Z4YLM5_MOUSE Loading...

tRNA methyltransferase 10B

AlphaFold DB , UniProt , Accession Z4YLM5, Species MOUSE (Mus musculus, Mouse), Gene Trmt10b, Length 141 aa.

						>Z4YLM5_MOUSE|Z4YLM5|Trmt10b
MDCKSEESAQRTDSQAFQEPDGLPEAGGEDGLSESFQLLQVDVEYERPEETSPANSAVWSSKNMQRKQRHWERIVSSKKSKRKQERERRKAKRAEDPGNGTCPQHSKRFLKALTKEKLLEAKHSGPRLCVDLSMTQHMSKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.3	Very low	43.2	Very low	223 Å²	223	166.1 Å²	166.1	100%	1.099	87%	0.869	S	S	*	*				0	81.4	0	-81.7	-69.7	175.3	0	0	104.7
2	D	45	Very low	42.6	Very low	158 Å²	158	164.6 Å²	164.6	85%	0.845	87%	0.872	S	S	*	*			trans	-117.1	111.7	-160.7	-60.3	-81.6	0	0	0	107.1	K4	D2-K4 PolarHBondContact O-N 3.04Å
3	C	52.9	Low	42.1	Very low	130 Å²	130	161.9 Å²	161.9	88%	0.878	86%	0.858	S	S	*	*			trans	-81.7	100.9	-172.3	-67.1	0	0	0	0	110.8
4	K	42.8	Very low	41.9	Very low	195 Å²	195	158 Å²	158	85%	0.848	85%	0.85	S	S	*	*			trans	35.9	116.5	139.3	-61	-177.1	175.4	-176.6	0	119.9	D2	D2-K4 PolarHBondContact O-N 3.04Å
5	S	44.6	Very low	41.3	Very low	120 Å²	120	159.1 Å²	159.1	84%	0.839	85%	0.848	S	S	*	*			trans	-73.8	137.4	155.4	-43.4	0	0	0	0	111.4
6	E	44.2	Very low	41.1	Very low	193 Å²	193	154.6 Å²	154.6	90%	0.902	84%	0.84	S	S	*	*			trans	-144.4	101.6	155.4	-68.5	-169.2	132.4	0	0	109.1
7	E	37.8	Very low	40.4	Very low	200 Å²	200	156.5 Å²	156.5	94%	0.935	84%	0.839	S	S	*	*			trans	-94.8	115.3	168.5	-178.1	177.5	127.8	0	0	107.1	A9	E7-A9 PolarHBondContact O-N 3.48Å
8	S	41.7	Very low	40.1	Very low	112 Å²	112	158 Å²	158	78%	0.783	84%	0.84	S	S	*	*			trans	-84.1	113.8	-178.1	-174.7	0	0	0	0	110.5
9	A	38.9	Very low	39.9	Very low	85 Å²	85	157.2 Å²	157.2	70%	0.702	83%	0.831	S	S	*	*			trans	-69.4	139.6	164.7	0	0	0	0	0	111.1	E7	E7-A9 PolarHBondContact O-N 3.48Å
10	Q	42.5	Very low	39.8	Very low	192 Å²	192	155.6 Å²	155.6	90%	0.897	83%	0.83	S	S	*	*			trans	-121.8	109.8	154.6	-73.1	-171.7	-24.1	0	0	108.1
11	R	41.1	Very low	39.7	Very low	219 Å²	219	154.7 Å²	154.7	83%	0.826	83%	0.825	S	S	*	*			trans	-88.7	138.9	161.3	-72.7	-175.9	174.8	-157.6	-0.6	108
12	T	35.8	Very low	39	Very low	148 Å²	148	147.2 Å²	147.2	91%	0.908	81%	0.806	S	S	*	*			trans	-143.5	130.6	143.4	32.5	0	0	0	0	108.9
13	D	35.9	Very low	38.9	Very low	130 Å²	130	147.1 Å²	147.1	70%	0.695	80%	0.804	S	S	*	*			trans	-73	144	-166.3	-84.3	-67	0	0	0	116.2
14	S	39.5	Very low	38.6	Very low	107 Å²	107	146.4 Å²	146.4	75%	0.748	80%	0.798	S	S	*	*				55.3	120.1	124.4	-52.8	0	0	0	0	121.5
15	Q	32.7	Very low	38.6	Very low	174 Å²	174	144.6 Å²	144.6	81%	0.813	79%	0.793	S	S	*	*			trans	-138.6	112.8	136.8	-164.7	166.6	12.5	0	0	110
16	A	37.8	Very low	38.6	Very low	88 Å²	88	143.3 Å²	143.3	73%	0.727	79%	0.79	S	S	*	*			trans	-72.5	136.8	171.3	0	0	0	0	0	110.3
17	F	28.6	Very low	38.3	Very low	187 Å²	187	137.8 Å²	137.8	82%	0.82	78%	0.784	S	S	*	*			trans	-144.3	142.7	148.5	-97.2	-78.6	0	0	0	109.5
18	Q	36.1	Very low	38.8	Very low	183 Å²	183	130.7 Å²	130.7	86%	0.855	76%	0.764	S	S	*	*			trans	-78.4	159.4	-156.6	-67.2	164.8	14.5	0	0	113.6
19	E	36	Very low	39.3	Very low	142 Å²	142	134.3 Å²	134.3	66%	0.664	77%	0.769	S	S	*	*			trans	-32.7	156.5	159.3	-107.2	-175	115.3	0	0	116	D21	E19-D21 WeakPolarHBondContact OE1-CA 3.38Å; E19-D21 PolarHBondContact OE1-N 3.03Å
20	P	38.7	Very low	40.3	Very low	126 Å²	126	136 Å²	136	82%	0.818	77%	0.766	S	S	*	*				-126.8	118.7	98.8	13.5	5.6	0	0	0	112.2
21	D	36.7	Very low	41	Very low	136 Å²	136	129.7 Å²	129.7	73%	0.727	75%	0.753	S	S	*	*				15.5	125.7	127.6	-95.3	-46.6	0	0	0	116.7	E19	E19-D21 WeakPolarHBondContact OE1-CA 3.38Å; E19-D21 PolarHBondContact OE1-N 3.03Å
22	G	30.6	Very low	41.8	Very low	67 Å²	67	125.2 Å²	125.2	69%	0.691	75%	0.745	S	S	*	*			trans	148.2	70.7	155.8	0	0	0	0	0	114.5	P24	G22-P24 WeakPolarHBondContact O-CD 3.47Å
23	L	42.4	Very low	43.2	Very low	155 Å²	155	121.2 Å²	121.2	81%	0.812	72%	0.723	S	S	*	*			trans	-70.3	135.6	153.3	-174.8	68.9	0	0	0	108.4
24	P	46.5	Very low	44.5	Very low	115 Å²	115	121.4 Å²	121.4	75%	0.747	72%	0.72	S	S	*	*			trans	-122.2	122.1	130.8	32.8	-24.4	0	0	0	110.4	G22	G22-P24 WeakPolarHBondContact O-CD 3.47Å
25	E	42.3	Very low	45.8	Very low	157 Å²	157	118.8 Å²	118.8	73%	0.734	70%	0.701	S	S	*	*			trans	3.1	132.3	144.3	-79.1	-79.1	143.4	0	0	118.7
26	A	44.6	Very low	47.4	Very low	94 Å²	94	116.8 Å²	116.8	78%	0.777	69%	0.69	S	S	*	*			trans	73.5	124.7	134.2	0	0	0	0	0	120.1
27	G	37.5	Very low	49	Very low	77 Å²	77	118.6 Å²	118.6	79%	0.794	68%	0.683	S	S	*	*			trans	118.2	89.2	173.2	0	0	0	0	0	108.8
28	G	48.9	Very low	51	Low	50 Å²	50	117.1 Å²	117.1	52%	0.515	68%	0.683	S	S	.	*				91.8	102.1	87.9	0	0	0	0	0	108.3	D30	G28-D30 PolarHBondContact O-N 3.39Å
29	E	52.9	Low	52.6	Low	188 Å²	188	114.5 Å²	114.5	88%	0.879	67%	0.674	S	S	*	*	S	Bend	trans	58.8	13.6	149.7	73.2	-151	141.7	0	0	123.1
30	D	58.6	Low	54.1	Low	120 Å²	120	114.1 Å²	114.1	64%	0.642	67%	0.673	S	S	*	*			trans	-104.7	-10.2	-175.2	-72.5	-35.7	0	0	0	118.1	G28 L32	G28-D30 PolarHBondContact O-N 3.39Å; D30-L32 PolarHBondContact O-N 3.41Å
31	G	57.7	Low	55.7	Low	60 Å²	60	113.7 Å²	113.7	62%	0.619	67%	0.668	S	S	*	*	H	α-helix	trans	-74.6	-26.7	-178.4	0	0	0	0	0	115
32	L	58.4	Low	57.2	Low	125 Å²	125	114 Å²	114	65%	0.654	67%	0.669	S	S	*	*	H	α-helix	trans	-77.8	-39.1	178	-69	173.8	0	0	0	111	D30 E34 S35 F36	D30-L32 PolarHBondContact O-N 3.41Å; L32-E34 VanDerWaalsContact C-N 3.31Å; L32-E34 PolarHBondContact O-N 3.05Å; L32-S35 PolarHBondContact O-N 3.14Å; L32-S35 VanDerWaalsContact O-N 3.14Å; L32-S35 PolarHBondContact O-OG 3.42Å; L32-F36 HydrophobicContact CB-CD2 4.4Å; L32-F36 HydrophobicContact CB-CE2 4.06Å; L32-F36 WeakPolarHBondContact O-CD2 3.18Å; L32-F36 PolarHBondContact O-N 3.15Å
33	S	64.5	Low	58.9	Low	64 Å²	64	116.1 Å²	116.1	45%	0.448	67%	0.668	S	S	.	*	H	α-helix	trans	-59.5	-41.3	179.8	-164.2	0	0	0	0	112	F36 Q37	S33-F36 PolarHBondContact O-N 3.45Å; S33-Q37 PolarHBondContact O-N 3.31Å
34	E	64.6	Low	59.5	Low	135 Å²	135	117.8 Å²	117.8	63%	0.631	67%	0.672	S	S	*	*	H	α-helix	trans	-67.1	-37.9	176.3	-160.8	177.9	-165.1	0	0	112.1	L32 F36 Q37 L38	L32-E34 VanDerWaalsContact C-N 3.31Å; L32-E34 PolarHBondContact O-N 3.05Å; E34-F36 VanDerWaalsContact C-N 3.31Å; E34-F36 PolarHBondContact O-N 3.18Å; E34-Q37 PolarHBondContact O-N 2.69Å; E34-L38 PolarHBondContact O-N 3.49Å
35	S	66.1	Low	59.6	Low	51 Å²	51	120.1 Å²	120.1	36%	0.357	67%	0.667	S	S	.	*	H	α-helix	trans	-67.3	-30.2	175.9	77	0	0	0	0	113.3	L32 L39	L32-S35 PolarHBondContact O-N 3.14Å; L32-S35 VanDerWaalsContact O-N 3.14Å; L32-S35 PolarHBondContact O-OG 3.42Å; S35-L39 PolarHBondContact O-N 3.29Å
