O-N 3.02Å
44	T	88.1	Confident	86.3	Confident	54 Å²	54	102.9 Å²	102.9	33%	0.331	51%	0.507	S	S	.	.	H	α-helix	trans	-70.4	-42.1	176.8	-59.4	0	0	0	0	110.7	I40 P41 R42 K47 R48	I40-T44 HydrophobicContact CG2-CG2 4.1Å; P41-T44 WeakPolarHBondContact O-CA 3.34Å; P41-T44 WeakPolarHBondContact O-CB 3.32Å; P41-T44 PolarHBondContact O-N 2.77Å; R42-T44 VanDerWaalsContact C-N 3.33Å; R42-T44 PolarHBondContact O-N 3.5Å; T44-K47 PolarHBondContact O-N 3.01Å; T44-R48 PolarHBondContact O-N 3.23Å
45	V	87.6	Confident	85.8	Confident	12 Å²	12	108.6 Å²	108.6	7%	0.073	53%	0.525	C	S	.	.	H	α-helix	trans	-62.3	-46.2	176.4	-174.7	0	0	0	0	110.6	F33 L37 I40 P41 R42 K47 R48 M49	F33-V45 HydrophobicContact CD1-CG1 4.04Å; F33-V45 HydrophobicContact CE1-CB 4.13Å; F33-V45 HydrophobicContact CE1-CG1 3.35Å; F33-V45 HydrophobicContact CZ-CG1 4.13Å; L37-V45 HydrophobicContact CB-CG2 4.33Å; L37-V45 HydrophobicContact CD1-CB 4.47Å; L37-V45 HydrophobicContact CD1-CG1 3.6Å; L37-V45 HydrophobicContact CD1-CG2 3.97Å; I40-V45 HydrophobicContact CB-CG2 3.94Å; I40-V45 HydrophobicContact CG2-CG2 3.58Å; P41-V45 PolarHBondContact O-N 2.96Å; P41-V45 VanDerWaalsContact O-N 3.14Å; R42-V45 PolarHBondContact O-N 3.23Å; V45-K47 PolarHBondContact O-N 3.48Å; V45-R48 PolarHBondContact O-N 3.07Å; V45-M49 HydrophobicContact CG1-CG 4.31Å; V45-M49 HydrophobicContact CG1-SD 4.11Å; V45-M49 WeakPolarHBondContact O-CB 3.2Å; V45-M49 VanDerWaalsContact O-CG 3.32Å; V45-M49 WeakPolarHBondContact O-CG 3.43Å; V45-M49 PolarHBondContact O-N 3.18Å
46	H	84.9	Confident	85.2	Confident	102 Å²	102	112 Å²	112	47%	0.472	54%	0.536	S	S	.	.	H	α-helix	trans	-59.7	-44.7	176	-75.4	-161.6	0	0	0	112.2	F33 R42 R48 M49 D50	F33-H46 AromaticContact CE2-NE2 3.55Å; F33-H46 AromaticContact CZ-CD2 3.76Å; F33-H46 AromaticContact CZ-NE2 3.67Å; R42-H46 WeakPolarHBondContact O-CB 3.5Å; R42-H46 PolarHBondContact O-CD2 2.95Å; R42-H46 VanDerWaalsContact O-CD2 3.3Å; R42-H46 PolarHBondContact O-N 3.01Å; H46-R48 VanDerWaalsContact C-N 3.34Å; H46-R48 PolarHBondContact O-N 3.4Å; H46-M49 PolarHBondContact O-N 2.92Å; H46-D50 WeakPolarHBondContact O-CB 3.32Å; H46-D50 PolarHBondContact O-N 3.47Å
47	K	88.8	Confident	84.8	Confident	165 Å²	165	112.9 Å²	112.9	72%	0.717	54%	0.539	S	S	*	.	H	α-helix	trans	-59.7	-42.6	174.6	-84.3	-173.7	175.9	-177	0	112.4	T43 T44 V45 D50 H51	T43-K47 PolarHBondContact O-N 3.02Å; T44-K47 PolarHBondContact O-N 3.01Å; V45-K47 PolarHBondContact O-N 3.48Å; K47-D50 PolarHBondContact O-N 2.93Å; K47-H51 WeakPolarHBondContact O-CB 3.49Å; K47-H51 PolarHBondContact O-N 3.11Å