36	F	65.8	Low	60.1	Low	133 Å²	133	121.3 Å²	121.3	58%	0.583	67%	0.673	S	S	*	*	H	α-helix	trans	-77.2	-26.7	175.9	-72	-64.4	0	0	0	113	L32 S33 E34 L39 Q40	L32-F36 HydrophobicContact CB-CD2 4.4Å; L32-F36 HydrophobicContact CB-CE2 4.06Å; L32-F36 WeakPolarHBondContact O-CD2 3.18Å; L32-F36 PolarHBondContact O-N 3.15Å; S33-F36 PolarHBondContact O-N 3.45Å; E34-F36 VanDerWaalsContact C-N 3.31Å; E34-F36 PolarHBondContact O-N 3.18Å; F36-L39 HydrophobicContact CD1-CD1 4.29Å; F36-L39 PolarHBondContact O-N 2.95Å; F36-Q40 PolarHBondContact O-N 3.3Å
37	Q	70.9	Confident	60.3	Low	125 Å²	125	125.8 Å²	125.8	58%	0.584	67%	0.669	S	S	*	*	H	α-helix	trans	-67	-35.2	171.8	-77.5	176.2	13.9	0	0	112.2	S33 E34 L39 Q40	S33-Q37 PolarHBondContact O-N 3.31Å; E34-Q37 PolarHBondContact O-N 2.69Å; Q37-L39 VanDerWaalsContact C-N 3.29Å; Q37-L39 PolarHBondContact O-N 3.46Å; Q37-Q40 WeakPolarHBondContact O-CB 2.93Å; Q37-Q40 PolarHBondContact O-N 3.29Å; Q37-Q40 VanDerWaalsContact O-N 3.15Å
38	L	72	Confident	60.9	Low	157 Å²	157	126 Å²	126	82%	0.822	66%	0.656	S	S	*	*	H	α-helix	trans	-70.8	-24.6	174.5	-74.7	163.2	0	0	0	113.3	E34 Q40	E34-L38 PolarHBondContact O-N 3.49Å; L38-Q40 VanDerWaalsContact C-N 3.27Å
39	L	69.1	Low	60.8	Low	127 Å²	127	131.3 Å²	131.3	67%	0.665	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.1	-3.6	172.7	-79.3	157.8	0	0	0	112.8	S35 F36 Q37 V41	S35-L39 PolarHBondContact O-N 3.29Å; F36-L39 HydrophobicContact CD1-CD1 4.29Å; F36-L39 PolarHBondContact O-N 2.95Å; Q37-L39 VanDerWaalsContact C-N 3.29Å; Q37-L39 PolarHBondContact O-N 3.46Å; L39-V41 VanDerWaalsContact C-N 3.34Å; L39-V41 PolarHBondContact O-N 3.3Å
40	Q	66.6	Low	60.7	Low	135 Å²	135	131.2 Å²	131.2	63%	0.631	67%	0.667	S	S	*	*			trans	-75.9	89.1	177.4	-163.9	162.4	10	0	0	109.4	F36 Q37 L38 D42	F36-Q40 PolarHBondContact O-N 3.3Å; Q37-Q40 WeakPolarHBondContact O-CB 2.93Å; Q37-Q40 PolarHBondContact O-N 3.29Å; Q37-Q40 VanDerWaalsContact O-N 3.15Å; L38-Q40 VanDerWaalsContact C-N 3.27Å; Q40-D42 PolarHBondContact O-N 3.13Å
41	V	72.8	Confident	60.2	Low	117 Å²	117	129.5 Å²	129.5	71%	0.709	66%	0.661	S	S	*	*			trans	-75.7	107.7	167.3	179.8	0	0	0	0	107.1	L39 V43	L39-V41 VanDerWaalsContact C-N 3.34Å; L39-V41 PolarHBondContact O-N 3.3Å; V41-V43 VanDerWaalsContact C-N 3.3Å; V41-V43 HydrophobicContact CG1-CG2 4.01Å; V41-V43 PolarHBondContact O-N 2.91Å
42	D	68.1	Low	59.8	Low	143 Å²	143	130 Å²	130	77%	0.765	66%	0.655	S	S	*	*			trans	-66.7	94.4	167.2	-84.3	-28.3	0	0	0	108.6	Q40 E44	Q40-D42 PolarHBondContact O-N 3.13Å; D42-E44 VanDerWaalsContact C-N 3.32Å; D42-E44 PolarHBondContact O-N 2.83Å; D42-E44 VanDerWaalsContact O-N 3.13Å
43	V	66.1	Low	59.5	Low	111 Å²	111	129.3 Å²	129.3	67%	0.673	66%	0.658	S	S	*	*			trans	-78.5	90.6	165.6	179.8	0	0	0	0	106.2	V41 Y45	V41-V43 VanDerWaalsContact C-N 3.3Å; V41-V43 HydrophobicContact CG1-CG2 4.01Å; V41-V43 PolarHBondContact O-N 2.91Å; V43-Y45 PolarHBondContact O-N 2.97Å
44	E	55.2	Low	58.8	Low	189 Å²	189	129.5 Å²	129.5	88%	0.883	66%	0.664	S	S	*	*			trans	-58.9	96.1	156	-87.3	-165	157.7	0	0	107.2	D42 E46	D42-E44 VanDerWaalsContact C-N 3.32Å; D42-E44 PolarHBondContact O-N 2.83Å; D42-E44 VanDerWaalsContact O-N 3.13Å; E44-E46 PolarHBondContact O-N 3.25Å
45	Y	49.3	Very low	58.1	Low	164 Å²	164	126.5 Å²	126.5	64%	0.643	65%	0.652	S	S	*	*			trans	-75.5	83	171.3	-171.7	-101.4	0	0	0	107.3	V43 R47	V43-Y45 PolarHBondContact O-N 2.97Å; Y45-R47 HydrophobicContact CD1-CB 3.95Å; Y45-R47 VanDerWaalsContact CE1-CA 3.42Å; Y45-R47 HydrophobicContact CE1-CB 3.65Å; Y45-R47 HydrophobicContact CE1-CG 3.96Å; Y45-R47 PolarHBondContact O-N 2.9Å
46	E	53	Low	57.6	Low	182 Å²	182	128.1 Å²	128.1	85%	0.85	66%	0.663	S	S	*	*			trans	-62.5	99.3	155.7	-162.7	-175.7	-139.4	0	0	105.4	E44 P48	E44-E46 PolarHBondContact O-N 3.25Å; E46-P48 WeakPolarHBondContact O-CD 3.03Å
47	R	48.7	Very low	57.1	Low	189 Å²	189	124.7 Å²	124.7	71%	0.713	66%	0.66	S	S	*	*			trans	-52.2	110.2	-179.2	173.5	-177	-70	-123.9	-0.5	107.6	Y45 E49	Y45-R47 HydrophobicContact CD1-CB 3.95Å; Y45-R47 VanDerWaalsContact CE1-CA 3.42Å; Y45-R47 HydrophobicContact CE1-CB 3.65Å; Y45-R47 HydrophobicContact CE1-CG 3.96Å; Y45-R47 PolarHBondContact O-N 2.9Å; R47-E49 PolarHBondContact O-N 2.64Å
48	P	49.2	Very low	56.3	Low	80 Å²	80	123.7 Å²	123.7	52%	0.519	66%	0.662	S	S	.	*			trans	-67.9	114.7	163.1	-4.8	23.8	0	0	0	103.9	E46 E50	E46-P48 WeakPolarHBondContact O-CD 3.03Å; P48-E50 PolarHBondContact O-N 3.04Å
49	E	46.4	Very low	55.3	Low	163 Å²	163	125.8 Å²	125.8	76%	0.762	66%	0.659	S	S	*	*			trans	-28.6	132.5	156.8	-86.2	-81.2	149.2	0	0	109.8	R47 T51	R47-E49 PolarHBondContact O-N 2.64Å; E49-T51 VanDerWaalsContact C-N 3.27Å; E49-T51 PolarHBondContact O-N 3.37Å
50	E	50.9	Low	55.3	Low	185 Å²	185	121 Å²	121	86%	0.864	64%	0.636	S	S	*	*			trans	-48	83.8	-174.6	-73.3	174.7	136.5	0	0	112.4	P48 S52	P48-E50 PolarHBondContact O-N 3.04Å; E50-S52 PolarHBondContact O-N 2.91Å
51	T	48.8	Very low	56.2	Low	84 Å²	84	118.1 Å²	118.1	52%	0.515	63%	0.631	S	S	.	*			trans	-78.8	88	167.7	48.2	0	0	0	0	106.6	E49 W59	E49-T51 VanDerWaalsContact C-N 3.27Å; E49-T51 PolarHBondContact O-N 3.37Å; T51-W59 HydrophobicContact CG2-CH2 4.41Å
52	S	50.5	Low	57.2	Low	70 Å²	70	120.7 Å²	120.7	49%	0.49	63%	0.633	S	S	.	*			trans	-33.9	134.5	161.4	-153.7	0	0	0	0	109.8	E50 A54 N55	E50-S52 PolarHBondContact O-N 2.91Å; S52-A54 PolarHBondContact O-N 2.85Å; S52-N55 PolarHBondContact O-N 2.89Å
53	P	51.8	Low	58.3	Low	111 Å²	111	118.2 Å²	118.2	72%	0.721	62%	0.62	S	S	*	*	G	3₁₀ helix	trans	-58.8	-14.8	-173.9	21.3	-31.3	0	0	0	113.3	N55 S56	P53-N55 VanDerWaalsContact C-N 3.28Å; P53-N55 PolarHBondContact O-N 2.86Å; P53-S56 PolarHBondContact O-N 3.46Å; P53-S56 PolarHBondContact O-OG 3.49Å
54	A	49.9	Very low	59.7	Low	68 Å²	68	118.4 Å²	118.4	56%	0.562	62%	0.615	S	S	*	*	G	3₁₀ helix	trans	-60	-29.1	170.8	0	0	0	0	0	114.4	S52	S52-A54 PolarHBondContact O-N 2.85Å
55	N	49.9	Very low	61.4	Low	73 Å²	73	112 Å²	112	39%	0.39	58%	0.584	S	S	.	*	G	3₁₀ helix	trans	-83.4	-20	-176.1	-66	-25.4	0	0	0	113.2	S52 P53 A57 V58	S52-N55 PolarHBondContact O-N 2.89Å; P53-N55 VanDerWaalsContact C-N 3.28Å; P53-N55 PolarHBondContact O-N 2.86Å; N55-A57 VanDerWaalsContact C-N 3.26Å; N55-A57 PolarHBondContact O-N 3.14Å; N55-V58 WeakPolarHBondContact O-CB 3.31Å; N55-V58 PolarHBondContact O-N 3.27Å; N55-V58 VanDerWaalsContact O-N 3.14Å