48	R	87.3	Confident	84.2	Confident	162 Å²	162	117.1 Å²	117.1	61%	0.611	56%	0.557	S	S	*	*	H	α-helix	trans	-67.5	-41	177.4	-76.6	-171.1	177.2	-167.8	0.5	112	T44 V45 H46 D50 H51 L52	T44-R48 PolarHBondContact O-N 3.23Å; V45-R48 PolarHBondContact O-N 3.07Å; H46-R48 VanDerWaalsContact C-N 3.34Å; H46-R48 PolarHBondContact O-N 3.4Å; R48-D50 VanDerWaalsContact C-N 3.32Å; R48-D50 PolarHBondContact O-N 3.32Å; R48-H51 PolarHBondContact O-N 2.83Å; R48-L52 VanDerWaalsContact O-CB 3.28Å; R48-L52 WeakPolarHBondContact O-CB 3.18Å; R48-L52 VanDerWaalsContact O-CG 3.23Å; R48-L52 WeakPolarHBondContact O-CG 3.49Å; R48-L52 PolarHBondContact O-N 3.45Å
49	M	87.3	Confident	83.6	Confident	34 Å²	34	113.6 Å²	113.6	17%	0.167	55%	0.55	C	S	.	*	H	α-helix	trans	-61.1	-42.6	175.3	-73.6	178.2	74.7	0	0	111.6	L29 F33 V45 H46 L52 K53 V54	L29-M49 HydrophobicContact CD1-CE 3.95Å; L29-M49 HydrophobicContact CD1-SD 4.19Å; L29-M49 HydrophobicContact CD2-CE 4.36Å; F33-M49 HydrophobicContact CE1-SD 4.23Å; F33-M49 HydrophobicContact CZ-SD 4.05Å; V45-M49 HydrophobicContact CG1-CG 4.31Å; V45-M49 HydrophobicContact CG1-SD 4.11Å; V45-M49 WeakPolarHBondContact O-CB 3.2Å; V45-M49 VanDerWaalsContact O-CG 3.32Å; V45-M49 WeakPolarHBondContact O-CG 3.43Å; V45-M49 PolarHBondContact O-N 3.18Å; H46-M49 PolarHBondContact O-N 2.92Å; M49-L52 CarbonylContact O-C 3.58Å; M49-L52 PolarHBondContact O-N 3.44Å; M49-K53 PolarHBondContact O-N 3.34Å; M49-V54 HydrophobicContact CB-CB 4.15Å; M49-V54 HydrophobicContact CB-CG2 4.39Å; M49-V54 HydrophobicContact CE-CB 4.26Å; M49-V54 HydrophobicContact CE-CG1 3.79Å; M49-V54 HydrophobicContact CG-CB 4.43Å; M49-V54 HydrophobicContact CG-CG2 4.49Å; M49-V54 PolarHBondContact O-N 3.01Å
50	D	87.1	Confident	83	Confident	132 Å²	132	112 Å²	112	71%	0.706	54%	0.542	S	S	*	.	H	α-helix	trans	-62.4	-47.6	175.1	-172.8	-100.4	0	0	0	111.4	H46 K47 R48 L52 K53	H46-D50 WeakPolarHBondContact O-CB 3.32Å; H46-D50 PolarHBondContact O-N 3.47Å; K47-D50 PolarHBondContact O-N 2.93Å; R48-D50 VanDerWaalsContact C-N 3.32Å; R48-D50 PolarHBondContact O-N 3.32Å; D50-L52 VanDerWaalsContact C-N 3.31Å; D50-L52 PolarHBondContact O-N 2.87Å; D50-K53 WeakPolarHBondContact O-CA 3.35Å; D50-K53 PolarHBondContact O-N 2.9Å
51	H	88.3	Confident	82.4	Confident	156 Å²	156	115.7 Å²	115.7	72%	0.722	56%	0.562	S	S	*	*	H	α-helix	trans	-59.2	-41.2	176	-168	107.3	0	0	0	112.5	K47 R48 K53	K47-H51 WeakPolarHBondContact O-CB 3.49Å; K47-H51 PolarHBondContact O-N 3.11Å; R48-H51 PolarHBondContact O-N 2.83Å; H51-K53 PolarHBondContact O-N 3.46Å
52	L	86.3	Confident	81.5	Confident	129 Å²	129	119.4 Å²	119.4	68%	0.675	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.4	0.9	177.1	-68	170.8	0	0	0	113	R48 M49 D50 V54	R48-L52 VanDerWaalsContact O-CB 3.28Å; R48-L52 WeakPolarHBondContact O-CB 3.18Å; R48-L52 VanDerWaalsContact O-CG 3.23Å; R48-L52 WeakPolarHBondContact O-CG 3.49Å; R48-L52 PolarHBondContact O-N 3.45Å; M49-L52 CarbonylContact O-C 3.58Å; M49-L52 PolarHBondContact O-N 3.44Å; D50-L52 VanDerWaalsContact C-N 3.31Å; D50-L52 PolarHBondContact O-N 2.87Å; L52-V54 HydrophobicContact CB-CG2 3.82Å; L52-V54 PolarHBondContact O-N 3.34Å
53	K	82.1	Confident	80.7	Confident	183 Å²	183	113 Å²	113	80%	0.796	55%	0.549	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.7	36.2	-177.5	-58.2	-180	179.7	178.3	0	112.8	M49 D50 H51 K55	M49-K53 PolarHBondContact O-N 3.34Å; D50-K53 WeakPolarHBondContact O-CA 3.35Å; D50-K53 PolarHBondContact O-N 2.9Å; H51-K53 PolarHBondContact O-N 3.46Å; K53-K55 PolarHBondContact O-N 3.03Å
54	V	80.7	Confident	79.6	Confident	74 Å²	74	114.7 Å²	114.7	45%	0.448	55%	0.553	S	S	.	*			trans	-66.7	116	178.7	179.2	0	0	0	0	108.6	M49 L52 K56	M49-V54 HydrophobicContact CB-CB 4.15Å; M49-V54 HydrophobicContact CB-CG2 4.39Å; M49-V54 HydrophobicContact CE-CB 4.26Å; M49-V54 HydrophobicContact CE-CG1 3.79Å; M49-V54 HydrophobicContact CG-CB 4.43Å; M49-V54 HydrophobicContact CG-CG2 4.49Å; M49-V54 PolarHBondContact O-N 3.01Å; L52-V54 HydrophobicContact CB-CG2 3.82Å; L52-V54 PolarHBondContact O-N 3.34Å; V54-K56 PolarHBondContact O-N 3.3Å
55	K	74.8	Confident	78.5	Confident	201 Å²	201	125.2 Å²	125.2	87%	0.874	59%	0.587	S	S	*	*			trans	-75.8	108.5	174.5	-67.1	-172.2	179.4	-176.2	0	108.9	K53	K53-K55 PolarHBondContact O-N 3.03Å
56	K	74.7	Confident	78	Confident	138 Å²	138	130.9 Å²	130.9	60%	0.6	61%	0.613	S	S	*	*	P	Polyproline II helix	trans	-77.3	130	166.6	59	-176.2	-178.6	176	0	109.4	V54	V54-K56 PolarHBondContact O-N 3.3Å
57	H	76.6	Confident	77.7	Confident	71 Å²	71	132.4 Å²	132.4	33%	0.329	62%	0.62	S	S	.	*	P	Polyproline II helix	trans	-88.1	127.5	166.7	-176.9	77.2	0	0	0	107.8	M26 C59 E63	M26-H57 HydrophobicContact CE-CB 3.35Å; M26-H57 HydrophobicContact SD-CB 3.5Å; M26-H57 VanDerWaalsContact SD-CB 3.5Å; H57-C59 PolarHBondContact O-N 3.14Å; H57-E63 IonicContact CD2-OE2 3.59Å; H57-E63 IonicContact CE1-OE2 3.96Å; H57-E63 IonicContact NE2-OE1 3.17Å; H57-E63 PolarHBondContact NE2-OE1 2.86Å; H57-E63 VanDerWaalsContact NE2-OE1 3.17Å; H57-E63 IonicContact NE2-OE2 2.85Å; H57-E63 PolarHBondContact NE2-OE2 3.08Å
58	H	74	Confident	77.1	Confident	140 Å²	140	130.6 Å²	130.6	65%	0.648	62%	0.615	S	S	*	*	P	Polyproline II helix	trans	-81.2	116.1	170.6	-87	-86.7	0	0	0	107.1	D60	H58-D60 PolarHBondContact O-N 2.78Å