56	S	55.4	Low	63.5	Low	84 Å²	84	112.8 Å²	112.8	59%	0.587	59%	0.587	S	S	*	*	G	3₁₀ helix	trans	-66.2	-28	177.7	70.4	0	0	0	0	113.1	P53 V58	P53-S56 PolarHBondContact O-N 3.46Å; P53-S56 PolarHBondContact O-OG 3.49Å; S56-V58 PolarHBondContact O-N 2.96Å
57	A	55.4	Low	65.6	Low	61 Å²	61	110.3 Å²	110.3	50%	0.504	57%	0.573	S	S	.	*	G	3₁₀ helix	trans	-69.5	-20.7	176.2	0	0	0	0	0	112.8	N55 S60 Q65	N55-A57 VanDerWaalsContact C-N 3.26Å; N55-A57 PolarHBondContact O-N 3.14Å; A57-S60 PolarHBondContact O-OG 3.33Å; A57-Q65 PolarHBondContact O-NE2 3.42Å
58	V	54.1	Low	67.9	Low	105 Å²	105	106.2 Å²	106.2	64%	0.636	56%	0.562	S	S	*	*	G	3₁₀ helix	trans	-83.1	-21.2	-175	-176.6	0	0	0	0	112.1	N55 S56	N55-V58 WeakPolarHBondContact O-CB 3.31Å; N55-V58 PolarHBondContact O-N 3.27Å; N55-V58 VanDerWaalsContact O-N 3.14Å; S56-V58 PolarHBondContact O-N 2.96Å
59	W	51.1	Low	70.1	Confident	200 Å²	200	109.7 Å²	109.7	76%	0.758	57%	0.565	S	S	*	*	S	Bend	trans	-100.7	-0.9	-171.6	-56.5	-10.9	0	0	0	114.6	T51 S61	T51-W59 HydrophobicContact CG2-CH2 4.41Å; W59-S61 PolarHBondContact O-N 3.24Å
60	S	67.1	Low	72.6	Confident	26 Å²	26	106.6 Å²	106.6	18%	0.182	55%	0.55	C	S	.	*	S	Bend	trans	-76.9	123	175.2	31.5	0	0	0	0	110.3	A57 K62 M64 Q65	A57-S60 PolarHBondContact O-OG 3.33Å; S60-K62 PolarHBondContact O-N 2.84Å; S60-M64 VanDerWaalsContact CB-SD 3.52Å; S60-Q65 PolarHBondContact O-NE2 3.26Å; S60-Q65 PolarHBondContact OG-NE2 3.36Å
61	S	87.4	Confident	74.8	Confident	76 Å²	76	105.5 Å²	105.5	53%	0.531	54%	0.538	S	S	.	.			trans	-48.6	141.8	176.6	170.7	0	0	0	0	111.4	W59 N63 M64 Q65	W59-S61 PolarHBondContact O-N 3.24Å; S61-N63 PolarHBondContact O-N 3.39Å; S61-N63 PolarHBondContact OG-N 3.14Å; S61-M64 WeakPolarHBondContact O-CA 3.47Å; S61-M64 WeakPolarHBondContact O-CB 3.34Å; S61-M64 PolarHBondContact O-N 2.97Å; S61-Q65 PolarHBondContact O-N 3.34Å; S61-Q65 VanDerWaalsContact O-N 3.14Å
62	K	92.5	Very high	77.1	Confident	170 Å²	170	106.3 Å²	106.3	74%	0.739	54%	0.536	S	S	*	.	H	α-helix	trans	-49.3	-31.5	177.3	-69	176.9	179.2	171.8	0	112.6	S60 R66	S60-K62 PolarHBondContact O-N 2.84Å; K62-R66 VanDerWaalsContact O-CG 3.23Å; K62-R66 WeakPolarHBondContact O-CG 3.23Å; K62-R66 PolarHBondContact O-N 3.49Å; K62-R66 VanDerWaalsContact O-N 3.13Å
63	N	92.2	Very high	79.4	Confident	92 Å²	92	110.7 Å²	110.7	49%	0.492	54%	0.542	S	S	.	.	H	α-helix	trans	-69.6	-44.7	176.2	-166.7	-44.9	0	0	0	112.3	S61 Q65 R66 K67	S61-N63 PolarHBondContact O-N 3.39Å; S61-N63 PolarHBondContact OG-N 3.14Å; N63-Q65 PolarHBondContact O-N 3.44Å; N63-R66 WeakPolarHBondContact O-CB 3.46Å; N63-R66 PolarHBondContact O-N 2.91Å; N63-K67 PolarHBondContact O-N 3.2Å; N63-K67 VanDerWaalsContact OD1-CE 3.31Å; N63-K67 WeakPolarHBondContact OD1-CE 3.33Å
64	M	94	Very high	81.6	Confident	114 Å²	114	107.8 Å²	107.8	56%	0.562	52%	0.519	S	S	*	.	H	α-helix	trans	-59	-47.2	176.7	-173.6	-168.7	-66.4	0	0	110.9	S60 S61 R66 K67 Q68	S60-M64 VanDerWaalsContact CB-SD 3.52Å; S61-M64 WeakPolarHBondContact O-CA 3.47Å; S61-M64 WeakPolarHBondContact O-CB 3.34Å; S61-M64 PolarHBondContact O-N 2.97Å; M64-R66 VanDerWaalsContact C-N 3.34Å; M64-R66 PolarHBondContact O-N 2.98Å; M64-K67 PolarHBondContact O-N 3.46Å; M64-Q68 PolarHBondContact O-N 2.96Å
65	Q	91.4	Very high	83.9	Confident	54 Å²	54	107.8 Å²	107.8	25%	0.252	51%	0.513	S	S	.	.	H	α-helix	trans	-62.9	-38.3	177.4	-64.9	-176.9	0.4	0	0	112.4	A57 S60 S61 N63 Q68 R69	A57-Q65 PolarHBondContact O-NE2 3.42Å; S60-Q65 PolarHBondContact O-NE2 3.26Å; S60-Q65 PolarHBondContact OG-NE2 3.36Å; S61-Q65 PolarHBondContact O-N 3.34Å; S61-Q65 VanDerWaalsContact O-N 3.14Å; N63-Q65 PolarHBondContact O-N 3.44Å; Q65-Q68 PolarHBondContact O-N 2.9Å; Q65-R69 WeakPolarHBondContact O-CB 3.47Å; Q65-R69 WeakPolarHBondContact O-CG 3.49Å; Q65-R69 PolarHBondContact O-N 3.26Å
66	R	94.8	Very high	86.1	Confident	182 Å²	182	107.6 Å²	107.6	69%	0.687	52%	0.517	S	S	*	.	H	α-helix	trans	-61.9	-45.8	174.4	-77.6	173.3	-175.6	-162	2	111.7	K62 N63 M64 R69 H70	K62-R66 VanDerWaalsContact O-CG 3.23Å; K62-R66 WeakPolarHBondContact O-CG 3.23Å; K62-R66 PolarHBondContact O-N 3.49Å; K62-R66 VanDerWaalsContact O-N 3.13Å; N63-R66 WeakPolarHBondContact O-CB 3.46Å; N63-R66 PolarHBondContact O-N 2.91Å; M64-R66 VanDerWaalsContact C-N 3.34Å; M64-R66 PolarHBondContact O-N 2.98Å; R66-R69 PolarHBondContact O-N 3.22Å; R66-H70 WeakPolarHBondContact O-CB 3.44Å; R66-H70 PolarHBondContact O-N 3.39Å
67	K	96.3	Very high	88.1	Confident	130 Å²	130	107.3 Å²	107.3	57%	0.565	52%	0.515	S	S	*	.	H	α-helix	trans	-62.7	-44.2	177.3	-72.9	-176.6	176.9	-178.3	0	111.3	N63 M64 H70 W71	N63-K67 PolarHBondContact O-N 3.2Å; N63-K67 VanDerWaalsContact OD1-CE 3.31Å; N63-K67 WeakPolarHBondContact OD1-CE 3.33Å; M64-K67 PolarHBondContact O-N 3.46Å; K67-H70 WeakPolarHBondContact O-CB 3.29Å; K67-H70 PolarHBondContact O-N 3.13Å; K67-W71 VanDerWaalsContact O-CD1 3.23Å; K67-W71 PolarHBondContact O-N 3.4Å
68	Q	96.4	Very high	90.1	Very high	103 Å²	103	110.5 Å²	110.5	48%	0.481	52%	0.517	S	S	.	.	H	α-helix	trans	-57.9	-55	175.8	179.8	179.9	-10.2	0	0	111.5	M64 Q65 H70 W71 E72	M64-Q68 PolarHBondContact O-N 2.96Å; Q65-Q68 PolarHBondContact O-N 2.9Å; Q68-H70 PolarHBondContact O-N 3.11Å; Q68-W71 PolarHBondContact O-N 3.2Å; Q68-W71 VanDerWaalsContact O-N 3.11Å; Q68-E72 HydrophobicContact CG-CG 4.43Å; Q68-E72 VanDerWaalsContact CG-OE1 3.29Å; Q68-E72 WeakPolarHBondContact CG-OE1 3.5Å; Q68-E72 PolarHBondContact NE2-OE1 2.94Å; Q68-E72 WeakPolarHBondContact O-CG 3.34Å; Q68-E72 PolarHBondContact O-N 3.13Å
69	R	96.8	Very high	92.2	Very high	153 Å²	153	112.4 Å²	112.4	58%	0.577	52%	0.517	S	S	*	.	H	α-helix	trans	-60	-31.5	178.6	-69.5	179.4	-168.8	-179	5.2	112.9	Q65 R66 R73	Q65-R69 WeakPolarHBondContact O-CB 3.47Å; Q65-R69 WeakPolarHBondContact O-CG 3.49Å; Q65-R69 PolarHBondContact O-N 3.26Å; R66-R69 PolarHBondContact O-N 3.22Å; R69-R73 WeakPolarHBondContact O-CB 3.35Å; R69-R73 WeakPolarHBondContact O-CG 3.29Å; R69-R73 PolarHBondContact O-N 3.13Å; R69-R73 VanDerWaalsContact O-N 3.13Å; R69-R73 PolarHBondContact O-NE 3.36Å; R69-R73 VanDerWaalsContact O-NE 3.17Å
70	H	97.4	Very high	94.4	Very high	98 Å²	98	106.6 Å²	106.6	45%	0.454	51%	0.507	S	S	.	.	H	α-helix	trans	-68.8	-47.2	175.8	177.1	70.4	0	0	0	111.3	R66 K67 Q68 R73 I74	R66-H70 WeakPolarHBondContact O-CB 3.44Å; R66-H70 PolarHBondContact O-N 3.39Å; K67-H70 WeakPolarHBondContact O-CB 3.29Å; K67-H70 PolarHBondContact O-N 3.13Å; Q68-H70 PolarHBondContact O-N 3.11Å; H70-R73 WeakPolarHBondContact O-CB 3.39Å; H70-R73 PolarHBondContact O-N 3.28Å; H70-I74 VanDerWaalsContact NE2-CD1 3.29Å; H70-I74 WeakPolarHBondContact NE2-CD1 3.19Å; H70-I74 WeakPolarHBondContact O-CG1 3.45Å; H70-I74 PolarHBondContact O-N 3Å
71	W	97.8	Very high	95.8	Very high	162 Å²	162	112.7 Å²	112.7	61%	0.614	53%	0.53	S	S	*	.	H	α-helix	trans	-62.1	-44.5	175.9	-83.3	115.5	0	0	0	112.5	K67 Q68 R73 I74 V75	K67-W71 VanDerWaalsContact O-CD1 3.23Å; K67-W71 PolarHBondContact O-N 3.4Å; Q68-W71 PolarHBondContact O-N 3.2Å; Q68-W71 VanDerWaalsContact O-N 3.11Å; W71-R73 VanDerWaalsContact C-N 3.3Å; W71-R73 PolarHBondContact O-N 2.97Å; W71-I74 HydrophobicContact CE3-CD1 4.26Å; W71-I74 HydrophobicContact CZ3-CD1 4.48Å; W71-I74 PolarHBondContact O-N 3.5Å; W71-I74 VanDerWaalsContact O-N 3.13Å; W71-V75 WeakPolarHBondContact O-CG2 3.48Å; W71-V75 PolarHBondContact O-N 2.89Å
72	E	97.6	Very high	96.2	Very high	100 Å²	100	118.2 Å²	118.2	47%	0.467	54%	0.539	S	S	.	.	H	α-helix	trans	-58	-43.1	175.4	-72.7	170.1	178.2	0	0	111.6	Q68 V75 S76	Q68-E72 HydrophobicContact CG-CG 4.43Å; Q68-E72 VanDerWaalsContact CG-OE1 3.29Å; Q68-E72 WeakPolarHBondContact CG-OE1 3.5Å; Q68-E72 PolarHBondContact NE2-OE1 2.94Å; Q68-E72 WeakPolarHBondContact O-CG 3.34Å; Q68-E72 PolarHBondContact O-N 3.13Å; E72-V75 PolarHBondContact O-N 3.48Å; E72-S76 WeakPolarHBondContact O-CB 3.4Å; E72-S76 PolarHBondContact O-N 2.96Å; E72-S76 PolarHBondContact O-OG 3.33Å
73	R	98.1	Very high	96.4	Very high	162 Å²	162	117.1 Å²	117.1	61%	0.611	53%	0.534	S	S	*	.	H	α-helix	trans	-61.7	-41.4	174	-83.9	-176.6	-80	165.1	-9	112.9	R69 H70 W71 S76 S77	R69-R73 WeakPolarHBondContact O-CB 3.35Å; R69-R73 WeakPolarHBondContact O-CG 3.29Å; R69-R73 PolarHBondContact O-N 3.13Å; R69-R73 VanDerWaalsContact O-N 3.13Å; R69-R73 PolarHBondContact O-NE 3.36Å; R69-R73 VanDerWaalsContact O-NE 3.17Å; H70-R73 WeakPolarHBondContact O-CB 3.39Å; H70-R73 PolarHBondContact O-N 3.28Å; W71-R73 VanDerWaalsContact C-N 3.3Å; W71-R73 PolarHBondContact O-N 2.97Å; R73-S76 WeakPolarHBondContact CA-OG 3.39Å; R73-S76 PolarHBondContact O-OG 2.94Å; R73-S76 VanDerWaalsContact O-OG 3.06Å; R73-S77 WeakPolarHBondContact O-CB 3.38Å; R73-S77 PolarHBondContact O-N 3.06Å
74	I	97.9	Very high	96.6	Very high	50 Å²	50	119.5 Å²	119.5	26%	0.256	54%	0.543	S	S	.	.	H	α-helix	trans	-63.4	-46.1	176.6	-70	166.7	0	0	0	110.4	H70 W71 S77 K78	H70-I74 VanDerWaalsContact NE2-CD1 3.29Å; H70-I74 WeakPolarHBondContact NE2-CD1 3.19Å; H70-I74 WeakPolarHBondContact O-CG1 3.45Å; H70-I74 PolarHBondContact O-N 3Å; W71-I74 HydrophobicContact CE3-CD1 4.26Å; W71-I74 HydrophobicContact CZ3-CD1 4.48Å; W71-I74 PolarHBondContact O-N 3.5Å; W71-I74 VanDerWaalsContact O-N 3.13Å; I74-S77 PolarHBondContact O-N 3.17Å; I74-K78 HydrophobicContact CG2-CD 4.13Å; I74-K78 WeakPolarHBondContact O-CB 3.49Å; I74-K78 WeakPolarHBondContact O-CG 3.43Å; I74-K78 PolarHBondContact O-N 3.16Å
75	V	98.1	Very high	96.6	Very high	69 Å²	69	117 Å²	117	42%	0.418	53%	0.529	S	S	.	.	H	α-helix	trans	-64.3	-46.2	-178.9	172.7	0	0	0	0	110.8	W71 E72 K78 K79	W71-V75 WeakPolarHBondContact O-CG2 3.48Å; W71-V75 PolarHBondContact O-N 2.89Å; E72-V75 PolarHBondContact O-N 3.48Å; V75-K78 PolarHBondContact O-N 2.89Å; V75-K79 HydrophobicContact CG1-CD 4.28Å; V75-K79 WeakPolarHBondContact O-CG 3.42Å; V75-K79 PolarHBondContact O-N 3.06Å
76	S	96.4	Very high	96.7	Very high	69 Å²	69	122.3 Å²	122.3	48%	0.483	55%	0.547	S	S	.	.	H	α-helix	trans	-64.6	-42	179	66.4	0	0	0	0	111.8	E72 R73 K79 S80	E72-S76 WeakPolarHBondContact O-CB 3.4Å; E72-S76 PolarHBondContact O-N 2.96Å; E72-S76 PolarHBondContact O-OG 3.33Å; R73-S76 WeakPolarHBondContact CA-OG 3.39Å; R73-S76 PolarHBondContact O-OG 2.94Å; R73-S76 VanDerWaalsContact O-OG 3.06Å; S76-K79 PolarHBondContact O-N 3.38Å; S76-S80 WeakPolarHBondContact O-CB 3.37Å; S76-S80 PolarHBondContact O-N 3.27Å
77	S	96.8	Very high	96.7	Very high	77 Å²	77	117.7 Å²	117.7	54%	0.538	53%	0.534	S	S	.	.	H	α-helix	trans	-59.8	-47.3	173.9	178.9	0	0	0	0	112	R73 I74 K79 S80 K81	R73-S77 WeakPolarHBondContact O-CB 3.38Å; R73-S77 PolarHBondContact O-N 3.06Å; I74-S77 PolarHBondContact O-N 3.17Å; S77-K79 PolarHBondContact O-N 2.92Å; S77-S80 PolarHBondContact O-N 3.3Å; S77-K81 PolarHBondContact O-N 3.49Å
78	K	97.9	Very high	96.5	Very high	128 Å²	128	116.7 Å²	116.7	56%	0.557	53%	0.526	S	S	*	.	H	α-helix	trans	-61	-42.8	175.8	-76.7	-179.7	176.4	-179.7	0	112.3	I74 V75 K81 R82	I74-K78 HydrophobicContact CG2-CD 4.13Å; I74-K78 WeakPolarHBondContact O-CB 3.49Å; I74-K78 WeakPolarHBondContact O-CG 3.43Å; I74-K78 PolarHBondContact O-N 3.16Å; V75-K78 PolarHBondContact O-N 2.89Å; K78-K81 PolarHBondContact O-N 2.91Å; K78-R82 WeakPolarHBondContact O-CG 3.38Å; K78-R82 PolarHBondContact O-N 3.44Å
79	K	97.9	Very high	96.1	Very high	145 Å²	145	118.9 Å²	118.9	63%	0.63	53%	0.53	S	S	*	.	H	α-helix	trans	-63.7	-44.7	176.2	-76.8	-177.4	177.8	-178.9	0	111.5	V75 S76 S77 R82 K83	V75-K79 HydrophobicContact CG1-CD 4.28Å; V75-K79 WeakPolarHBondContact O-CG 3.42Å; V75-K79 PolarHBondContact O-N 3.06Å; S76-K79 PolarHBondContact O-N 3.38Å; S77-K79 PolarHBondContact O-N 2.92Å; K79-R82 PolarHBondContact O-N 3.1Å; K79-K83 PolarHBondContact O-N 2.84Å
80	S	96.6	Very high	95.6	Very high	78 Å²	78	116.3 Å²	116.3	55%	0.545	52%	0.523	S	S	.	.	H	α-helix	trans	-59.4	-46.9	176.6	-175	0	0	0	0	111.4	S76 S77 R82 K83 Q84	S76-S80 WeakPolarHBondContact O-CB 3.37Å; S76-S80 PolarHBondContact O-N 3.27Å; S77-S80 PolarHBondContact O-N 3.3Å; S80-R82 PolarHBondContact O-N 2.94Å; S80-K83 WeakPolarHBondContact O-CB 3.25Å; S80-K83 PolarHBondContact O-N 2.94Å; S80-K83 VanDerWaalsContact O-N 3.1Å; S80-Q84 PolarHBondContact O-N 3.38Å
81	K	97.4	Very high	95	Very high	154 Å²	154	113.8 Å²	113.8	67%	0.67	52%	0.519	S	S	*	.	H	α-helix	trans	-59	-43.1	176	-171.2	175	-177.4	174.1	0	112.5	S77 K78 Q84 E85	S77-K81 PolarHBondContact O-N 3.49Å; K78-K81 PolarHBondContact O-N 2.91Å; K81-Q84 PolarHBondContact O-N 3.29Å; K81-E85 WeakPolarHBondContact O-CB 3.29Å; K81-E85 PolarHBondContact O-N 3.49Å
82	R	96.1	Very high	94.2	Very high	192 Å²	192	112.5 Å²	112.5	73%	0.725	52%	0.518	S	S	*	.	H	α-helix	trans	-62.5	-41.1	174.9	-72.1	175.8	-176.8	-176.2	0.7	112	K78 K79 S80 R86	K78-R82 WeakPolarHBondContact O-CG 3.38Å; K78-R82 PolarHBondContact O-N 3.44Å; K79-R82 PolarHBondContact O-N 3.1Å; S80-R82 PolarHBondContact O-N 2.94Å; R82-R86 WeakPolarHBondContact O-CB 3.49Å; R82-R86 PolarHBondContact O-N 2.94Å