59	C	73.4	Confident	76.5	Confident	74 Å²	74	128.8 Å²	128.8	50%	0.5	62%	0.615	S	S	.	*	P	Polyproline II helix	trans	-65.6	128.6	176.3	-63.8	0	0	0	0	109.9	H57 E63	H57-C59 PolarHBondContact O-N 3.14Å; C59-E63 VanDerWaalsContact CA-OE2 3.26Å; C59-E63 WeakPolarHBondContact CA-OE2 3.46Å; C59-E63 HydrophobicContact CB-CB 3.93Å
60	D	74.8	Confident	75.8	Confident	111 Å²	111	134.7 Å²	134.7	59%	0.594	64%	0.643	S	S	*	*	P	Polyproline II helix	trans	-73.7	165.7	168.6	-71.1	-54.1	0	0	0	110.6	H58 E62 E63 L64	H58-D60 PolarHBondContact O-N 2.78Å; D60-E62 PolarHBondContact O-N 3.14Å; D60-E62 VanDerWaalsContact O-N 3.11Å; D60-E63 PolarHBondContact N-OE2 2.88Å; D60-E63 WeakPolarHBondContact O-CA 3.46Å; D60-E63 PolarHBondContact O-N 3.32Å; D60-L64 PolarHBondContact O-N 3.45Å
61	L	73.1	Confident	75	Confident	144 Å²	144	134.9 Å²	134.9	75%	0.754	64%	0.639	S	S	*	*	H	α-helix	trans	-55.5	-30.4	-178.7	-85.2	162.4	0	0	0	113.8	R65	L61-R65 PolarHBondContact O-N 3.3Å
62	E	69.1	Low	74.1	Confident	155 Å²	155	133.4 Å²	133.4	72%	0.724	63%	0.633	S	S	*	*	H	α-helix	trans	-74.9	-27.8	175.7	-64.2	-169.8	96	0	0	112.9	D60	D60-E62 PolarHBondContact O-N 3.14Å; D60-E62 VanDerWaalsContact O-N 3.11Å
63	E	67.1	Low	73.1	Confident	31 Å²	31	133.7 Å²	133.7	15%	0.145	63%	0.63	C	S	.	*	H	α-helix	trans	-85.3	-17.3	178	-62.1	176.2	132.7	0	0	112.2	L4 L19 I21 H57 C59 D60	L4-E63 HydrophobicContact CD1-CG 4.05Å; L4-E63 HydrophobicContact CD2-CG 4.11Å; L19-E63 HydrophobicContact CD2-CB 3.87Å; L19-E63 HydrophobicContact CD2-CG 4.29Å; I21-E63 HydrophobicContact CD1-CG 4.42Å; I21-E63 WeakPolarHBondContact CD1-OE1 3.3Å; I21-E63 VanDerWaalsContact CG1-OE1 3.31Å; I21-E63 WeakPolarHBondContact CG1-OE1 3.39Å; I21-E63 WeakPolarHBondContact CG2-OE1 3.42Å; H57-E63 IonicContact CD2-OE2 3.59Å; H57-E63 IonicContact CE1-OE2 3.96Å; H57-E63 IonicContact NE2-OE1 3.17Å; H57-E63 PolarHBondContact NE2-OE1 2.86Å; H57-E63 VanDerWaalsContact NE2-OE1 3.17Å; H57-E63 IonicContact NE2-OE2 2.85Å; H57-E63 PolarHBondContact NE2-OE2 3.08Å; C59-E63 VanDerWaalsContact CA-OE2 3.26Å; C59-E63 WeakPolarHBondContact CA-OE2 3.46Å; C59-E63 HydrophobicContact CB-CB 3.93Å; D60-E63 PolarHBondContact N-OE2 2.88Å; D60-E63 WeakPolarHBondContact O-CA 3.46Å; D60-E63 PolarHBondContact O-N 3.32Å
64	L	66.2	Low	72.4	Confident	140 Å²	140	129.6 Å²	129.6	73%	0.733	62%	0.616	S	S	*	*	H	α-helix	trans	-84.7	-27.2	174.3	-168.2	72	0	0	0	112.9	D60	D60-L64 PolarHBondContact O-N 3.45Å
65	R	64.2	Low	71.6	Confident	276 Å²	276	134.6 Å²	134.6	100%	1.042	63%	0.631	S	S	*	*			trans	-74.3	0	-179.7	-89.1	-176.6	170.5	179.3	-1.7	112.1	L61	L61-R65 PolarHBondContact O-N 3.3Å

Retrieved 65 of 65 residues in 79 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).