83	K	96.8	Very high	93.1	Very high	147 Å²	147	116.4 Å²	116.4	64%	0.639	53%	0.528	S	S	*	.	H	α-helix	trans	-64.2	-48.5	177	-172.5	-179.7	178.9	-176.5	0	110.8	K79 S80 E85 R86 E87	K79-K83 PolarHBondContact O-N 2.84Å; S80-K83 WeakPolarHBondContact O-CB 3.25Å; S80-K83 PolarHBondContact O-N 2.94Å; S80-K83 VanDerWaalsContact O-N 3.1Å; K83-E85 PolarHBondContact O-N 3Å; K83-R86 WeakPolarHBondContact O-CB 3.48Å; K83-R86 PolarHBondContact O-N 3.12Å; K83-R86 VanDerWaalsContact O-N 3.14Å; K83-E87 WeakPolarHBondContact O-CG 3.44Å; K83-E87 PolarHBondContact O-N 3.2Å
84	Q	95.6	Very high	91.9	Very high	142 Å²	142	112.7 Å²	112.7	66%	0.664	53%	0.532	S	S	*	.	H	α-helix	trans	-58.4	-45.7	177.4	-171.7	-174	27.8	0	0	111.9	S80 K81 R86 E87 R88	S80-Q84 PolarHBondContact O-N 3.38Å; K81-Q84 PolarHBondContact O-N 3.29Å; Q84-R86 VanDerWaalsContact C-N 3.31Å; Q84-R86 PolarHBondContact O-N 3.28Å; Q84-E87 PolarHBondContact O-N 2.83Å; Q84-R88 WeakPolarHBondContact O-CB 3.42Å; Q84-R88 PolarHBondContact O-N 2.77Å
85	E	95.4	Very high	90.6	Very high	61 Å²	61	117.8 Å²	117.8	29%	0.285	56%	0.555	S	S	.	*	H	α-helix	trans	-64.1	-36.3	176.9	175.7	57.5	-162.7	0	0	112.2	K81 K83 R88 R89	K81-E85 WeakPolarHBondContact O-CB 3.29Å; K81-E85 PolarHBondContact O-N 3.49Å; K83-E85 PolarHBondContact O-N 3Å; E85-R88 PolarHBondContact O-N 3.43Å; E85-R88 IonicContact OE1-CZ 2.74Å; E85-R88 IonicContact OE1-NE 3.49Å; E85-R88 IonicContact OE1-NH2 3.64Å; E85-R88 PolarHBondContact OE1-NH2 2.95Å; E85-R88 IonicContact OE2-CZ 2.77Å; E85-R88 IonicContact OE2-NE 3.59Å; E85-R88 PolarHBondContact OE2-NE 3.45Å; E85-R88 IonicContact OE2-NH2 2.77Å; E85-R88 PolarHBondContact OE2-NH2 2.85Å; E85-R89 VanDerWaalsContact O-CG 3.29Å; E85-R89 WeakPolarHBondContact O-CG 3.42Å; E85-R89 PolarHBondContact O-N 2.97Å; E85-R89 IonicContact OE1-CZ 3.48Å; E85-R89 IonicContact OE1-NE 2.83Å; E85-R89 PolarHBondContact OE1-NE 3.31Å; E85-R89 IonicContact OE1-NH2 3.28Å; E85-R89 PolarHBondContact OE1-NH2 3.39Å
86	R	93.4	Very high	89	Confident	167 Å²	167	118.5 Å²	118.5	63%	0.63	56%	0.556	S	S	*	*	H	α-helix	trans	-63.6	-45.6	173.9	-174	-179.8	-174.9	-179.8	0.2	111.4	R82 K83 Q84 R89 K90	R82-R86 WeakPolarHBondContact O-CB 3.49Å; R82-R86 PolarHBondContact O-N 2.94Å; K83-R86 WeakPolarHBondContact O-CB 3.48Å; K83-R86 PolarHBondContact O-N 3.12Å; K83-R86 VanDerWaalsContact O-N 3.14Å; Q84-R86 VanDerWaalsContact C-N 3.31Å; Q84-R86 PolarHBondContact O-N 3.28Å; R86-R89 PolarHBondContact O-N 2.77Å; R86-K90 WeakPolarHBondContact O-CG 3.45Å; R86-K90 PolarHBondContact O-N 3.3Å
87	E	93	Very high	87.1	Confident	85 Å²	85	120.8 Å²	120.8	40%	0.397	57%	0.57	S	S	.	*	H	α-helix	trans	-65.9	-41.3	177.4	-64	-49.6	129.7	0	0	111.4	K83 Q84 R89 K90 A91	K83-E87 WeakPolarHBondContact O-CG 3.44Å; K83-E87 PolarHBondContact O-N 3.2Å; Q84-E87 PolarHBondContact O-N 2.83Å; E87-R89 VanDerWaalsContact C-N 3.29Å; E87-R89 PolarHBondContact O-N 2.74Å; E87-K90 WeakPolarHBondContact O-CB 3.47Å; E87-K90 PolarHBondContact O-N 3.31Å; E87-K90 VanDerWaalsContact O-N 3.1Å; E87-K90 IonicContact OE1-NZ 3.49Å; E87-K90 PolarHBondContact OE1-NZ 3.14Å; E87-K90 WeakPolarHBondContact OE2-CD 3.34Å; E87-K90 IonicContact OE2-NZ 3.38Å; E87-K90 PolarHBondContact OE2-NZ 2.94Å; E87-A91 PolarHBondContact O-N 2.8Å
88	R	92.7	Very high	85.2	Confident	109 Å²	109	120.8 Å²	120.8	41%	0.411	58%	0.582	S	S	.	*	H	α-helix	trans	-56.6	-41.9	172.6	-168.7	-165.7	68.7	76.8	0	112.1	Q84 E85 K92	Q84-R88 WeakPolarHBondContact O-CB 3.42Å; Q84-R88 PolarHBondContact O-N 2.77Å; E85-R88 PolarHBondContact O-N 3.43Å; E85-R88 IonicContact OE1-CZ 2.74Å; E85-R88 IonicContact OE1-NE 3.49Å; E85-R88 IonicContact OE1-NH2 3.64Å; E85-R88 PolarHBondContact OE1-NH2 2.95Å; E85-R88 IonicContact OE2-CZ 2.77Å; E85-R88 IonicContact OE2-NE 3.59Å; E85-R88 PolarHBondContact OE2-NE 3.45Å; E85-R88 IonicContact OE2-NH2 2.77Å; E85-R88 PolarHBondContact OE2-NH2 2.85Å; R88-K92 VanDerWaalsContact NH1-CD 3.29Å; R88-K92 WeakPolarHBondContact O-CB 3.4Å; R88-K92 WeakPolarHBondContact O-CG 3.43Å; R88-K92 PolarHBondContact O-N 3Å
89	R	87.9	Confident	83.1	Confident	149 Å²	149	119.2 Å²	119.2	56%	0.562	58%	0.579	S	S	*	*	H	α-helix	trans	-67.4	-37	176.4	-72.5	173.7	-170.5	-172.2	0.6	112.7	E85 R86 E87 R93	E85-R89 VanDerWaalsContact O-CG 3.29Å; E85-R89 WeakPolarHBondContact O-CG 3.42Å; E85-R89 PolarHBondContact O-N 2.97Å; E85-R89 IonicContact OE1-CZ 3.48Å; E85-R89 IonicContact OE1-NE 2.83Å; E85-R89 PolarHBondContact OE1-NE 3.31Å; E85-R89 IonicContact OE1-NH2 3.28Å; E85-R89 PolarHBondContact OE1-NH2 3.39Å; R86-R89 PolarHBondContact O-N 2.77Å; E87-R89 VanDerWaalsContact C-N 3.29Å; E87-R89 PolarHBondContact O-N 2.74Å; R89-R93 WeakPolarHBondContact O-CG 3.46Å; R89-R93 PolarHBondContact O-N 3.38Å; R89-R93 VanDerWaalsContact O-N 3.13Å
90	K	86.1	Confident	81	Confident	98 Å²	98	114.6 Å²	114.6	43%	0.426	57%	0.573	S	S	.	*	H	α-helix	trans	-66	-46.6	174.4	-72.1	173.1	178.3	173.2	0	111	R86 E87 R93 A94	R86-K90 WeakPolarHBondContact O-CG 3.45Å; R86-K90 PolarHBondContact O-N 3.3Å; E87-K90 WeakPolarHBondContact O-CB 3.47Å; E87-K90 PolarHBondContact O-N 3.31Å; E87-K90 VanDerWaalsContact O-N 3.1Å; E87-K90 IonicContact OE1-NZ 3.49Å; E87-K90 PolarHBondContact OE1-NZ 3.14Å; E87-K90 WeakPolarHBondContact OE2-CD 3.34Å; E87-K90 IonicContact OE2-NZ 3.38Å; E87-K90 PolarHBondContact OE2-NZ 2.94Å; K90-R93 WeakPolarHBondContact O-CB 3.46Å; K90-R93 PolarHBondContact O-N 3.26Å; K90-R93 VanDerWaalsContact O-N 3.12Å; K90-A94 PolarHBondContact O-N 2.99Å
91	A	85.9	Confident	78.9	Confident	45 Å²	45	117.9 Å²	117.9	37%	0.372	59%	0.59	S	S	.	*	H	α-helix	trans	-58.7	-48.6	176.2	0	0	0	0	0	111.3	E87 R93 A94 E95	E87-A91 PolarHBondContact O-N 2.8Å; A91-R93 PolarHBondContact O-N 3.43Å; A91-A94 PolarHBondContact O-N 3.33Å; A91-E95 PolarHBondContact O-N 2.86Å
92	K	80.9	Confident	76.8	Confident	136 Å²	136	113.8 Å²	113.8	59%	0.591	58%	0.58	S	S	*	*	H	α-helix	trans	-58.4	-32.1	174.5	-79.3	-153.3	171.4	-167.2	0	114.3	R88	R88-K92 VanDerWaalsContact NH1-CD 3.29Å; R88-K92 WeakPolarHBondContact O-CB 3.4Å; R88-K92 WeakPolarHBondContact O-CG 3.43Å; R88-K92 PolarHBondContact O-N 3Å
93	R	74.9	Confident	75.1	Confident	182 Å²	182	109.3 Å²	109.3	69%	0.687	58%	0.576	S	S	*	*	H	α-helix	trans	-74	-28.7	174.9	-76.2	176	-178.9	-97.7	-0.1	112.6	R89 K90 A91	R89-R93 WeakPolarHBondContact O-CG 3.46Å; R89-R93 PolarHBondContact O-N 3.38Å; R89-R93 VanDerWaalsContact O-N 3.13Å; K90-R93 WeakPolarHBondContact O-CB 3.46Å; K90-R93 PolarHBondContact O-N 3.26Å; K90-R93 VanDerWaalsContact O-N 3.12Å; A91-R93 PolarHBondContact O-N 3.43Å
94	A	72.4	Confident	73.7	Confident	84 Å²	84	109.1 Å²	109.1	69%	0.694	58%	0.577	S	S	*	*	H	α-helix	trans	-80.6	-33	177.4	0	0	0	0	0	112.3	K90 A91	K90-A94 PolarHBondContact O-N 2.99Å; A91-A94 PolarHBondContact O-N 3.33Å
95	E	71.1	Confident	72.7	Confident	156 Å²	156	105.1 Å²	105.1	73%	0.729	56%	0.558	S	S	*	*	S	Bend	trans	-84.9	-2.3	-179.5	-69.8	-178	-177.3	0	0	114.8	A91 P97	A91-E95 PolarHBondContact O-N 2.86Å; E95-P97 WeakPolarHBondContact O-CD 3.46Å
96	D	64.3	Low	72.2	Confident	84 Å²	84	105.7 Å²	105.7	45%	0.449	57%	0.569	S	S	.	*			trans	-99.1	81.8	173.1	-170	-5	0	0	0	110.2	G98 N99	D96-G98 PolarHBondContact O-N 2.92Å; D96-G98 PolarHBondContact OD1-N 3.47Å; D96-N99 PolarHBondContact O-N 3.11Å
97	P	56.7	Low	71.8	Confident	118 Å²	118	105.4 Å²	105.4	77%	0.766	57%	0.573	S	S	*	*	G	3₁₀ helix	trans	-67.4	-13.6	177.1	28.6	-35.2	0	0	0	112.3	E95 N99 G100	E95-P97 WeakPolarHBondContact O-CD 3.46Å; P97-N99 PolarHBondContact O-N 3.04Å; P97-G100 PolarHBondContact O-N 3.32Å
98	G	55.3	Low	71.6	Confident	76 Å²	76	111.6 Å²	111.6	78%	0.784	59%	0.592	S	S	*	*	G	3₁₀ helix	trans	-73.5	-15.5	174.5	0	0	0	0	0	113.7	D96	D96-G98 PolarHBondContact O-N 2.92Å; D96-G98 PolarHBondContact OD1-N 3.47Å
99	N	54.6	Low	71.5	Confident	95 Å²	95	110.7 Å²	110.7	51%	0.508	59%	0.592	S	S	.	*	G	3₁₀ helix	trans	-116.9	19.9	174.9	-159.6	91.3	0	0	0	111.5	D96 P97	D96-N99 PolarHBondContact O-N 3.11Å; P97-N99 PolarHBondContact O-N 3.04Å
100	G	54.3	Low	71.7	Confident	49 Å²	49	107.6 Å²	107.6	51%	0.505	59%	0.586	S	S	.	*	T	Hydrogen-bonded Turn	trans	-96.6	20.3	-159.1	0	0	0	0	0	118.7	P97	P97-G100 PolarHBondContact O-N 3.32Å
101	T	51.3	Low	72	Confident	146 Å²	146	108.9 Å²	108.9	90%	0.896	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-135.1	12.3	176.1	52.8	0	0	0	0	115.8
102	C	53.8	Low	72.4	Confident	68 Å²	68	109.4 Å²	109.4	46%	0.459	60%	0.595	S	S	.	*	S	Bend	trans	-143.2	127.7	177.4	-148.1	0	0	0	0	110.5	Q104 H105	C102-Q104 PolarHBondContact O-N 2.89Å; C102-H105 PolarHBondContact SG-CD2 3.1Å; C102-H105 PolarHBondContact SG-NE2 3.49Å
103	P	61.2	Low	73	Confident	98 Å²	98	105.8 Å²	105.8	64%	0.636	58%	0.582	S	S	*	*			trans	-47	122.1	158.8	-15.3	26.5	0	0	0	105	H105	P103-H105 WeakPolarHBondContact O-CA 3.34Å; P103-H105 PolarHBondContact O-CD2 2.97Å; P103-H105 VanDerWaalsContact O-CG 3.25Å; P103-H105 PolarHBondContact O-N 3.08Å
104	Q	67.4	Low	74	Confident	143 Å²	143	101.5 Å²	101.5	67%	0.668	58%	0.576	S	S	*	*			trans	-60.1	88.4	-175.4	-167.1	-179.7	11.1	0	0	107.4	C102 S106	C102-Q104 PolarHBondContact O-N 2.89Å; Q104-S106 PolarHBondContact O-N 3.34Å
105	H	73.9	Confident	75.1	Confident	58 Å²	58	104.3 Å²	104.3	27%	0.269	57%	0.573	S	S	.	*			trans	-64.9	136.2	-167.9	-75.1	-56.3	0	0	0	105.9	C102 P103 K107 F109 L110	C102-H105 PolarHBondContact SG-CD2 3.1Å; C102-H105 PolarHBondContact SG-NE2 3.49Å; P103-H105 WeakPolarHBondContact O-CA 3.34Å; P103-H105 PolarHBondContact O-CD2 2.97Å; P103-H105 VanDerWaalsContact O-CG 3.25Å; P103-H105 PolarHBondContact O-N 3.08Å; H105-K107 PolarHBondContact O-N 2.57Å; H105-F109 HydrophobicContact CB-CB 4.06Å; H105-F109 HydrophobicContact CB-CD1 3.3Å; H105-F109 HydrophobicContact CB-CE1 3.95Å; H105-F109 HydrophobicContact CB-CG 3.9Å; H105-F109 AromaticContact CD2-CD1 3.74Å; H105-F109 AromaticContact CD2-CE1 3.43Å; H105-F109 VanDerWaalsContact CD2-CE1 3.43Å; H105-F109 WeakPolarHBondContact CD2-CE1 3.46Å; H105-F109 AromaticContact CE1-CE1 3.44Å; H105-F109 VanDerWaalsContact CE1-CE1 3.44Å; H105-F109 WeakPolarHBondContact CE1-CE1 3.48Å; H105-F109 AromaticContact CE1-CZ 3.66Å; H105-F109 AromaticContact CG-CD1 3.22Å; H105-F109 AromaticContact CG-CE1 3.32Å; H105-F109 AromaticContact ND1-CD1 3.46Å; H105-F109 WeakPolarHBondContact ND1-CD1 3.33Å; H105-F109 AromaticContact ND1-CE1 3.32Å; H105-F109 VanDerWaalsContact ND1-CE1 3.32Å; H105-F109 WeakPolarHBondContact ND1-CE1 3.46Å; H105-F109 AromaticContact ND1-CG 3.96Å; H105-F109 AromaticContact ND1-CZ 3.75Å; H105-F109 AromaticContact NE2-CE1 3.5Å; H105-L110 HydrophobicContact CB-CD2 3.87Å; H105-L110 HydrophobicContact CB-CG 3.87Å
106	S	84	Confident	76.3	Confident	73 Å²	73	102.7 Å²	102.7	51%	0.51	57%	0.565	S	S	.	*			trans	-52.4	145.3	178.4	75.2	0	0	0	0	108.8	Q104 R108 F109 L110	Q104-S106 PolarHBondContact O-N 3.34Å; S106-R108 CarbonylContact O-C 3.6Å; S106-R108 PolarHBondContact O-N 3.43Å; S106-F109 WeakPolarHBondContact O-CA 3.35Å; S106-F109 WeakPolarHBondContact O-CB 3.43Å; S106-F109 PolarHBondContact O-N 3.1Å; S106-F109 PolarHBondContact OG-N 3.13Å; S106-F109 VanDerWaalsContact OG-N 3.12Å; S106-L110 PolarHBondContact O-N 2.86Å; S106-L110 VanDerWaalsContact O-N 3.1Å
107	K	86.4	Confident	77.8	Confident	162 Å²	162	104.8 Å²	104.8	70%	0.704	57%	0.57	S	S	*	*	H	α-helix	trans	-50.8	-29.4	176	-175	176	-178.1	174.1	0	111.9	H105 K111	H105-K107 PolarHBondContact O-N 2.57Å; K107-K111 WeakPolarHBondContact O-CB 3.48Å; K107-K111 VanDerWaalsContact O-CG 3.25Å; K107-K111 WeakPolarHBondContact O-CG 3.46Å; K107-K111 PolarHBondContact O-N 2.99Å
108	R	88.7	Confident	79.6	Confident	215 Å²	215	103.9 Å²	103.9	81%	0.811	56%	0.559	S	S	*	*	H	α-helix	trans	-67.6	-43.9	173.8	-66.2	-174.3	-180	-165.5	0.2	112.4	S106 K111 A112	S106-R108 CarbonylContact O-C 3.6Å; S106-R108 PolarHBondContact O-N 3.43Å; R108-K111 PolarHBondContact O-N 3.49Å; R108-A112 WeakPolarHBondContact O-CB 3.44Å; R108-A112 PolarHBondContact O-N 3.02Å
109	F	91.3	Very high	81.4	Confident	90 Å²	90	104.8 Å²	104.8	40%	0.395	55%	0.545	S	S	.	.	H	α-helix	trans	-61.5	-48.8	175.9	178.3	-83.5	0	0	0	111.9	H105 S106 K111 A112 L113	H105-F109 HydrophobicContact CB-CB 4.06Å; H105-F109 HydrophobicContact CB-CD1 3.3Å; H105-F109 HydrophobicContact CB-CE1 3.95Å; H105-F109 HydrophobicContact CB-CG 3.9Å; H105-F109 AromaticContact CD2-CD1 3.74Å; H105-F109 AromaticContact CD2-CE1 3.43Å; H105-F109 VanDerWaalsContact CD2-CE1 3.43Å; H105-F109 WeakPolarHBondContact CD2-CE1 3.46Å; H105-F109 AromaticContact CE1-CE1 3.44Å; H105-F109 VanDerWaalsContact CE1-CE1 3.44Å; H105-F109 WeakPolarHBondContact CE1-CE1 3.48Å; H105-F109 AromaticContact CE1-CZ 3.66Å; H105-F109 AromaticContact CG-CD1 3.22Å; H105-F109 AromaticContact CG-CE1 3.32Å; H105-F109 AromaticContact ND1-CD1 3.46Å; H105-F109 WeakPolarHBondContact ND1-CD1 3.33Å; H105-F109 AromaticContact ND1-CE1 3.32Å; H105-F109 VanDerWaalsContact ND1-CE1 3.32Å; H105-F109 WeakPolarHBondContact ND1-CE1 3.46Å; H105-F109 AromaticContact ND1-CG 3.96Å; H105-F109 AromaticContact ND1-CZ 3.75Å; H105-F109 AromaticContact NE2-CE1 3.5Å; S106-F109 WeakPolarHBondContact O-CA 3.35Å; S106-F109 WeakPolarHBondContact O-CB 3.43Å; S106-F109 PolarHBondContact O-N 3.1Å; S106-F109 PolarHBondContact OG-N 3.13Å; S106-F109 VanDerWaalsContact OG-N 3.12Å; F109-K111 VanDerWaalsContact C-N 3.27Å; F109-K111 PolarHBondContact O-N 2.72Å; F109-A112 WeakPolarHBondContact O-CB 3.32Å; F109-A112 PolarHBondContact O-N 3.17Å; F109-A112 VanDerWaalsContact O-N 3.08Å; F109-L113 HydrophobicContact CE1-CD2 4.32Å; F109-L113 WeakPolarHBondContact O-CB 3.46Å; F109-L113 PolarHBondContact O-N 3.42Å
110	L	90.2	Very high	83.3	Confident	84 Å²	84	106.4 Å²	106.4	44%	0.44	55%	0.55	S	S	.	.	H	α-helix	trans	-61.2	-38.6	179.1	-67.4	175.4	0	0	0	111.9	H105 S106 T114	H105-L110 HydrophobicContact CB-CD2 3.87Å; H105-L110 HydrophobicContact CB-CG 3.87Å; S106-L110 PolarHBondContact O-N 2.86Å; S106-L110 VanDerWaalsContact O-N 3.1Å; L110-T114 WeakPolarHBondContact O-CB 3.43Å; L110-T114 PolarHBondContact O-N 3.07Å; L110-T114 PolarHBondContact O-OG1 3.41Å
111	K	93.4	Very high	85.1	Confident	125 Å²	125	106.8 Å²	106.8	54%	0.543	55%	0.548	S	S	.	.	H	α-helix	trans	-64.6	-41.1	173.8	-77.3	-179.6	173.9	-164.9	0	112.5	K107 R108 F109 T114 K115	K107-K111 WeakPolarHBondContact O-CB 3.48Å; K107-K111 VanDerWaalsContact O-CG 3.25Å; K107-K111 WeakPolarHBondContact O-CG 3.46Å; K107-K111 PolarHBondContact O-N 2.99Å; R108-K111 PolarHBondContact O-N 3.49Å; F109-K111 VanDerWaalsContact C-N 3.27Å; F109-K111 PolarHBondContact O-N 2.72Å; K111-T114 PolarHBondContact O-N 3.22Å; K111-K115 WeakPolarHBondContact O-CG 3.45Å; K111-K115 PolarHBondContact O-N 3.48Å
112	A	94.9	Very high	86.9	Confident	55 Å²	55	106.6 Å²	106.6	46%	0.455	54%	0.535	S	S	.	.	H	α-helix	trans	-63.7	-49.1	177.2	0	0	0	0	0	110.8	R108 F109 T114 K115 E116	R108-A112 WeakPolarHBondContact O-CB 3.44Å; R108-A112 PolarHBondContact O-N 3.02Å; F109-A112 WeakPolarHBondContact O-CB 3.32Å; F109-A112 PolarHBondContact O-N 3.17Å; F109-A112 VanDerWaalsContact O-N 3.08Å; A112-T114 VanDerWaalsContact C-N 3.29Å; A112-T114 PolarHBondContact O-N 3Å; A112-K115 WeakPolarHBondContact O-CB 3.32Å; A112-K115 PolarHBondContact O-N 2.97Å; A112-K115 VanDerWaalsContact O-N 3.11Å; A112-E116 PolarHBondContact O-N 3Å
113	L	93.8	Very high	88.7	Confident	60 Å²	60	111 Å²	111	31%	0.314	55%	0.548	S	S	.	.	H	α-helix	trans	-58.1	-41.1	177.1	-174.5	69.9	0	0	0	112.2	F109 E116 K117	F109-L113 HydrophobicContact CE1-CD2 4.32Å; F109-L113 WeakPolarHBondContact O-CB 3.46Å; F109-L113 PolarHBondContact O-N 3.42Å; L113-E116 PolarHBondContact O-N 3.47Å; L113-K117 WeakPolarHBondContact O-CG 3.42Å; L113-K117 PolarHBondContact O-N 3.07Å; L113-K117 VanDerWaalsContact O-N 3.07Å
114	T	94.9	Very high	90.1	Very high	92 Å²	92	110.8 Å²	110.8	56%	0.564	55%	0.549	S	S	*	.	H	α-helix	trans	-67.1	-40.2	177.7	-52.8	0	0	0	0	111.5	L110 K111 A112 L118	L110-T114 WeakPolarHBondContact O-CB 3.43Å; L110-T114 PolarHBondContact O-N 3.07Å; L110-T114 PolarHBondContact O-OG1 3.41Å; K111-T114 PolarHBondContact O-N 3.22Å; A112-T114 VanDerWaalsContact C-N 3.29Å; A112-T114 PolarHBondContact O-N 3Å; T114-L118 WeakPolarHBondContact O-CB 3.43Å; T114-L118 PolarHBondContact O-N 3.24Å
115	K	96.2	Very high	91.2	Very high	144 Å²	144	105.3 Å²	105.3	63%	0.626	53%	0.531	S	S	*	.	H	α-helix	trans	-63.9	-44	176.3	-77.1	-179.9	176.6	-169.1	0	111.6	K111 A112 L118 L119	K111-K115 WeakPolarHBondContact O-CG 3.45Å; K111-K115 PolarHBondContact O-N 3.48Å; A112-K115 WeakPolarHBondContact O-CB 3.32Å; A112-K115 PolarHBondContact O-N 2.97Å; A112-K115 VanDerWaalsContact O-N 3.11Å; K115-L118 PolarHBondContact O-N 3.12Å; K115-L119 WeakPolarHBondContact O-CG 3.43Å; K115-L119 PolarHBondContact O-N 3.29Å
116	E	95.6	Very high	92	Very high	121 Å²	121	109.1 Å²	109.1	57%	0.565	56%	0.561	S	S	*	*	H	α-helix	trans	-57	-54.3	176.7	-175.7	-174.8	176.4	0	0	110.9	A112 L113 L118 L119 E120	A112-E116 PolarHBondContact O-N 3Å; L113-E116 PolarHBondContact O-N 3.47Å; E116-L118 VanDerWaalsContact C-N 3.29Å; E116-L118 PolarHBondContact O-N 2.97Å; E116-L119 PolarHBondContact O-N 3.07Å; E116-L119 VanDerWaalsContact O-N 3.12Å; E116-E120 PolarHBondContact O-N 3.23Å
117	K	94.9	Very high	92.2	Very high	128 Å²	128	116 Å²	116	56%	0.557	58%	0.576	S	S	*	*	H	α-helix	trans	-59.5	-37.8	177.7	-71.4	-171.9	174	-169.6	0	113.4	L113 E120 A121	L113-K117 WeakPolarHBondContact O-CG 3.42Å; L113-K117 PolarHBondContact O-N 3.07Å; L113-K117 VanDerWaalsContact O-N 3.07Å; K117-E120 PolarHBondContact O-N 3.16Å; K117-A121 WeakPolarHBondContact O-CB 3.35Å; K117-A121 PolarHBondContact O-N 2.97Å
118	L	94.8	Very high	92.5	Very high	100 Å²	100	116 Å²	116	52%	0.524	58%	0.582	S	S	.	*	H	α-helix	trans	-66.2	-41	177.3	-178.7	66.4	0	0	0	111.7	T114 K115 E116 A121 K122	T114-L118 WeakPolarHBondContact O-CB 3.43Å; T114-L118 PolarHBondContact O-N 3.24Å; K115-L118 PolarHBondContact O-N 3.12Å; E116-L118 VanDerWaalsContact C-N 3.29Å; E116-L118 PolarHBondContact O-N 2.97Å; L118-A121 PolarHBondContact O-N 3.38Å; L118-K122 VanDerWaalsContact O-CG 3.32Å; L118-K122 WeakPolarHBondContact O-CG 3.28Å; L118-K122 PolarHBondContact O-N 3.17Å
119	L	94.3	Very high	92.7	Very high	95 Å²	95	110.6 Å²	110.6	50%	0.497	58%	0.577	S	S	.	*	H	α-helix	trans	-64.2	-45.1	176.1	-71.4	169.9	0	0	0	110.6	K115 E116 A121 K122 H123	K115-L119 WeakPolarHBondContact O-CG 3.43Å; K115-L119 PolarHBondContact O-N 3.29Å; E116-L119 PolarHBondContact O-N 3.07Å; E116-L119 VanDerWaalsContact O-N 3.12Å; L119-A121 VanDerWaalsContact C-N 3.34Å; L119-A121 PolarHBondContact O-N 3.21Å; L119-K122 WeakPolarHBondContact O-CB 3.46Å; L119-K122 PolarHBondContact O-N 2.62Å; L119-K122 VanDerWaalsContact O-N 3.17Å; L119-H123 PolarHBondContact O-CD2 2.93Å; L119-H123 PolarHBondContact O-N 3.12Å
120	E	93.8	Very high	92.9	Very high	129 Å²	129	111.4 Å²	111.4	60%	0.603	59%	0.589	S	S	*	*	H	α-helix	trans	-57.3	-45.8	175.9	-173.3	-178.5	-176.2	0	0	112.2	E116 K117 K122 H123 S124	E116-E120 PolarHBondContact O-N 3.23Å; K117-E120 PolarHBondContact O-N 3.16Å; E120-K122 VanDerWaalsContact C-N 3.33Å; E120-K122 PolarHBondContact O-N 3.07Å; E120-H123 PolarHBondContact O-N 3.34Å; E120-S124 WeakPolarHBondContact O-CB 3.48Å; E120-S124 PolarHBondContact O-N 2.77Å; E120-S124 PolarHBondContact O-OG 2.98Å
121	A	91.8	Very high	93.1	Very high	57 Å²	57	113.4 Å²	113.4	47%	0.471	60%	0.6	S	S	.	*	H	α-helix	trans	-64.5	-35	177.5	0	0	0	0	0	112.9	K117 L118 L119 H123 G125	K117-A121 WeakPolarHBondContact O-CB 3.35Å; K117-A121 PolarHBondContact O-N 2.97Å; L118-A121 PolarHBondContact O-N 3.38Å; L119-A121 VanDerWaalsContact C-N 3.34Å; L119-A121 PolarHBondContact O-N 3.21Å; A121-H123 VanDerWaalsContact C-N 3.28Å; A121-H123 PolarHBondContact O-N 3.32Å; A121-G125 PolarHBondContact O-N 3.03Å
122	K	89.7	Confident	93.1	Very high	142 Å²	142	113.1 Å²	113.1	62%	0.617	60%	0.604	S	S	*	*	H	α-helix	trans	-65.1	-32.4	176.1	-77.3	177.1	176.3	-170.8	0	112.9	L118 L119 E120	L118-K122 VanDerWaalsContact O-CG 3.32Å; L118-K122 WeakPolarHBondContact O-CG 3.28Å; L118-K122 PolarHBondContact O-N 3.17Å; L119-K122 WeakPolarHBondContact O-CB 3.46Å; L119-K122 PolarHBondContact O-N 2.62Å; L119-K122 VanDerWaalsContact O-N 3.17Å; E120-K122 VanDerWaalsContact C-N 3.33Å; E120-K122 PolarHBondContact O-N 3.07Å
123	H	90.4	Very high	93.1	Very high	159 Å²	159	114.1 Å²	114.1	74%	0.736	61%	0.607	S	S	*	*	H	α-helix	trans	-88.8	-32.6	-178.2	-66	-57.8	0	0	0	113	L119 E120 A121	L119-H123 PolarHBondContact O-CD2 2.93Å; L119-H123 PolarHBondContact O-N 3.12Å; E120-H123 PolarHBondContact O-N 3.34Å; A121-H123 VanDerWaalsContact C-N 3.28Å; A121-H123 PolarHBondContact O-N 3.32Å
124	S	92.3	Very high	93.1	Very high	94 Å²	94	116.6 Å²	116.6	66%	0.657	62%	0.619	S	S	*	*	H	α-helix	trans	-89.6	-18.4	-179	57.2	0	0	0	0	114.1	E120	E120-S124 WeakPolarHBondContact O-CB 3.48Å; E120-S124 PolarHBondContact O-N 2.77Å; E120-S124 PolarHBondContact O-OG 2.98Å
125	G	89.5	Confident	93.1	Very high	29 Å²	29	116.3 Å²	116.3	30%	0.299	62%	0.617	S	S	.	*	S	Bend	trans	-69.5	150.5	-176.1	0	0	0	0	0	114.2	A121 R127	A121-G125 PolarHBondContact O-N 3.03Å; G125-R127 PolarHBondContact O-N 3.19Å
126	P	91	Very high	92.9	Very high	138 Å²	138	118 Å²	118	90%	0.896	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-60.1	136.6	173.6	25.6	-32.9	0	0	0	110.5
127	R	88.9	Confident	92.8	Very high	218 Å²	218	119.1 Å²	119.1	82%	0.823	63%	0.632	S	S	*	*	P	Polyproline II helix	trans	-97.1	127.5	-179.7	-62	178.5	68	-166.2	0.1	109.7	G125	G125-R127 PolarHBondContact O-N 3.19Å
128	L	91.4	Very high	92.7	Very high	160 Å²	160	119.9 Å²	119.9	84%	0.838	64%	0.639	S	S	*	*			trans	-84.5	115.6	166.9	179	63.7	0	0	0	108.6	V130	L128-V130 HydrophobicContact CG-CG2 4.31Å
129	C	93.1	Very high	92.6	Very high	103 Å²	103	120.2 Å²	120.2	70%	0.696	65%	0.65	S	S	*	*			trans	-106.7	120.9	173.2	-62.8	0	0	0	0	108.5
130	V	95.4	Very high	92.4	Very high	107 Å²	107	126.1 Å²	126.1	65%	0.648	67%	0.671	S	S	*	*			trans	-105	116.5	172.3	-177.5	0	0	0	0	107.2	L128 L132	L128-V130 HydrophobicContact CG-CG2 4.31Å; V130-L132 HydrophobicContact CG1-CD2 3.89Å
131	D	94.3	Very high	91.8	Very high	125 Å²	125	132.7 Å²	132.7	67%	0.668	70%	0.698	S	S	*	*			trans	-79.3	126.3	174.5	-175.8	16	0	0	0	110	S133	D131-S133 WeakPolarHBondContact OD1-CB 3.21Å; D131-S133 PolarHBondContact OD1-N 3.11Å; D131-S133 PolarHBondContact OD1-OG 2.86Å; D131-S133 VanDerWaalsContact OD1-OG 3.11Å; D131-S133 PolarHBondContact OD2-OG 3.44Å
132	L	94.3	Very high	91.8	Very high	120 Å²	120	136.5 Å²	136.5	63%	0.628	71%	0.709	S	S	*	*			trans	-109.6	6.8	179.5	-58.6	-179.6	0	0	0	112	V130 M134 T135	V130-L132 HydrophobicContact CG1-CD2 3.89Å; L132-M134 PolarHBondContact O-N 2.68Å; L132-T135 VanDerWaalsContact O-CB 3.28Å; L132-T135 WeakPolarHBondContact O-CB 2.86Å; L132-T135 PolarHBondContact O-N 3.2Å; L132-T135 VanDerWaalsContact O-N 3.07Å; L132-T135 PolarHBondContact O-OG1 2.99Å
133	S	95	Very high	91.9	Very high	75 Å²	75	136.2 Å²	136.2	52%	0.524	71%	0.714	S	S	.	*	G	3₁₀ helix	trans	-54.2	-36.2	179	65.9	0	0	0	0	112.7	D131 T135	D131-S133 WeakPolarHBondContact OD1-CB 3.21Å; D131-S133 PolarHBondContact OD1-N 3.11Å; D131-S133 PolarHBondContact OD1-OG 2.86Å; D131-S133 VanDerWaalsContact OD1-OG 3.11Å; D131-S133 PolarHBondContact OD2-OG 3.44Å; S133-T135 VanDerWaalsContact C-N 3.28Å; S133-T135 PolarHBondContact O-N 3.2Å
134	M	93.6	Very high	92	Very high	113 Å²	113	134.9 Å²	134.9	56%	0.557	71%	0.713	S	S	*	*	G	3₁₀ helix	trans	-83.2	5	-178.3	-64.6	-59	-65.3	0	0	114.7	L132 Q136 H137	L132-M134 PolarHBondContact O-N 2.68Å; M134-Q136 PolarHBondContact O-N 3.43Å; M134-H137 HydrophobicContact CE-CB 4.18Å; M134-H137 PolarHBondContact O-N 3.37Å
135	T	94.2	Very high	92	Very high	85 Å²	85	137.3 Å²	137.3	52%	0.521	72%	0.716	S	S	.	*	G	3₁₀ helix	trans	-60.3	-31.7	-174.4	-56.5	0	0	0	0	112.6	L132 S133 H137 M138	L132-T135 VanDerWaalsContact O-CB 3.28Å; L132-T135 WeakPolarHBondContact O-CB 2.86Å; L132-T135 PolarHBondContact O-N 3.2Å; L132-T135 VanDerWaalsContact O-N 3.07Å; L132-T135 PolarHBondContact O-OG1 2.99Å; S133-T135 VanDerWaalsContact C-N 3.28Å; S133-T135 PolarHBondContact O-N 3.2Å; T135-H137 PolarHBondContact O-N 3.23Å; T135-M138 PolarHBondContact O-N 3.46Å
136	Q	93.6	Very high	92.1	Very high	180 Å²	180	144.1 Å²	144.1	84%	0.841	74%	0.742	S	S	*	*	G	3₁₀ helix	trans	-70.6	-16.7	179.3	-63.7	-175	-4.5	0	0	113.9	M134	M134-Q136 PolarHBondContact O-N 3.43Å
137	H	93.3	Very high	92.2	Very high	144 Å²	144	144.5 Å²	144.5	67%	0.667	73%	0.732	S	S	*	*	G	3₁₀ helix	trans	-101.1	-0.6	-179.5	-57.7	-61.9	0	0	0	113.1	M134 T135	M134-H137 HydrophobicContact CE-CB 4.18Å; M134-H137 PolarHBondContact O-N 3.37Å; T135-H137 PolarHBondContact O-N 3.23Å
138	M	92.5	Very high	92.4	Very high	145 Å²	145	139.2 Å²	139.2	71%	0.714	73%	0.726	S	S	*	*	S	Bend	trans	-87.8	135.3	-179.8	-66.5	-103.5	-61.9	0	0	110.6	T135	T135-M138 PolarHBondContact O-N 3.46Å
139	S	92.6	Very high	92.5	Very high	106 Å²	106	137.6 Å²	137.6	74%	0.741	72%	0.717	S	S	*	*			trans	-72.5	144.9	174.2	50.4	0	0	0	0	111.3	K141	S139-K141 PolarHBondContact O-N 3.24Å
140	K	89.2	Confident	92.4	Very high	219 Å²	219	140.5 Å²	140.5	95%	0.952	72%	0.719	S	S	*	*			trans	-70.4	113.5	170.5	-114.7	177.5	178.6	176.5	0	108.2
141	K	81.5	Confident	92.2	Very high	267 Å²	267	143.5 Å²	143.5	100%	1.161	73%	0.725	S	S	*	*			trans	-104.8	0	174.4	-120.6	-174.3	178	-174.5	0	110.6	S139	S139-K141 PolarHBondContact O-N 3.24Å

Retrieved 141 of 141 residues in 98.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).